Psyllid ID: psy12984


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MSKDTEKHLMNKITKREKKKLKILQSKEKSKPAEKDSDANEDEDQTNAVEVQLPGSDVALEILSSTQFEALKGKVCENTLKAIADMGFTKMTEIQARTIPPLLEGRDLVGSAKTGSGKTLAFLVPAVELIYNLKFMPRNGKSWQGKLRPLTNGVYLVACNVFKSTQPPTVIKVQTLIF
cccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHccccccccccccccccHHHHHcccccHHHHHHHHHcccccccHHHHHccccccccccEEEEcccccHHHHHHHHHHHHHHHHcccccccccEEEcccHHHHHHHHHHHHHHHHHccccccEEEEEEEc
ccHHHHHHHHHHHHHHHcHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHcccccHHHHHHHHHcccccccHHHHHccHHHHccccEEEEcccccHHHHHHHHHHHHHHHHccccccccccEEEEEccHHHHHHHHHHHHHHHcccccEEEEEEEEc
MSKDTEKHLMNKITKREKKKLKILQSkekskpaekdsdanededqtnavevqlpGSDVALEILSSTQFEALKGKVCENTLKAIADMGFTKMTEIQartippllegrdlvgsaktgsgktlAFLVPAVELIynlkfmprngkswqgklrpltnGVYLVACNVfkstqpptvikVQTLIF
mskdtekhlmnkitkrekkklkilqskekskpaekdsdanededqtnAVEVQLPGSDVALEILSSTQFEALKGKVCENTLKAIADMGFTKMTEIQARTIPPLLEGRDLVGSAKTGSGKTLAFLVPAVELIYNLKFMPRNGKSWQGKLRPLTNGVYLVACNvfkstqpptvikvqtlif
MSKDTEKHLMNkitkrekkklkilqskekskPAEKDSDANEDEDQTNAVEVQLPGSDVALEILSSTQFEALKGKVCENTLKAIADMGFTKMTEIQARTIPPLLEGRDLVGSAKTGSGKTLAFLVPAVELIYNLKFMPRNGKSWQGKLRPLTNGVYLVACNVFKSTQPPTVIKVQTLIF
********************************************************DVALEILSSTQFEALKGKVCENTLKAIADMGFTKMTEIQARTIPPLLEGRDLVGSAKTGSGKTLAFLVPAVELIYNLKFMPRNGKSWQGKLRPLTNGVYLVACNVFKSTQPPTVIKVQTL**
******************************************************************QFEALKGKVCENTLKAIADMGFTKMTEIQARTIPPLLEGRDLVGSAKTGSGKTLAFLVPAVELIYNLKFMPRNGKSWQGKLRPLTNGVYLVACNVFKSTQPPTVIKVQTLIF
*********MNKITKREKKKLKIL**********************NAVEVQLPGSDVALEILSSTQFEALKGKVCENTLKAIADMGFTKMTEIQARTIPPLLEGRDLVGSAKTGSGKTLAFLVPAVELIYNLKFMPRNGKSWQGKLRPLTNGVYLVACNVFKSTQPPTVIKVQTLIF
**********NKITKRE**********************************************SSTQFEALKGKVCENTLKAIADMGFTKMTEIQARTIPPLLEGRDLVGSAKTGSGKTLAFLVPAVELIYNLKFMPRNGKSWQGKLRPLTNGVYLVACNVFKSTQPPTVIKVQTLIF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKDTEKHLMNKITKREKKKLKILQSKEKSKPAEKDSDANEDEDQTNAVEVQLPGSDVALEILSSTQFEALKGKVCENTLKAIADMGFTKMTEIQARTIPPLLEGRDLVGSAKTGSGKTLAFLVPAVELIYNLKFMPRNGKSWQGKLRPLTNGVYLVACNVFKSTQPPTVIKVQTLIF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query178 2.2.26 [Sep-21-2011]
Q9NVP1 670 ATP-dependent RNA helicas yes N/A 0.617 0.164 0.537 2e-26
Q9VD51 680 Probable ATP-dependent RN yes N/A 0.646 0.169 0.549 6e-26
A4R8B5 587 ATP-dependent RNA helicas N/A N/A 0.584 0.177 0.536 9e-25
Q8K363 660 ATP-dependent RNA helicas yes N/A 0.634 0.171 0.530 2e-24
Q6BH93 568 ATP-dependent RNA helicas yes N/A 0.370 0.116 0.712 7e-24
A1CIQ5 625 ATP-dependent RNA helicas N/A N/A 0.601 0.171 0.531 2e-23
Q03532 505 ATP-dependent RNA helicas yes N/A 0.516 0.182 0.527 2e-23
A5DID7 569 ATP-dependent RNA helicas N/A N/A 0.415 0.130 0.644 6e-23
A5E2Z9 559 ATP-dependent RNA helicas N/A N/A 0.477 0.152 0.557 7e-23
Q5AK59 565 ATP-dependent RNA helicas N/A N/A 0.359 0.113 0.734 7e-23
>sp|Q9NVP1|DDX18_HUMAN ATP-dependent RNA helicase DDX18 OS=Homo sapiens GN=DDX18 PE=1 SV=2 Back     alignment and function desciption
 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/119 (53%), Positives = 81/119 (68%), Gaps = 9/119 (7%)

Query: 25  QSKEKSKPAEKD---SDANEDEDQTNAVEVQLPGSDVALEILSSTQFEALKGKVCENTLK 81
           +S E +K  E +    D +EDE +  ++ + L G+         T F +L   V ENTLK
Sbjct: 139 ESAETTKETENNVEKPDNDEDESEVPSLPLGLTGA------FEDTSFASLCNLVNENTLK 192

Query: 82  AIADMGFTKMTEIQARTIPPLLEGRDLVGSAKTGSGKTLAFLVPAVELIYNLKFMPRNG 140
           AI +MGFT MTEIQ ++I PLLEGRDL+ +AKTGSGKTLAFL+PAVELI  L+FMPRNG
Sbjct: 193 AIKEMGFTNMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFLIPAVELIVKLRFMPRNG 251




Probable RNA-dependent helicase.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q9VD51|DDX18_DROME Probable ATP-dependent RNA helicase pitchoune OS=Drosophila melanogaster GN=pit PE=2 SV=2 Back     alignment and function description
>sp|A4R8B5|HAS1_MAGO7 ATP-dependent RNA helicase HAS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HAS1 PE=3 SV=2 Back     alignment and function description
>sp|Q8K363|DDX18_MOUSE ATP-dependent RNA helicase DDX18 OS=Mus musculus GN=Ddx18 PE=2 SV=1 Back     alignment and function description
>sp|Q6BH93|HAS1_DEBHA ATP-dependent RNA helicase HAS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HAS1 PE=3 SV=1 Back     alignment and function description
>sp|A1CIQ5|HAS1_ASPCL ATP-dependent RNA helicase has1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=has1 PE=3 SV=1 Back     alignment and function description
>sp|Q03532|HAS1_YEAST ATP-dependent RNA helicase HAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAS1 PE=1 SV=1 Back     alignment and function description
>sp|A5DID7|HAS1_PICGU ATP-dependent RNA helicase HAS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HAS1 PE=3 SV=2 Back     alignment and function description
>sp|A5E2Z9|HAS1_LODEL ATP-dependent RNA helicase HAS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=HAS1 PE=3 SV=1 Back     alignment and function description
>sp|Q5AK59|HAS1_CANAL ATP-dependent RNA helicase HAS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAS1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
322796780 605 hypothetical protein SINV_02979 [Solenop 0.758 0.223 0.546 2e-37
189234356 695 PREDICTED: similar to pitchoune CG6375-P 0.539 0.138 0.75 1e-36
270001921 629 hypothetical protein TcasGA2_TC000825 [T 0.539 0.152 0.75 1e-36
242022035 636 DEAD box ATP-dependent RNA helicase, put 0.449 0.125 0.8 2e-36
340721973 579 PREDICTED: probable ATP-dependent RNA he 0.651 0.200 0.65 6e-36
383857595 621 PREDICTED: probable ATP-dependent RNA he 0.584 0.167 0.704 2e-35
350412881 578 PREDICTED: probable ATP-dependent RNA he 0.550 0.169 0.734 4e-35
345489122 643 PREDICTED: probable ATP-dependent RNA he 0.584 0.161 0.698 7e-34
193290168 643 pitchoune [Nasonia vitripennis] 0.578 0.160 0.679 7e-34
380011151 607 PREDICTED: probable ATP-dependent RNA he 0.578 0.169 0.663 2e-33
>gi|322796780|gb|EFZ19207.1| hypothetical protein SINV_02979 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 88/161 (54%), Positives = 105/161 (65%), Gaps = 26/161 (16%)

Query: 6   EKHLMNKITKREKKKLKILQSKEKSK-----PAEKDSDANEDED-------------QTN 47
           EK LM KI KREK KL +L+ +E+ K     P E+++     ED             ++ 
Sbjct: 5   EKVLMRKIKKREKTKLTVLKQREEQKDAIKEPKEEETSQQNTEDSLPKKKIKLKVSKRSE 64

Query: 48  AVEV--------QLPGSDVALEILSSTQFEALKGKVCENTLKAIADMGFTKMTEIQARTI 99
             EV         LPG+ +  E+ + T F  L  KVCENTLKAI DMGFT MTEIQA++I
Sbjct: 65  NSEVAEQSPTTENLPGTAIGFEVTNDTNFSVLSEKVCENTLKAIKDMGFTNMTEIQAKSI 124

Query: 100 PPLLEGRDLVGSAKTGSGKTLAFLVPAVELIYNLKFMPRNG 140
           PPLLEGRDLVG+AKTGSGKTLAFL+PAVELIY LKFMPRNG
Sbjct: 125 PPLLEGRDLVGAAKTGSGKTLAFLIPAVELIYKLKFMPRNG 165




Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189234356|ref|XP_973872.2| PREDICTED: similar to pitchoune CG6375-PB [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270001921|gb|EEZ98368.1| hypothetical protein TcasGA2_TC000825 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242022035|ref|XP_002431447.1| DEAD box ATP-dependent RNA helicase, putative [Pediculus humanus corporis] gi|212516735|gb|EEB18709.1| DEAD box ATP-dependent RNA helicase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|340721973|ref|XP_003399387.1| PREDICTED: probable ATP-dependent RNA helicase pitchoune-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383857595|ref|XP_003704290.1| PREDICTED: probable ATP-dependent RNA helicase pitchoune-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350412881|ref|XP_003489799.1| PREDICTED: probable ATP-dependent RNA helicase pitchoune-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|345489122|ref|XP_001604385.2| PREDICTED: probable ATP-dependent RNA helicase pitchoune-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|193290168|ref|NP_001123270.1| pitchoune [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380011151|ref|XP_003689675.1| PREDICTED: probable ATP-dependent RNA helicase pitchoune-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
UNIPROTKB|F1NEQ3 659 DDX18 "Uncharacterized protein 0.595 0.160 0.560 4e-25
UNIPROTKB|E2RFA3 669 DDX18 "Uncharacterized protein 0.595 0.158 0.585 1.5e-24
UNIPROTKB|F1N533 670 DDX18 "Uncharacterized protein 0.595 0.158 0.585 2.4e-24
UNIPROTKB|F1MSX0 674 F1MSX0 "Uncharacterized protei 0.595 0.157 0.585 2.4e-24
ZFIN|ZDB-GENE-030131-9685 653 ddx18 "DEAD (Asp-Glu-Ala-Asp) 0.567 0.154 0.583 7.8e-24
UNIPROTKB|Q9NVP1 670 DDX18 "ATP-dependent RNA helic 0.595 0.158 0.551 1.1e-23
FB|FBgn0025140 680 pit "pitchoune" [Drosophila me 0.584 0.152 0.564 3e-23
MGI|MGI:1914192 660 Ddx18 "DEAD (Asp-Glu-Ala-Asp) 0.601 0.162 0.536 3.6e-23
UNIPROTKB|I3L840 667 DDX18 "Uncharacterized protein 0.584 0.155 0.577 4.7e-23
UNIPROTKB|F1RY13 671 DDX18 "Uncharacterized protein 0.584 0.154 0.577 4.8e-23
UNIPROTKB|F1NEQ3 DDX18 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 294 (108.6 bits), Expect = 4.0e-25, P = 4.0e-25
 Identities = 60/107 (56%), Positives = 75/107 (70%)

Query:    35 KDSDANEDEDQTNAVEVQLPGSDVALE-ILSSTQFEALKGKVCENTLKAIADMGFTKMTE 93
             +D D  +  ++    E ++P   + L        F +L G V ENTLK I+DMGFT MTE
Sbjct:   132 EDEDGQDTGEKEAEEEDEVPSLPLGLTGAFEDNSFTSLAGLVSENTLKGISDMGFTHMTE 191

Query:    94 IQARTIPPLLEGRDLVGSAKTGSGKTLAFLVPAVELIYNLKFMPRNG 140
             IQ ++I PLLEGRD++ +AKTGSGKTLAFL+PAVELIY LKFMPRNG
Sbjct:   192 IQHKSIKPLLEGRDILAAAKTGSGKTLAFLIPAVELIYKLKFMPRNG 238




GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005730 "nucleolus" evidence=IEA
UNIPROTKB|E2RFA3 DDX18 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1N533 DDX18 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MSX0 F1MSX0 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-9685 ddx18 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 18" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NVP1 DDX18 "ATP-dependent RNA helicase DDX18" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0025140 pit "pitchoune" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1914192 Ddx18 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 18" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|I3L840 DDX18 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1RY13 DDX18 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q4IEK8HAS1_GIBZE3, ., 6, ., 4, ., 1, 30.51450.54490.1641yesN/A
Q8K363DDX18_MOUSE3, ., 6, ., 4, ., 1, 30.53040.63480.1712yesN/A
Q9NVP1DDX18_HUMAN3, ., 6, ., 4, ., 1, 30.53780.61790.1641yesN/A
Q9VD51DDX18_DROME3, ., 6, ., 4, ., 1, 30.54910.64600.1691yesN/A
Q84T03RH27_ORYSJ3, ., 6, ., 4, ., 1, 30.52320.47190.1423yesN/A
Q03532HAS1_YEAST3, ., 6, ., 4, ., 1, 30.52720.51680.1821yesN/A
Q9SB89RH27_ARATH3, ., 6, ., 4, ., 1, 30.58220.43250.1216yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
cd00268203 cd00268, DEADc, DEAD-box helicases 2e-25
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 7e-21
PRK11192 434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-17
PRK11776 460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 2e-14
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 3e-14
PRK04837 423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 4e-13
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 6e-12
PTZ00110 545 PTZ00110, PTZ00110, helicase; Provisional 8e-12
PTZ00424 401 PTZ00424, PTZ00424, helicase 45; Provisional 2e-11
PRK10590 456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 6e-11
smart00487 201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-10
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 6e-10
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 8e-09
PLN00206 518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 1e-08
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 4e-06
COG1205 851 COG1205, COG1205, Distinct helicase family with a 2e-05
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 3e-04
PRK13767 876 PRK13767, PRK13767, ATP-dependent helicase; Provis 0.003
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
 Score = 96.8 bits (242), Expect = 2e-25
 Identities = 34/67 (50%), Positives = 43/67 (64%), Gaps = 2/67 (2%)

Query: 68  FEALKGKVCENTLKAIADMGFTKMTEIQARTIPPLLEGRDLVGSAKTGSGKTLAFLVPAV 127
           FE L   +    L+ I  +GF K T IQAR IPPLL GRD++G A+TGSGKT AFL+P +
Sbjct: 1   FEELG--LSPELLRGIYALGFEKPTPIQARAIPPLLSGRDVIGQAQTGSGKTAAFLIPIL 58

Query: 128 ELIYNLK 134
           E +    
Sbjct: 59  EKLDPSP 65


A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP- binding region. Length = 203

>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|237497 PRK13767, PRK13767, ATP-dependent helicase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 178
KOG0338|consensus 691 99.94
KOG0330|consensus 476 99.92
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.91
KOG0346|consensus 569 99.91
KOG0331|consensus 519 99.91
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 99.91
KOG0343|consensus 758 99.9
KOG0345|consensus 567 99.9
PTZ00110 545 helicase; Provisional 99.9
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 99.89
KOG0348|consensus 708 99.89
KOG0340|consensus 442 99.89
KOG0342|consensus 543 99.89
KOG0347|consensus 731 99.88
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 99.88
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.88
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 99.87
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 99.87
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 99.87
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.85
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.85
KOG0335|consensus 482 99.85
KOG0332|consensus 477 99.85
KOG0333|consensus 673 99.84
KOG0334|consensus 997 99.84
PTZ00424 401 helicase 45; Provisional 99.83
KOG0328|consensus 400 99.83
KOG0341|consensus 610 99.81
KOG0326|consensus 459 99.81
KOG0337|consensus 529 99.8
KOG0339|consensus 731 99.8
KOG0344|consensus 593 99.8
KOG0350|consensus 620 99.78
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.78
KOG0327|consensus 397 99.77
KOG0329|consensus 387 99.76
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.75
PRK02362 737 ski2-like helicase; Provisional 99.75
PRK13767 876 ATP-dependent helicase; Provisional 99.73
PRK00254 720 ski2-like helicase; Provisional 99.72
KOG0336|consensus 629 99.71
COG1205 851 Distinct helicase family with a unique C-terminal 99.68
PRK01172 674 ski2-like helicase; Provisional 99.67
KOG4284|consensus 980 99.65
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.59
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.59
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.58
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.54
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.53
PRK09401 1176 reverse gyrase; Reviewed 99.52
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.51
PRK14701 1638 reverse gyrase; Provisional 99.5
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 99.5
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 99.5
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.49
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.48
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.48
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 99.47
PRK10689 1147 transcription-repair coupling factor; Provisional 99.39
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.29
COG1202 830 Superfamily II helicase, archaea-specific [General 99.29
COG1204 766 Superfamily II helicase [General function predicti 99.28
TIGR03158 357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.27
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.21
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 99.19
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.18
smart00487 201 DEXDc DEAD-like helicases superfamily. 99.11
PHA02653 675 RNA helicase NPH-II; Provisional 99.1
KOG0952|consensus 1230 99.09
PHA02558 501 uvsW UvsW helicase; Provisional 99.08
PRK05580 679 primosome assembly protein PriA; Validated 99.06
KOG0349|consensus 725 99.05
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 99.04
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 98.97
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 98.96
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 98.93
smart00488 289 DEXDc2 DEAD-like helicases superfamily. 98.82
smart00489 289 DEXDc3 DEAD-like helicases superfamily. 98.82
PF04851184 ResIII: Type III restriction enzyme, res subunit; 98.78
KOG0352|consensus 641 98.77
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 98.75
PRK12904 830 preprotein translocase subunit SecA; Reviewed 98.74
PRK13766 773 Hef nuclease; Provisional 98.74
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 98.67
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 98.66
PRK13107 908 preprotein translocase subunit SecA; Reviewed 98.61
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 98.59
PRK09694 878 helicase Cas3; Provisional 98.59
KOG0353|consensus 695 98.55
KOG0354|consensus 746 98.55
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 98.51
KOG0951|consensus 1674 98.47
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 98.41
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.39
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 98.33
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 98.31
KOG0351|consensus 941 98.31
KOG0947|consensus 1248 98.21
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 98.18
TIGR00595 505 priA primosomal protein N'. All proteins in this f 98.16
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 98.13
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 98.11
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 98.05
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 98.02
PRK12326 764 preprotein translocase subunit SecA; Reviewed 98.0
PF00580 315 UvrD-helicase: UvrD/REP helicase N-terminal domain 97.97
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 97.91
PF1324576 AAA_19: Part of AAA domain 97.89
KOG0948|consensus 1041 97.87
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 97.86
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 97.81
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 97.81
CHL00122 870 secA preprotein translocase subunit SecA; Validate 97.78
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 97.68
PF13086 236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 97.66
PF07517 266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 97.62
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 97.28
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 97.28
COG1198 730 PriA Primosomal protein N' (replication factor Y) 97.23
PF13604 196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.96
KOG0951|consensus 1674 96.94
PRK11054 684 helD DNA helicase IV; Provisional 96.81
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 96.8
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 96.79
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 96.76
PF02562 205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 96.59
PF00176 299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 96.58
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 96.56
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 96.54
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 96.5
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 96.48
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 96.44
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 96.36
TIGR00376 637 DNA helicase, putative. The gene product may repre 96.36
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 96.29
PRK15483 986 type III restriction-modification system StyLTI en 96.22
PRK13894319 conjugal transfer ATPase TrbB; Provisional 96.15
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 96.1
KOG0949|consensus 1330 96.07
PRK05298 652 excinuclease ABC subunit B; Provisional 95.62
PRK04914 956 ATP-dependent helicase HepA; Validated 95.62
cd01126 384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 95.43
COG4096 875 HsdR Type I site-specific restriction-modification 95.32
PF02534 469 T4SS-DNA_transf: Type IV secretory system Conjugat 95.26
PRK10536 262 hypothetical protein; Provisional 95.25
COG3587 985 Restriction endonuclease [Defense mechanisms] 95.12
PRK13897 606 type IV secretion system component VirD4; Provisio 94.86
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 94.79
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 94.77
KOG4150|consensus 1034 94.77
PF12340 229 DUF3638: Protein of unknown function (DUF3638); In 94.71
KOG1803|consensus 649 94.71
COG4098 441 comFA Superfamily II DNA/RNA helicase required for 94.69
PRK13833 323 conjugal transfer protein TrbB; Provisional 94.68
COG4889 1518 Predicted helicase [General function prediction on 94.59
KOG0950|consensus 1008 94.56
COG4962 355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 94.47
PRK13850 670 type IV secretion system protein VirD4; Provisiona 94.41
KOG0952|consensus 1230 94.41
PRK14873 665 primosome assembly protein PriA; Provisional 94.35
KOG1802|consensus 935 94.31
COG3973 747 Superfamily I DNA and RNA helicases [General funct 94.27
PRK13851 344 type IV secretion system protein VirB11; Provision 94.21
TIGR02768 744 TraA_Ti Ti-type conjugative transfer relaxase TraA 94.13
PRK10875 615 recD exonuclease V subunit alpha; Provisional 94.04
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 93.92
COG2805 353 PilT Tfp pilus assembly protein, pilus retraction 93.84
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 93.72
PRK13880 636 conjugal transfer coupling protein TraG; Provision 93.58
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 93.54
KOG2340|consensus 698 93.54
KOG1133|consensus 821 93.49
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 93.38
PRK13822 641 conjugal transfer coupling protein TraG; Provision 93.32
TIGR02767 623 TraG-Ti Ti-type conjugative transfer system protie 93.25
KOG1132|consensus 945 93.22
PRK13889 988 conjugal transfer relaxase TraA; Provisional 93.21
PRK13876 663 conjugal transfer coupling protein TraG; Provision 93.17
PF12846 304 AAA_10: AAA-like domain 93.04
cd01127 410 TrwB Bacterial conjugation protein TrwB, ATP bindi 92.89
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 92.87
KOG0953|consensus 700 92.66
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 92.61
TIGR03877 237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 92.51
COG1484254 DnaC DNA replication protein [DNA replication, rec 92.51
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 92.5
PRK13764 602 ATPase; Provisional 92.47
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA repl 92.45
smart00382148 AAA ATPases associated with a variety of cellular 92.44
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 92.31
KOG4150|consensus 1034 92.3
PF10412 386 TrwB_AAD_bind: Type IV secretion-system coupling p 92.16
TIGR03743 634 SXT_TraD conjugative coupling factor TraD, SXT/TOL 92.09
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 92.04
TIGR01547 396 phage_term_2 phage terminase, large subunit, PBSX 91.98
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 91.75
PRK10436 462 hypothetical protein; Provisional 91.6
PRK05973237 replicative DNA helicase; Provisional 91.6
cd01124 187 KaiC KaiC is a circadian clock protein primarily f 91.48
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 91.29
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 91.04
KOG0390|consensus 776 90.67
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 90.63
TIGR03754 643 conj_TOL_TraD conjugative coupling factor TraD, TO 90.51
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 90.37
TIGR02538 564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 90.31
COG0610 962 Type I site-specific restriction-modification syst 90.22
TIGR02525 372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 90.14
KOG0926|consensus 1172 90.02
TIGR02784 1141 addA_alphas double-strand break repair helicase Ad 89.97
TIGR02533 486 type_II_gspE general secretory pathway protein E. 89.95
cd01122 271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 89.77
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 89.77
PF06745 226 KaiC: KaiC; InterPro: IPR014774 This entry represe 89.7
COG2804 500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 89.61
PRK08116268 hypothetical protein; Validated 89.4
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 89.33
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 89.16
cd01131 198 PilT Pilus retraction ATPase PilT. PilT is a nucle 89.12
PRK13700 732 conjugal transfer protein TraD; Provisional 89.11
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 88.99
TIGR03420 226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 88.98
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 88.96
cd00984 242 DnaB_C DnaB helicase C terminal domain. The hexame 88.96
PF12775 272 AAA_7: P-loop containing dynein motor region D3; P 88.94
PRK06921266 hypothetical protein; Provisional 88.93
TIGR02688 449 conserved hypothetical protein TIGR02688. Members 88.9
KOG0745|consensus 564 88.89
TIGR03878 259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 88.81
PF09439 181 SRPRB: Signal recognition particle receptor beta s 88.79
PRK08181269 transposase; Validated 88.48
cd01129 264 PulE-GspE PulE/GspE The type II secretory pathway 88.36
COG0467 260 RAD55 RecA-superfamily ATPases implicated in signa 88.31
PF05970 364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 88.31
PRK09183259 transposase/IS protein; Provisional 88.22
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 88.21
PF01935 229 DUF87: Domain of unknown function DUF87; InterPro: 88.19
PRK04328 249 hypothetical protein; Provisional 88.12
KOG0729|consensus 435 88.11
TIGR02524 358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 88.1
TIGR02759 566 TraD_Ftype type IV conjugative transfer system cou 87.9
PHA02533 534 17 large terminase protein; Provisional 87.69
PHA00729 226 NTP-binding motif containing protein 87.59
TIGR03881 229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 87.51
PRK06835329 DNA replication protein DnaC; Validated 87.5
PRK07952244 DNA replication protein DnaC; Validated 87.15
PRK13826 1102 Dtr system oriT relaxase; Provisional 86.96
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 86.95
PRK12377248 putative replication protein; Provisional 86.94
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 86.87
PRK08903 227 DnaA regulatory inactivator Hda; Validated 86.73
PRK06526254 transposase; Provisional 86.57
PF05729166 NACHT: NACHT domain 86.45
TIGR01420 343 pilT_fam pilus retraction protein PilT. This model 86.41
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 86.4
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 86.24
PF1355562 AAA_29: P-loop containing region of AAA domain 86.0
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 85.97
PRK08533 230 flagellar accessory protein FlaH; Reviewed 85.86
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 85.83
PRK08084 235 DNA replication initiation factor; Provisional 85.74
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 85.4
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 85.26
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 85.04
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 84.8
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 84.58
PF00004132 AAA: ATPase family associated with various cellula 84.54
KOG0924|consensus 1042 84.19
KOG1942|consensus 456 84.12
KOG1131|consensus 755 84.0
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 83.89
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 83.63
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 83.5
TIGR03880 224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 83.41
PLN03025 319 replication factor C subunit; Provisional 83.26
PTZ00112 1164 origin recognition complex 1 protein; Provisional 83.17
TIGR03744 893 traC_PFL_4706 conjugative transfer ATPase, PFL_470 83.12
COG1136 226 SalX ABC-type antimicrobial peptide transport syst 83.03
PRK00131175 aroK shikimate kinase; Reviewed 82.95
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 82.91
PRK05642 234 DNA replication initiation factor; Validated 82.89
PF00448 196 SRP54: SRP54-type protein, GTPase domain; InterPro 82.81
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 82.75
PF06068 398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 82.66
PRK13531 498 regulatory ATPase RavA; Provisional 82.64
PF04665 241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 82.53
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 82.52
TIGR02237 209 recomb_radB DNA repair and recombination protein R 82.52
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 82.17
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 82.03
PF03237 384 Terminase_6: Terminase-like family; InterPro: IPR0 82.02
COG4185 187 Uncharacterized protein conserved in bacteria [Fun 81.75
COG1875 436 NYN ribonuclease and ATPase of PhoH family domains 81.71
PRK06067 234 flagellar accessory protein FlaH; Validated 81.4
PRK12402 337 replication factor C small subunit 2; Reviewed 81.32
KOG0989|consensus 346 80.96
PRK10078 186 ribose 1,5-bisphosphokinase; Provisional 80.94
CHL00181 287 cbbX CbbX; Provisional 80.74
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 80.64
PRK14729 300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 80.57
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 80.55
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 80.35
PHA02244 383 ATPase-like protein 80.33
KOG0060|consensus 659 80.32
PRK14530 215 adenylate kinase; Provisional 80.11
PLN02165 334 adenylate isopentenyltransferase 80.1
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 80.1
>KOG0338|consensus Back     alignment and domain information
Probab=99.94  E-value=9.7e-28  Score=210.37  Aligned_cols=109  Identities=30%  Similarity=0.350  Sum_probs=100.0

Q ss_pred             ccchHhhcccCCHHHHHHHHHCCCCCCcHHHHHhhccccCCCcEEEEccCCCchhhHhHHHHHHHHHh-ccCCCCCceEE
Q psy12984         65 STQFEALKGKVCENTLKAIADMGFTKMTEIQARTIPPLLEGRDLVGSAKTGSGKTLAFLVPAVELIYN-LKFMPRNGKSW  143 (178)
Q Consensus        65 ~~~f~~l~~~l~~~ll~~l~~~g~~~pt~iQ~~aip~~l~g~dvi~~a~TGsGKTlaf~lp~l~~l~~-~~~~~~~~~~~  143 (178)
                      ..+|.+|+  |+-.|+++|..+||..|||||..+||.++-|+|+++||-||||||.||+||+|++|+- .+..+..+++|
T Consensus       180 ~~sF~~mN--LSRPlLka~~~lGy~~PTpIQ~a~IPvallgkDIca~A~TGsGKTAAF~lPiLERLlYrPk~~~~TRVLV  257 (691)
T KOG0338|consen  180 NESFQSMN--LSRPLLKACSTLGYKKPTPIQVATIPVALLGKDICACAATGSGKTAAFALPILERLLYRPKKVAATRVLV  257 (691)
T ss_pred             hhhHHhcc--cchHHHHHHHhcCCCCCCchhhhcccHHhhcchhhheecccCCchhhhHHHHHHHHhcCcccCcceeEEE
Confidence            35799998  9999999999999999999999999999999999999999999999999999999864 44566779999


Q ss_pred             EeecHHHHHHHHHHHHHHhhhcCCCCcceEEE
Q psy12984        144 QGKLRPLTNGVYLVACNVFKSTQPPTVIKVQT  175 (178)
Q Consensus       144 l~Ptr~La~qi~~~~~~l~~~~~~~~~~~v~~  175 (178)
                      |+||||||.|++.+.+++.+++...++++|+-
T Consensus       258 L~PTRELaiQv~sV~~qlaqFt~I~~~L~vGG  289 (691)
T KOG0338|consen  258 LVPTRELAIQVHSVTKQLAQFTDITVGLAVGG  289 (691)
T ss_pred             EeccHHHHHHHHHHHHHHHhhccceeeeeecC
Confidence            99999999999999999999999877777754



>KOG0330|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK13880 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>KOG1133|consensus Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK13822 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK13876 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein Back     alignment and domain information
>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK13700 conjugal transfer protein TraD; Provisional Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>KOG1942|consensus Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>TIGR03744 traC_PFL_4706 conjugative transfer ATPase, PFL_4706 family Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>COG4185 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>KOG0060|consensus Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
3ly5_A262 Ddx18 Dead-Domain Length = 262 6e-27
2pl3_A 236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 4e-12
2z0m_A 337 Crystal Structure Of Hypothetical Atp-Dependent Rna 4e-10
3i5x_A 563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 3e-09
3dkp_A 245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 4e-09
3sqx_A 512 Structure Of Mss116p (Nte And C-Tail Double Deletio 4e-09
3fe2_A 242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 4e-09
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 4e-09
3sqw_A 579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 8e-09
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 6e-08
2i4i_A 417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 7e-08
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 2e-07
1hv8_A 367 Crystal Structure Of A Dead Box Protein From The Hy 2e-07
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 5e-07
1q0u_A 219 Crystal Structure Of The Bstdead N-Terminal Domain 7e-07
2db3_A 434 Structural Basis For Rna Unwinding By The Dead-Box 1e-06
2vso_A 395 Crystal Structure Of A Translation Initiation Compl 1e-06
1fuu_A 394 Yeast Initiation Factor 4a Length = 394 2e-06
1wrb_A 253 Crystal Structure Of The N-Terminal Reca-Like Domai 2e-06
1s2m_A 400 Crystal Structure Of The Dead Box Protein Dhh1p Len 3e-06
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 3e-06
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 3e-06
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 5e-06
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 6e-06
2j0u_A 374 The Crystal Structure Of Eif4aiii-Barentsz Complex 2e-05
2j0u_B 374 The Crystal Structure Of Eif4aiii-Barentsz Complex 2e-05
3eiq_A 414 Crystal Structure Of Pdcd4-eif4a Length = 414 3e-05
2zu6_A 388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 3e-05
2hxy_A 391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 3e-05
2hyi_C 413 Structure Of The Human Exon Junction Complex With A 3e-05
2j0q_A 410 The Crystal Structure Of The Exon Junction Complex 3e-05
2xb2_A 411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 3e-05
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 4e-05
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 8e-05
1xtj_A 386 Structure Of Human Uap56 In Complex With Adp Length 8e-05
1xti_A 391 Structure Of Wildtype Human Uap56 Length = 391 9e-05
1xtk_A 390 Structure Of Decd To Dead Mutation Of Human Uap56 L 1e-04
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure

Iteration: 1

Score = 116 bits (291), Expect = 6e-27, Method: Compositional matrix adjust. Identities = 60/103 (58%), Positives = 74/103 (71%), Gaps = 6/103 (5%) Query: 38 DANEDEDQTNAVEVQLPGSDVALEILSSTQFEALKGKVCENTLKAIADMGFTKMTEIQAR 97 D +EDE + ++ + L G+ T F +L V ENTLKAI +MGFT MTEIQ + Sbjct: 30 DNDEDESEVPSLPLGLTGA------FEDTSFASLCNLVNENTLKAIKEMGFTNMTEIQHK 83 Query: 98 TIPPLLEGRDLVGSAKTGSGKTLAFLVPAVELIYNLKFMPRNG 140 +I PLLEGRDL+ +AKTGSGKTLAFL+PAVELI L+FMPRNG Sbjct: 84 SIRPLLEGRDLLAAAKTGSGKTLAFLIPAVELIVKLRFMPRNG 126
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 3e-39
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 7e-36
2pl3_A 236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 5e-34
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 3e-33
1q0u_A 219 Bstdead; DEAD protein, RNA binding protein; 1.85A 5e-24
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 2e-22
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 2e-21
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 4e-21
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 4e-21
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 1e-20
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 1e-20
3bor_A237 Human initiation factor 4A-II; translation initiat 2e-20
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 2e-20
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 3e-20
3dkp_A 245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 4e-20
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 4e-20
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 5e-20
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-19
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 1e-19
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 1e-19
1wrb_A 253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 4e-19
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 1e-18
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 1e-18
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-18
3fe2_A 242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 4e-18
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 5e-18
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 8e-18
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 1e-17
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 2e-17
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 2e-17
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 6e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 1e-04
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
 Score =  133 bits (336), Expect = 3e-39
 Identities = 62/124 (50%), Positives = 78/124 (62%), Gaps = 6/124 (4%)

Query: 17  EKKKLKILQSKEKSKPAEKDSDANEDEDQTNAVEVQLPGSDVALEILSSTQFEALKGKVC 76
               L       +S    +  D +EDE +  ++ + L G+         T F +L   V 
Sbjct: 9   SGVDLGTENLYFQSMNNVEKPDNDEDESEVPSLPLGLTGAF------EDTSFASLCNLVN 62

Query: 77  ENTLKAIADMGFTKMTEIQARTIPPLLEGRDLVGSAKTGSGKTLAFLVPAVELIYNLKFM 136
           ENTLKAI +MGFT MTEIQ ++I PLLEGRDL+ +AKTGSGKTLAFL+PAVELI  L+FM
Sbjct: 63  ENTLKAIKEMGFTNMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFLIPAVELIVKLRFM 122

Query: 137 PRNG 140
           PRNG
Sbjct: 123 PRNG 126


>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.93
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.9
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.9
3dkp_A 245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.89
1q0u_A 219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.88
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.88
1wrb_A 253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.87
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.87
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.87
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.87
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.87
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.87
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.87
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.86
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.86
3bor_A237 Human initiation factor 4A-II; translation initiat 99.86
1qde_A 224 EIF4A, translation initiation factor 4A; DEAD box 99.86
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.85
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.85
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.83
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.81
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.81
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.81
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.8
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.8
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.79
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.79
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.78
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 99.74
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 99.68
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.68
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.67
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.67
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.66
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.65
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.64
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.63
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.63
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.62
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 99.62
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 99.61
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.58
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 99.58
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.57
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.53
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.53
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.53
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.52
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.5
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 99.49
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.49
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.49
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.49
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.48
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.44
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.41
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.4
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.39
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.36
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.31
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.31
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.3
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.29
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.27
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.25
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.24
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.22
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.21
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.19
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.18
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.15
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.07
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.02
3h1t_A 590 Type I site-specific restriction-modification syst 98.91
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 98.84
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 98.78
3jux_A 822 Protein translocase subunit SECA; protein transloc 98.71
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.44
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 98.44
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 98.27
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 97.73
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 97.7
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 97.56
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 97.18
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 97.13
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 97.08
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 96.99
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 96.99
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 96.94
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.91
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 96.89
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 96.79
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.51
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 96.0
2o0j_A 385 Terminase, DNA packaging protein GP17; nucleotide- 95.71
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 95.33
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 93.32
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 93.0
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 91.77
3vkw_A 446 Replicase large subunit; alpha/beta domain, helica 91.68
3co5_A143 Putative two-component system transcriptional RES 90.91
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 90.78
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 89.95
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 89.22
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 88.49
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 88.16
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 87.96
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 87.46
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 87.25
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 87.2
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 87.09
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 86.79
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 86.6
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 86.48
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 86.36
2kjq_A149 DNAA-related protein; solution structure, NESG, st 86.07
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 86.04
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 85.99
1w36_B 1180 RECB, exodeoxyribonuclease V beta chain; recombina 85.97
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 85.46
3bos_A 242 Putative DNA replication factor; P-loop containing 85.38
2eyu_A 261 Twitching motility protein PILT; pilus retraction 85.28
1kgd_A 180 CASK, peripheral plasma membrane CASK; maguk, guan 85.24
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 85.09
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 84.85
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 84.43
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 84.41
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 84.22
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 84.2
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 83.55
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 83.29
1qhx_A 178 CPT, protein (chloramphenicol phosphotransferase); 83.08
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 82.88
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 82.74
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 82.63
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 82.1
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 81.9
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 81.9
3vaa_A 199 Shikimate kinase, SK; structural genomics, center 81.61
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 81.52
2chg_A 226 Replication factor C small subunit; DNA-binding pr 81.51
2qor_A 204 Guanylate kinase; phosphotransferase, purine metab 81.44
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 81.39
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 81.34
2j41_A 207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 81.2
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 80.98
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 80.97
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 80.92
2ius_A 512 DNA translocase FTSK; nucleotide-binding, chromoso 80.9
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 80.73
1lvg_A 198 Guanylate kinase, GMP kinase; transferase; HET: AD 80.71
2gza_A 361 Type IV secretion system protein VIRB11; ATPase, h 80.6
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 80.59
3tau_A 208 Guanylate kinase, GMP kinase; structural genomics, 80.49
3trf_A 185 Shikimate kinase, SK; amino acid biosynthesis, tra 80.44
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 80.1
1zp6_A 191 Hypothetical protein ATU3015; alpha-beta protein., 80.08
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
Probab=99.93  E-value=3e-26  Score=191.24  Aligned_cols=111  Identities=22%  Similarity=0.274  Sum_probs=99.7

Q ss_pred             cccCCCCCCcCCCCccchHhhcccCCHHHHHHHHHCCCCCCcHHHHHhhccccCC--CcEEEEccCCCchhhHhHHHHHH
Q psy12984         51 VQLPGSDVALEILSSTQFEALKGKVCENTLKAIADMGFTKMTEIQARTIPPLLEG--RDLVGSAKTGSGKTLAFLVPAVE  128 (178)
Q Consensus        51 ~~~~~~~~~~~~~~~~~f~~l~~~l~~~ll~~l~~~g~~~pt~iQ~~aip~~l~g--~dvi~~a~TGsGKTlaf~lp~l~  128 (178)
                      +...+.+.+.+..+..+|++++  |++.++++|..+||..||++|..+||.++.|  +|++++|+||||||++|++|+++
T Consensus        77 v~v~~~~~~~p~~~~~~f~~l~--l~~~l~~~l~~~g~~~pt~iQ~~ai~~il~~~~~~~l~~a~TGsGKT~a~~lp~l~  154 (300)
T 3fmo_B           77 VEVLQRDPNSPLYSVKSFEELR--LKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLS  154 (300)
T ss_dssp             EEEECSSTTCCCCCCCCSGGGT--CCHHHHHHHHHTTCCSCCHHHHHHHHHHTSSSCCCEEEECCTTSSHHHHHHHHHHH
T ss_pred             ceeccCCCCCCcCCcCCHhhcC--CCHHHHHHHHHcCCCCCCHHHHHHHHHHHcCCCCeEEEECCCCCCccHHHHHHHHH
Confidence            3445667777888889999998  9999999999999999999999999999988  99999999999999999999999


Q ss_pred             HHHhccCCCCCceEEEeecHHHHHHHHHHHHHHhhhc
Q psy12984        129 LIYNLKFMPRNGKSWQGKLRPLTNGVYLVACNVFKST  165 (178)
Q Consensus       129 ~l~~~~~~~~~~~~~l~Ptr~La~qi~~~~~~l~~~~  165 (178)
                      ++...  ...++++||+|||+||.|++.++..+++++
T Consensus       155 ~l~~~--~~~~~~lil~PtreLa~Q~~~~~~~l~~~~  189 (300)
T 3fmo_B          155 QVEPA--NKYPQCLCLSPTYELALQTGKVIEQMGKFY  189 (300)
T ss_dssp             HCCTT--SCSCCEEEECSSHHHHHHHHHHHHHHTTTS
T ss_pred             hhhcc--CCCceEEEEcCcHHHHHHHHHHHHHHHhhC
Confidence            88653  345589999999999999999999988765



>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 178
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 5e-15
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 2e-14
d1wrba1 238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 2e-14
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 3e-14
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 4e-14
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 5e-14
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 5e-14
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 1e-13
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 2e-13
d1gkub1 237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 8e-13
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 3e-10
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 1e-09
d2bmfa2 305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 2e-05
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 67.9 bits (165), Expect = 5e-15
 Identities = 20/78 (25%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 61  EILSSTQFEALKGKVCENTLKAIADMGFTKMTEIQARTIPPLLEGRDLVGSAKTGSGKTL 120
           E+  +  F+ +   + E+ L+ I   GF K + IQ R I  +++GRD++  +++G+GKT 
Sbjct: 12  EVDVTPTFDTMG--LREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTA 69

Query: 121 AFLVPAVELIYNLKFMPR 138
            F +  ++ +       +
Sbjct: 70  TFSISVLQCLDIQVRETQ 87


>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.95
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.94
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.94
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.94
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.93
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.93
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.9
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.9
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.89
d1gkub1 237 Helicase-like "domain" of reverse gyrase {Archaeon 99.8
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.76
d1oywa2 206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.71
d1wp9a1 200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.41
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.27
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 98.92
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 98.92
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 98.9
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 98.83
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 98.74
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 98.56
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 98.0
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 97.9
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 97.47
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.96
d1tf5a3 273 Translocation ATPase SecA, nucleotide-binding doma 96.92
d1z63a1 230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 96.86
d1z3ix2 298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 96.71
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 96.48
d1nkta3 288 Translocation ATPase SecA, nucleotide-binding doma 96.05
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 94.64
d2i3ba1 189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 94.17
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 93.96
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 92.25
d1c4oa1 408 Nucleotide excision repair enzyme UvrB {Thermus th 92.0
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 91.65
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 91.63
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 91.11
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 90.89
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 90.21
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 89.68
d1ls1a2 207 GTPase domain of the signal sequence recognition p 88.91
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 88.72
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 88.63
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 88.62
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 88.61
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 88.22
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 88.21
d1m8pa3 183 ATP sulfurylase C-terminal domain {Fungus (Penicil 87.72
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 87.48
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 87.33
d1lw7a2 192 Transcriptional regulator NadR, ribosylnicotinamid 87.1
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 87.03
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 86.65
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 86.57
d2bdta1 176 Hypothetical protein BH3686 {Bacillus halodurans [ 86.48
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 85.92
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 85.71
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 85.54
d1vmaa2 213 GTPase domain of the signal recognition particle r 84.12
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 83.79
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 83.67
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 83.65
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 83.47
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 83.42
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 83.14
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 82.83
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 82.5
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 82.02
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 81.97
d1gkya_ 186 Guanylate kinase {Baker's yeast (Saccharomyces cer 81.8
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 81.31
d1ye8a1 178 Hypothetical kinase-like protein Aq_1292 {Aquifex 81.28
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 81.05
d1qhxa_ 178 Chloramphenicol phosphotransferase {Streptomyces v 80.79
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95  E-value=1.3e-28  Score=196.52  Aligned_cols=101  Identities=21%  Similarity=0.334  Sum_probs=91.4

Q ss_pred             CCCccchHhhcccCCHHHHHHHHHCCCCCCcHHHHHhhccccCCCcEEEEccCCCchhhHhHHHHHHHHHhccCCCCCce
Q psy12984         62 ILSSTQFEALKGKVCENTLKAIADMGFTKMTEIQARTIPPLLEGRDLVGSAKTGSGKTLAFLVPAVELIYNLKFMPRNGK  141 (178)
Q Consensus        62 ~~~~~~f~~l~~~l~~~ll~~l~~~g~~~pt~iQ~~aip~~l~g~dvi~~a~TGsGKTlaf~lp~l~~l~~~~~~~~~~~  141 (178)
                      +....+|++|+  |+++++++|.++||.+|||||+.|||.++.|+|++++|+||||||+||++|+++++...  ...+++
T Consensus        13 ~~~~~sF~~l~--L~~~l~~~L~~~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~--~~~~~~   88 (222)
T d2j0sa1          13 VDVTPTFDTMG--LREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQ--VRETQA   88 (222)
T ss_dssp             CCCCCSGGGGC--CCHHHHHHHHHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTT--SCSCCE
T ss_pred             CCCCCCHHHCC--CCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhhhccccccccccc--ccCcee
Confidence            33445799998  99999999999999999999999999999999999999999999999999999988654  345689


Q ss_pred             EEEeecHHHHHHHHHHHHHHhhhcC
Q psy12984        142 SWQGKLRPLTNGVYLVACNVFKSTQ  166 (178)
Q Consensus       142 ~~l~Ptr~La~qi~~~~~~l~~~~~  166 (178)
                      ++++||||||.|++.++..+.++.+
T Consensus        89 lil~PtreLa~Qi~~~~~~l~~~~~  113 (222)
T d2j0sa1          89 LILAPTRELAVQIQKGLLALGDYMN  113 (222)
T ss_dssp             EEECSSHHHHHHHHHHHHHHTTTTT
T ss_pred             EEecchHHHHHHHHHHHHHHhCccc
Confidence            9999999999999999999887654



>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure