Psyllid ID: psy13021

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------
MAGDTTVMDLEDKQDEEDKVVKEISVPPDVPIEVPEVVVIDPSPSSTSAEMASTVLISIDGMTCQSCVNTITDTIRAKPGVFNIKVSLEQKNANIRFNPIITNEETLRISIEDMGFDARLPSTNDEATFTVDGMKCQSCVKKIEATIGEKPGINSVLVALLAAKAEIRYSKDLISPTEIAASISELGFPATVIDEAGSGEGELELKISGMSCASCVNKIETSVKKLAGIKSAVVALTTQRGKFRYDLEVTGPRDVMECIEKLGFTTALLNSKDKDSRGYLDQRTIAL
ccccEEEEEEcccHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEEcccccHHHHHHHHHHHcccccEEEEEEEccccEEEEEEccccccHHHHHHHHHHccccccccccccEEEEEEcccccHHHHHHHHHHHcccccEEEEEEEEcccEEEEEEccccccHHHHHHHHHHccccEEEEccccccccEEEEEEEccccHHHHHHHHHHHHccccEEEEEEEccccEEEEEEccccccHHHHHHHHHHccccEEEccccccccccHHccccccc
ccccccccccccccccHHccccccccccccccccccccccccccccccccccEEEEEEEEcccHHHHHHHHHHHHcccccEEEEEEEEcccEEEEEEccccccHHHHHHHHHHccccccccccccEEEEEEEcccHHHHHHHHHHHHHccccEEEEEEEEccccEEEEEccccccHHHHHHHHHHccccEEEEccccccccEEEEEEEcccHHHHHHHHHHHHHccccEEEEEEEEccccEEEEEccccccHHHHHHHHHHccccEEEEccccccccccccccEccc
magdttvmdledkqdeeDKVVKEisvppdvpievpevvvidpspsstsaEMASTVLISIDGMTCQSCVNTITDtirakpgvfNIKVSLEqknanirfnpiitneeTLRISIEdmgfdarlpstndeatftvdgmkcQSCVKKIEatigekpgiNSVLVALLAAKAEIRyskdlisptEIAASIselgfpatvideagsgegelELKISGMSCASCVNKIETSVKKLAGIKSAVVALTTQrgkfrydlevtgprdvMECIEKLGFTTALlnskdkdsrgyldqrtial
magdttvmdledkqdeedkvvkeisvppdvpievpevVVIDPSPSSTSAEMASTVLISIDGMTCQSCVNTITDTIRAKPGVFNIKVSleqknanirfnpiitneeTLRISIEDMGFDARLPSTNDEATFTVDGMKCQSCVKKIEatigekpginSVLVALLAAKAEIRYSKDLISPTEIAASISELGFPATVIDEAGSGEGELELKISGMSCASCVNKIETSVKKLAGIKSAVValttqrgkfrydlevtgprdvMECIEKLGFttallnskdkdsrgyldqrtial
MAGDTTVMDLEDKQDEEDKVVKeisvppdvpievpevvvidpspssTSAEMASTVLISIDGMTCQSCVNTITDTIRAKPGVFNIKVSLEQKNANIRFNPIITNEETLRISIEDMGFDARLPSTNDEATFTVDGMKCQSCVKKIEATIGEKPGINSVLVALLAAKAEIRYSKDLISPTEIAASISELGFPATVIDEAGSGEGELELKISGMSCASCVNKIETSVKKLAGIKSAVVALTTQRGKFRYDLEVTGPRDVMECIEKLGFTTALLNSKDKDSRGYLDQRTIAL
*******************************IEVPEVVVI************STVLISIDGMTCQSCVNTITDTIRAKPGVFNIKVSLEQKNANIRFNPIITNEETLRISIEDMGFDARLPSTNDEATFTVDGMKCQSCVKKIEATIGEKPGINSVLVALLAAKAEIRYSKDLISPTEIAASISELGFPATVIDEAGSGEGELELKISGMSCASCVNKIETSVKKLAGIKSAVVALTTQRGKFRYDLEVTGPRDVMECIEKLGFTTALL******************
***DTTVMDLEDKQDEEDKVV**********************************LISIDGMTCQSCVNTITDTIRAKPGVFNIKVSLEQKNANIRFNPIITNEETLRISIEDMGFDARLPSTNDEATFTVDGMKCQSCVKKIEATIGEKPGINSVLVALLAAKAEIRYSKDLISPTEIAASISELGFPA**************LKISGMSCASCVNKIETSVKKLAGIKSAVVALTTQRGKFRYDLEVTGPRDVMECIEKLGFT**********************
MAGDTTVMDLEDKQDEEDKVVKEISVPPDVPIEVPEVVVIDPSPSSTSAEMASTVLISIDGMTCQSCVNTITDTIRAKPGVFNIKVSLEQKNANIRFNPIITNEETLRISIEDMGFDARLPSTNDEATFTVDGMKCQSCVKKIEATIGEKPGINSVLVALLAAKAEIRYSKDLISPTEIAASISELGFPATVIDEAGSGEGELELKISGMSCASCVNKIETSVKKLAGIKSAVVALTTQRGKFRYDLEVTGPRDVMECIEKLGFTTALLNSKDKDSRGYLDQRTIAL
**************************************************MASTVLISIDGMTCQSCVNTITDTIRAKPGVFNIKVSLEQKNANIRFNPIITNEETLRISIEDMGFDARLPSTNDEATFTVDGMKCQSCVKKIEATIGEKPGINSVLVALLAAKAEIRYSKDLISPTEIAASISELGFPATVIDEAGSGEGELELKISGMSCASCVNKIETSVKKLAGIKSAVVALTTQRGKFRYDLEVTGPRDVMECIEKLGFTTALLNS****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGDTTVMDLEDKQDEEDKVVKEISVPPDVPIEVPEVVVIDPSPSSTSAEMASTVLISIDGMTCQSCVNTITDTIRAKPGVFNIKVSLEQKNANIRFNPIITNEETLRISIEDMGFDARLPSTNDEATFTVDGMKCQSCVKKIEATIGEKPGINSVLVALLAAKAEIRYSKDLISPTEIAASISELGFPATVIDEAGSGEGELELKISGMSCASCVNKIETSVKKLAGIKSAVVALTTQRGKFRYDLEVTGPRDVMECIEKLGFTTALLNSKDKDSRGYLDQRTIAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query287 2.2.26 [Sep-21-2011]
Q04656 1500 Copper-transporting ATPas yes N/A 0.815 0.156 0.421 4e-53
Q64430 1491 Copper-transporting ATPas yes N/A 0.815 0.156 0.428 1e-52
P70705 1492 Copper-transporting ATPas yes N/A 0.815 0.156 0.419 2e-51
P49015 1476 Copper-transporting ATPas yes N/A 0.815 0.158 0.421 1e-49
P35670 1465 Copper-transporting ATPas no N/A 0.797 0.156 0.350 2e-43
Q9XT50 1505 Copper-transporting ATPas N/A N/A 0.818 0.156 0.334 2e-40
Q64446 1462 Copper-transporting ATPas no N/A 0.797 0.156 0.309 8e-35
Q64535 1451 Copper-transporting ATPas no N/A 0.797 0.157 0.294 4e-31
Q9S7J8 1001 Copper-transporting ATPas yes N/A 0.717 0.205 0.281 6e-21
Q9SH30 995 Putative copper-transport no N/A 0.728 0.210 0.309 3e-20
>sp|Q04656|ATP7A_HUMAN Copper-transporting ATPase 1 OS=Homo sapiens GN=ATP7A PE=1 SV=3 Back     alignment and function desciption
 Score =  208 bits (529), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 116/275 (42%), Positives = 155/275 (56%), Gaps = 41/275 (14%)

Query: 48  SAEMASTVLISIDGMTCQSCVNTITDTIRAKPGVFNIKVSLEQKNANIRFNPIITNEETL 107
           S  +    +I+IDGMTC SCV +I   I  KPGV +I+VSL   N  + ++P++T+ ETL
Sbjct: 372 SQPLTQETVINIDGMTCNSCVQSIEGVISKKPGVKSIRVSLANSNGTVEYDPLLTSPETL 431

Query: 108 RISIEDMGFDARLPSTND---------------------------------------EAT 128
           R +IEDMGFDA L  TN+                                       +  
Sbjct: 432 RGAIEDMGFDATLSDTNEPLVVIAQPSSEMPLLTSTNEFYTKGMTPVQDKEEGKNSSKCY 491

Query: 129 FTVDGMKCQSCVKKIEATIGEKPGINSVLVALLAAKAEIRYSKDLISPTEIAASISELGF 188
             V GM C SCV  IE  +  + GI S+LVAL+A KAE+RY+  +I P  IA  I ELGF
Sbjct: 492 IQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPAVIQPPMIAEFIRELGF 551

Query: 189 PATVIDEAGSGEGELELKISGMSCASCVNKIETSVKKLAGIKSAVVALTTQRGKFRYDLE 248
            ATVI+ A  G+G LEL + GM+CASCV+KIE+S+ K  GI    VAL T +   +YD E
Sbjct: 552 GATVIENADEGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPE 611

Query: 249 VTGPRDVMECIEKLGFTTALLNSKDKDSRGYLDQR 283
           + GPRD++  IE LGF  +L+  KD+ S  +LD +
Sbjct: 612 IIGPRDIIHTIESLGFEASLVK-KDR-SASHLDHK 644
May supply copper to copper-requiring proteins within the secretory pathway, when localized in the trans-Golgi network. Under conditions of elevated extracellular copper, it relocalized to the plasma membrane where it functions in the efflux of copper from cells.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 3EC: .EC: 4
>sp|Q64430|ATP7A_MOUSE Copper-transporting ATPase 1 OS=Mus musculus GN=Atp7a PE=1 SV=3 Back     alignment and function description
>sp|P70705|ATP7A_RAT Copper-transporting ATPase 1 OS=Rattus norvegicus GN=Atp7a PE=1 SV=1 Back     alignment and function description
>sp|P49015|ATP7A_CRIGR Copper-transporting ATPase 1 (Fragment) OS=Cricetulus griseus GN=ATP7A PE=2 SV=1 Back     alignment and function description
>sp|P35670|ATP7B_HUMAN Copper-transporting ATPase 2 OS=Homo sapiens GN=ATP7B PE=1 SV=4 Back     alignment and function description
>sp|Q9XT50|ATP7B_SHEEP Copper-transporting ATPase 2 OS=Ovis aries GN=ATP7B PE=2 SV=1 Back     alignment and function description
>sp|Q64446|ATP7B_MOUSE Copper-transporting ATPase 2 OS=Mus musculus GN=Atp7b PE=1 SV=2 Back     alignment and function description
>sp|Q64535|ATP7B_RAT Copper-transporting ATPase 2 OS=Rattus norvegicus GN=Atp7b PE=2 SV=1 Back     alignment and function description
>sp|Q9S7J8|HMA7_ARATH Copper-transporting ATPase RAN1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SH30|HMA5_ARATH Putative copper-transporting ATPase HMA5 OS=Arabidopsis thaliana GN=HMA5 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query287
242012285 1261 Copper-transporting ATPase, putative [Pe 0.804 0.183 0.471 3e-61
332027749 1282 Copper-transporting ATPase 1 [Acromyrmex 0.888 0.198 0.425 1e-60
307183481 1278 Copper-transporting ATPase 1 [Camponotus 0.790 0.177 0.484 7e-60
328776473 1295 PREDICTED: copper-transporting ATPase 1 0.790 0.175 0.460 3e-59
350424310 1291 PREDICTED: copper-transporting ATPase 1- 0.804 0.178 0.444 4e-59
380014298 1295 PREDICTED: LOW QUALITY PROTEIN: copper-t 0.804 0.178 0.456 7e-59
307194123 1273 Copper-transporting ATPase 1 [Harpegnath 0.804 0.181 0.458 1e-58
383849738 1284 PREDICTED: copper-transporting ATPase 1- 0.787 0.176 0.471 2e-58
340722671 1300 PREDICTED: LOW QUALITY PROTEIN: copper-t 0.790 0.174 0.447 5e-58
189238613 1224 PREDICTED: similar to copper-transportin 0.783 0.183 0.444 1e-53
>gi|242012285|ref|XP_002426863.1| Copper-transporting ATPase, putative [Pediculus humanus corporis] gi|212511092|gb|EEB14125.1| Copper-transporting ATPase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  241 bits (615), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 126/267 (47%), Positives = 165/267 (61%), Gaps = 36/267 (13%)

Query: 53  STVLISIDGMTCQSCVNTITDTIRAKPGVFNIKVSLEQKNANIRFNPIITNEETLRISIE 112
           + VLI I+GMTC SCV  I  TI    G+ ++ VSL  K     ++P +     +R +IE
Sbjct: 151 NNVLIHIEGMTCNSCVKNIETTIGKVKGINSVNVSLANKLGTFSYDPTLVTPVQIRSAIE 210

Query: 113 DMGFDARL----PSTN--------------------------------DEATFTVDGMKC 136
           DMGFD       P T                                  +    + GM C
Sbjct: 211 DMGFDTNFQNSPPPTGGLFPIETDPMVESMMETPKKTVSMSIDMEVEYSKCFLHIKGMSC 270

Query: 137 QSCVKKIEATIGEKPGINSVLVALLAAKAEIRYSKDLISPTEIAASISELGFPATVIDEA 196
            SCV  IE    +  G+ SVL+ALLAAKAE++Y+  LISPT+IA SI++LGFP  +I+E 
Sbjct: 271 ASCVAAIEKHCKKIQGVESVLIALLAAKAEVKYNAQLISPTDIANSITDLGFPTEIINEP 330

Query: 197 GSGEGELELKISGMSCASCVNKIETSVKKLAGIKSAVVALTTQRGKFRYDLEVTGPRDVM 256
           G+GEGE+EL+I+GM+CASCVNKIE++VKK+ G+ SA VALTTQ+GKF+YDLE TGPRD++
Sbjct: 331 GTGEGEIELQITGMTCASCVNKIESTVKKINGVFSASVALTTQKGKFKYDLEKTGPRDII 390

Query: 257 ECIEKLGFTTALLNSKDKDSRGYLDQR 283
           E I KLGF   +L+SKDK+SR YLD R
Sbjct: 391 ETINKLGFKADILSSKDKESRAYLDHR 417

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332027749|gb|EGI67816.1| Copper-transporting ATPase 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307183481|gb|EFN70280.1| Copper-transporting ATPase 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328776473|ref|XP_395837.3| PREDICTED: copper-transporting ATPase 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|350424310|ref|XP_003493753.1| PREDICTED: copper-transporting ATPase 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380014298|ref|XP_003691176.1| PREDICTED: LOW QUALITY PROTEIN: copper-transporting ATPase 1-like [Apis florea] Back     alignment and taxonomy information
>gi|307194123|gb|EFN76571.1| Copper-transporting ATPase 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383849738|ref|XP_003700494.1| PREDICTED: copper-transporting ATPase 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340722671|ref|XP_003399727.1| PREDICTED: LOW QUALITY PROTEIN: copper-transporting ATPase 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|189238613|ref|XP_968455.2| PREDICTED: similar to copper-transporting ATPase 1 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query287
UNIPROTKB|Q04656 1500 ATP7A "Copper-transporting ATP 0.526 0.100 0.503 1.8e-50
MGI|MGI:99400 1491 Atp7a "ATPase, Cu++ transporti 0.564 0.108 0.463 4.7e-48
UNIPROTKB|F1LM77 1490 Atp7a "Copper-transporting ATP 0.526 0.101 0.490 4.1e-47
UNIPROTKB|F1LQK4 1491 Atp7a "Copper-transporting ATP 0.526 0.101 0.490 4.2e-47
RGD|2179 1492 Atp7a "ATPase, Cu++ transporti 0.526 0.101 0.490 4.2e-47
UNIPROTKB|F1PK99 1499 ATP7A "Uncharacterized protein 0.554 0.106 0.465 4.3e-47
UNIPROTKB|F1NUA1 1476 F1NUA1 "Uncharacterized protei 0.526 0.102 0.483 1e-46
UNIPROTKB|F1NJ24 1497 F1NJ24 "Uncharacterized protei 0.526 0.100 0.483 1.1e-46
UNIPROTKB|F1N8W2 1390 ATP7B "Uncharacterized protein 0.498 0.102 0.475 3.9e-44
UNIPROTKB|E1C2H2 1426 ATP7B "Uncharacterized protein 0.498 0.100 0.475 4.2e-44
UNIPROTKB|Q04656 ATP7A "Copper-transporting ATPase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 365 (133.5 bits), Expect = 1.8e-50, Sum P(2) = 1.8e-50
 Identities = 77/153 (50%), Positives = 101/153 (66%)

Query:   131 VDGMKCQSCVKKIEATIGEKPGINSVLVALLAAKAEIRYSKDLISPTEIAASISELGFPA 190
             V GM C SCV  IE  +  + GI S+LVAL+A KAE+RY+  +I P  IA  I ELGF A
Sbjct:   494 VTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPAVIQPPMIAEFIRELGFGA 553

Query:   191 TVIDEAGSGEGELELKISGMSCASCVNKIETSVKKLAGIKSAVVALTTQRGKFRYDLEVT 250
             TVI+ A  G+G LEL + GM+CASCV+KIE+S+ K  GI    VAL T +   +YD E+ 
Sbjct:   554 TVIENADEGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEII 613

Query:   251 GPRDVMECIEKLGFTTALLNSKDKDSRGYLDQR 283
             GPRD++  IE LGF  +L+  KD+ S  +LD +
Sbjct:   614 GPRDIIHTIESLGFEASLVK-KDR-SASHLDHK 644
GO:0001701 "in utero embryonic development" evidence=IEA
GO:0001836 "release of cytochrome c from mitochondria" evidence=IEA
GO:0006570 "tyrosine metabolic process" evidence=IEA
GO:0010041 "response to iron(III) ion" evidence=IEA
GO:0010043 "response to zinc ion" evidence=IEA
GO:0010468 "regulation of gene expression" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0030141 "secretory granule" evidence=IEA
GO:0031526 "brush border membrane" evidence=IEA
GO:0042421 "norepinephrine biosynthetic process" evidence=IEA
GO:0043524 "negative regulation of neuron apoptotic process" evidence=IEA
GO:0048813 "dendrite morphogenesis" evidence=IEA
GO:0005783 "endoplasmic reticulum" evidence=IEA;IDA
GO:0005829 "cytosol" evidence=IEA
GO:0006825 "copper ion transport" evidence=IMP
GO:0005507 "copper ion binding" evidence=IDA
GO:0042414 "epinephrine metabolic process" evidence=ISS
GO:0043085 "positive regulation of catalytic activity" evidence=ISS
GO:0048286 "lung alveolus development" evidence=ISS
GO:0051542 "elastin biosynthetic process" evidence=ISS
GO:0005770 "late endosome" evidence=IDA
GO:0016323 "basolateral plasma membrane" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA;TAS
GO:0005802 "trans-Golgi network" evidence=IDA
GO:0051353 "positive regulation of oxidoreductase activity" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0032767 "copper-dependent protein binding" evidence=IPI
GO:0001568 "blood vessel development" evidence=ISS
GO:0001974 "blood vessel remodeling" evidence=ISS
GO:0002082 "regulation of oxidative phosphorylation" evidence=ISS
GO:0004008 "copper-exporting ATPase activity" evidence=ISS
GO:0005375 "copper ion transmembrane transporter activity" evidence=ISS
GO:0006568 "tryptophan metabolic process" evidence=ISS
GO:0006584 "catecholamine metabolic process" evidence=ISS
GO:0007005 "mitochondrion organization" evidence=ISS
GO:0007626 "locomotory behavior" evidence=ISS
GO:0010273 "detoxification of copper ion" evidence=ISS
GO:0015677 "copper ion import" evidence=ISS
GO:0016532 "superoxide dismutase copper chaperone activity" evidence=ISS
GO:0018205 "peptidyl-lysine modification" evidence=ISS
GO:0019430 "removal of superoxide radicals" evidence=ISS
GO:0021702 "cerebellar Purkinje cell differentiation" evidence=ISS
GO:0021860 "pyramidal neuron development" evidence=ISS
GO:0021954 "central nervous system neuron development" evidence=ISS
GO:0030198 "extracellular matrix organization" evidence=ISS
GO:0030199 "collagen fibril organization" evidence=ISS
GO:0031069 "hair follicle morphogenesis" evidence=ISS
GO:0042093 "T-helper cell differentiation" evidence=ISS
GO:0042415 "norepinephrine metabolic process" evidence=ISS
GO:0042417 "dopamine metabolic process" evidence=ISS
GO:0042428 "serotonin metabolic process" evidence=ISS
GO:0043005 "neuron projection" evidence=ISS
GO:0043025 "neuronal cell body" evidence=ISS
GO:0043473 "pigmentation" evidence=ISS
GO:0043588 "skin development" evidence=ISS
GO:0048251 "elastic fiber assembly" evidence=ISS
GO:0048553 "negative regulation of metalloenzyme activity" evidence=ISS
GO:0048554 "positive regulation of metalloenzyme activity" evidence=ISS
GO:0048812 "neuron projection morphogenesis" evidence=ISS
GO:0051216 "cartilage development" evidence=ISS
GO:0060003 "copper ion export" evidence=ISS
GO:0048471 "perinuclear region of cytoplasm" evidence=IDA
GO:0006878 "cellular copper ion homeostasis" evidence=IMP
GO:0030140 "trans-Golgi network transport vesicle" evidence=IMP
GO:0005524 "ATP binding" evidence=TAS
GO:0034220 "ion transmembrane transport" evidence=TAS
GO:0055085 "transmembrane transport" evidence=TAS
MGI|MGI:99400 Atp7a "ATPase, Cu++ transporting, alpha polypeptide" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1LM77 Atp7a "Copper-transporting ATPase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LQK4 Atp7a "Copper-transporting ATPase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|2179 Atp7a "ATPase, Cu++ transporting, alpha polypeptide" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PK99 ATP7A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NUA1 F1NUA1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJ24 F1NJ24 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N8W2 ATP7B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C2H2 ATP7B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query287
cd0037163 cd00371, HMA, Heavy-metal-associated domain (HMA) 3e-14
cd0037163 cd00371, HMA, Heavy-metal-associated domain (HMA) 7e-14
cd0037163 cd00371, HMA, Heavy-metal-associated domain (HMA) 3e-13
pfam0040362 pfam00403, HMA, Heavy-metal-associated domain 1e-12
COG2217 713 COG2217, ZntA, Cation transport ATPase [Inorganic 9e-11
PRK10671 834 PRK10671, copA, copper exporting ATPase; Provision 2e-10
COG260871 COG2608, CopZ, Copper chaperone [Inorganic ion tra 4e-10
pfam0040362 pfam00403, HMA, Heavy-metal-associated domain 1e-09
TIGR0000366 TIGR00003, TIGR00003, copper ion binding protein 2e-09
COG260871 COG2608, CopZ, Copper chaperone [Inorganic ion tra 3e-09
pfam0040362 pfam00403, HMA, Heavy-metal-associated domain 5e-09
COG260871 COG2608, CopZ, Copper chaperone [Inorganic ion tra 1e-07
PRK11033 741 PRK11033, zntA, zinc/cadmium/mercury/lead-transpor 1e-07
COG2217 713 COG2217, ZntA, Cation transport ATPase [Inorganic 6e-07
PRK13748 561 PRK13748, PRK13748, putative mercuric reductase; P 1e-05
TIGR0000366 TIGR00003, TIGR00003, copper ion binding protein 3e-05
PRK13748 561 PRK13748, PRK13748, putative mercuric reductase; P 3e-05
COG2217 713 COG2217, ZntA, Cation transport ATPase [Inorganic 5e-05
TIGR0000366 TIGR00003, TIGR00003, copper ion binding protein 5e-05
PRK13748 561 PRK13748, PRK13748, putative mercuric reductase; P 5e-05
PRK10671 834 PRK10671, copA, copper exporting ATPase; Provision 3e-04
TIGR0205292 TIGR02052, MerP, mercuric transport protein peripl 3e-04
>gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information 
 Score = 65.7 bits (161), Expect = 3e-14
 Identities = 25/63 (39%), Positives = 39/63 (61%), Gaps = 1/63 (1%)

Query: 57  ISIDGMTCQSCVNTITDTIRAKPGVFNIKVSLEQKNANIRFNPIITNEETLRISIEDMGF 116
           +S++GMTC  CV+ I   +   PGV +++V LE   A + ++P ++ EE L   IED G+
Sbjct: 2   LSVEGMTCAGCVSKIEKALEKLPGVESVEVDLETGKATVEYDPEVSPEELLEA-IEDAGY 60

Query: 117 DAR 119
            AR
Sbjct: 61  KAR 63

HMA domain contains two cysteine residues that are important in binding and transfer of metal ions, such as copper, cadmium, cobalt and zinc. In the case of copper, stoichiometry of binding is one Cu+ ion per binding domain. Repeats of the HMA domain in copper chaperone has been associated with Menkes/Wilson disease due to binding of multiple copper ions. Length = 63
>gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information
>gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information
>gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain Back     alignment and domain information
>gnl|CDD|225127 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional Back     alignment and domain information
>gnl|CDD|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain Back     alignment and domain information
>gnl|CDD|188014 TIGR00003, TIGR00003, copper ion binding protein Back     alignment and domain information
>gnl|CDD|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain Back     alignment and domain information
>gnl|CDD|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|236827 PRK11033, zntA, zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>gnl|CDD|225127 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184298 PRK13748, PRK13748, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|188014 TIGR00003, TIGR00003, copper ion binding protein Back     alignment and domain information
>gnl|CDD|184298 PRK13748, PRK13748, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|225127 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|188014 TIGR00003, TIGR00003, copper ion binding protein Back     alignment and domain information
>gnl|CDD|184298 PRK13748, PRK13748, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional Back     alignment and domain information
>gnl|CDD|131107 TIGR02052, MerP, mercuric transport protein periplasmic component Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 287
KOG0207|consensus 951 99.94
KOG0207|consensus 951 99.64
PRK10671 834 copA copper exporting ATPase; Provisional 99.39
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 99.37
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 99.36
COG260871 CopZ Copper chaperone [Inorganic ion transport and 99.31
PRK10671 834 copA copper exporting ATPase; Provisional 99.28
COG260871 CopZ Copper chaperone [Inorganic ion transport and 99.21
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 98.36
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 98.13
TIGR0000368 copper ion binding protein. This model describes a 97.87
TIGR0000368 copper ion binding protein. This model describes a 97.83
PLN02957 238 copper, zinc superoxide dismutase 97.8
KOG4656|consensus247 97.72
PLN02957238 copper, zinc superoxide dismutase 97.58
KOG4656|consensus 247 97.34
KOG1603|consensus73 97.28
KOG1603|consensus73 97.13
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 96.87
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 96.73
TIGR0205292 MerP mercuric transport protein periplasmic compon 94.26
TIGR0205292 MerP mercuric transport protein periplasmic compon 93.79
PRK13748 561 putative mercuric reductase; Provisional 89.1
cd0037163 HMA Heavy-metal-associated domain (HMA) is a conse 88.88
PRK13748 561 putative mercuric reductase; Provisional 87.05
PRK14054172 methionine sulfoxide reductase A; Provisional 86.51
PF0120670 TusA: Sulfurtransferase TusA; InterPro: IPR001455 84.68
cd0037163 HMA Heavy-metal-associated domain (HMA) is a conse 84.35
PF0120670 TusA: Sulfurtransferase TusA; InterPro: IPR001455 81.99
PRK14054172 methionine sulfoxide reductase A; Provisional 81.7
PRK1101878 hypothetical protein; Provisional 80.25
PRK05528156 methionine sulfoxide reductase A; Provisional 80.16
>KOG0207|consensus Back     alignment and domain information 
Probab=99.94  E-value=5.4e-26  Score=213.78  Aligned_cols=213  Identities=43%  Similarity=0.749  Sum_probs=195.2

Q ss_pred             eCCCChhhHHHHHHHHhcCCCeeEEEEeccCCeEEEEeCCCCCCHHHHHHHhhhccccccCCCCC----ceeEEEECCCC
Q psy13021         60 DGMTCQSCVNTITDTIRAKPGVFNIKVSLEQKNANIRFNPIITNEETLRISIEDMGFDARLPSTN----DEATFTVDGMK  135 (287)
Q Consensus        60 ~gm~C~~C~~~i~~~l~~~~gv~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~~~G~~~~~~~~~----~~~~~~v~gm~  135 (287)
                      .||+|..|.+.++.++...+|+.++.+++..+.+.+.|+ ...+.+.+++.++++||++...+..    ....+++.||+
T Consensus         1 ~gmtc~ac~~si~~~~~~~~g~~~i~vsl~~~~~~v~~~-~~~~~~~i~~~ied~gf~~~~~~~~~~~~~~~~l~v~Gmt   79 (951)
T KOG0207|consen    1 KGMTCSACSNSIEKAISRKPGVQKIEVSLAQKRANVSYD-NIVSPESIKETIEDMGFEASLLSDSEITASKCYLSVNGMT   79 (951)
T ss_pred             CCccHHHHhhhHHHHHhcCCCceeEEEEeccccceEEEe-eccCHHHHHHHhhcccceeeecccCccccceeEEEecCce
Confidence            389999999999999999999999999999999999999 7778999999999999998765421    14589999999


Q ss_pred             ChhHHHHHHHHhccCCCeeEEEEeeecceeeeeccCCCCChHHHHHHhhhcCCCceeeccCCCCC-ccceeeeccCCchh
Q psy13021        136 CQSCVKKIEATIGEKPGINSVLVALLAAKAEIRYSKDLISPTEIAASISELGFPATVIDEAGSGE-GELELKISGMSCAS  214 (287)
Q Consensus       136 C~~C~~~ie~~l~~~~gV~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~~~G~~~~~~~~~~~~~-~~~~~~v~gm~c~~  214 (287)
                      |++|+..+++.|+..+|+.++.+.+..+.+.+.|+|..++.+.+.+.++++||.+..++..+... .+..|.+.||.|..
T Consensus        80 C~scv~~i~~~l~~~~gv~~~~val~~~~~~v~~dp~v~s~~~~~e~ie~~gf~a~~i~~~~~~~~~~i~L~v~g~~c~s  159 (951)
T KOG0207|consen   80 CASCVATIERNLRKIEGVESAVVALSASKAEVIYDPAVTSPDSIAESIEDLGFSAELIESVNGNSNQKIYLDVLGMTCAS  159 (951)
T ss_pred             eHHHHHHHHHHhhccCCcceEEEEeeccceeEEECCcccCchhHHHHHHhcCccceehhcccCCCCCcEEEEeecccccc
Confidence            99999999999999999999999999999999999999999999999999999998876654332 67889999999999


Q ss_pred             hHHHHHHHhhcCCCeeEEEEEccCCeEEEEEcCCCCCHHHHHHHHHhcCCeeEEeCCCC
Q psy13021        215 CVNKIETSVKKLAGIKSAVVALTTQRGKFRYDLEVTGPRDVMECIEKLGFTTALLNSKD  273 (287)
Q Consensus       215 C~~~ie~~l~~~~gv~~~~v~~~~~~~~v~~~~~~~~~~~i~~~I~~~G~~~~~~~~~~  273 (287)
                      |+.+|+..|.+++||.++++++.+.++.+.|+|..++++++.+.|+..||.+......+
T Consensus       160 ~~~~ie~~l~~l~gV~~~sv~~~t~~~~V~~~~~~~~pr~i~k~ie~~~~~~~~~~~~~  218 (951)
T KOG0207|consen  160 CVSKIESILERLRGVKSFSVSLATDTAIVVYDPEITGPRDIIKAIEETGFEASVRPYGD  218 (951)
T ss_pred             hhhhhHHHHhhccCeeEEEEeccCCceEEEecccccChHHHHHHHHhhcccceeeeccc
Confidence            99999999999999999999999999999999999999999999999999877655433

>KOG0207|consensus Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>KOG4656|consensus Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>KOG4656|consensus Back     alignment and domain information
>KOG1603|consensus Back     alignment and domain information
>KOG1603|consensus Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>TIGR02052 MerP mercuric transport protein periplasmic component Back     alignment and domain information
>TIGR02052 MerP mercuric transport protein periplasmic component Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>cd00371 HMA Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK14054 methionine sulfoxide reductase A; Provisional Back     alignment and domain information
>PF01206 TusA: Sulfurtransferase TusA; InterPro: IPR001455 SirA functions as a response regulator as part of a two-component system, where BarA is the sensor kinase Back     alignment and domain information
>cd00371 HMA Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information
>PF01206 TusA: Sulfurtransferase TusA; InterPro: IPR001455 SirA functions as a response regulator as part of a two-component system, where BarA is the sensor kinase Back     alignment and domain information
>PRK14054 methionine sulfoxide reductase A; Provisional Back     alignment and domain information
>PRK11018 hypothetical protein; Provisional Back     alignment and domain information
>PRK05528 methionine sulfoxide reductase A; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query287
2ew9_A149 Solution Structure Of Apowln5-6 Length = 149 6e-32
2ew9_A149 Solution Structure Of Apowln5-6 Length = 149 2e-10
2rop_A202 Solution Structure Of Domains 3 And 4 Of Human Atp7 2e-17
2rop_A202 Solution Structure Of Domains 3 And 4 Of Human Atp7 6e-14
1aw0_A72 Fourth Metal-Binding Domain Of The Menkes Copper- T 2e-15
1aw0_A72 Fourth Metal-Binding Domain Of The Menkes Copper- T 6e-10
1aw0_A72 Fourth Metal-Binding Domain Of The Menkes Copper- T 7e-07
1yju_A75 Solution Structure Of The Apo Form Of The Sixth Sol 2e-15
1yjr_A75 Solution Structure Of The Apo Form Of The Sixth Sol 3e-15
3cjk_B75 Crystal Structure Of The Adduct Hah1-Cd(Ii)-Mnk1 Le 7e-13
3cjk_B75 Crystal Structure Of The Adduct Hah1-Cd(Ii)-Mnk1 Le 8e-07
3cjk_B75 Crystal Structure Of The Adduct Hah1-Cd(Ii)-Mnk1 Le 2e-05
1y3k_A77 Solution Structure Of The Apo Form Of The Fifth Dom 2e-12
1y3k_A77 Solution Structure Of The Apo Form Of The Fifth Dom 2e-07
2k1r_A73 The Solution Nmr Structure Of The Complex Between M 4e-12
2k1r_A73 The Solution Nmr Structure Of The Complex Between M 4e-06
2k1r_A73 The Solution Nmr Structure Of The Complex Between M 6e-05
1kvi_A79 Solution Structure Of The Reduced Form Of The First 4e-12
1kvi_A79 Solution Structure Of The Reduced Form Of The First 4e-06
1kvi_A79 Solution Structure Of The Reduced Form Of The First 6e-05
2rml_A147 Solution Structure Of The N-Terminal Soluble Domain 2e-11
1p6t_A151 Structure Characterization Of The Water Soluble Reg 2e-11
1p8g_A73 The Solution Structure Of Apo Copz From Bacillus Su 1e-08
1p8g_A73 The Solution Structure Of Apo Copz From Bacillus Su 2e-05
2qif_A69 Crystal Structure Of A Metallochaperone With A Tetr 2e-08
2qif_A69 Crystal Structure Of A Metallochaperone With A Tetr 2e-05
1q8l_A84 Second Metal Binding Domain Of The Menkes Atpase Le 4e-08
1q8l_A84 Second Metal Binding Domain Of The Menkes Atpase Le 9e-07
1q8l_A84 Second Metal Binding Domain Of The Menkes Atpase Le 3e-05
1s6o_A76 Solution Structure And Backbone Dynamics Of The Apo 8e-08
1s6o_A76 Solution Structure And Backbone Dynamics Of The Apo 6e-07
1s6o_A76 Solution Structure And Backbone Dynamics Of The Apo 8e-05
1opz_A76 A Core Mutation Affecting The Folding Properties Of 1e-07
2l3m_A71 Solution Structure Of The Putative Copper-Ion-Bindi 4e-06
1kqk_A80 Solution Structure Of The N-Terminal Domain Of A Po 1e-05
2voy_A80 Cryoem Model Of Copa, The Copper Transporting Atpas 1e-05
2ggp_B72 Solution Structure Of The Atx1-Cu(I)-Ccc2a Complex 1e-05
1fvs_A72 Solution Structure Of The Yeast Copper Transporter 1e-05
2g9o_A90 Solution Structure Of The Apo Form Of The Third Met 3e-05
2g9o_A90 Solution Structure Of The Apo Form Of The Third Met 5e-05
1cpz_A68 Copper Chaperone Of Enterococcus Hirae (Apo-Form) L 7e-05
3j09_A 723 High Resolution Helical Reconstruction Of The Bacte 7e-05
3j09_A 723 High Resolution Helical Reconstruction Of The Bacte 1e-04
2ldi_A71 Nmr Solution Structure Of Ziaan Sub Mutant Length = 1e-04
2ofh_X111 Solution Structure Of The N-Terminal Domain Of The 1e-04
2ofg_X111 Solution Structure Of The N-Terminal Domain Of The 1e-04
2gcf_A73 Solution Structure Of The N-Terminal Domain Of The 6e-04
2xmw_A71 Pacs, N-Terminal Domain, From Synechocystis Pcc6803 8e-04
>pdb|2EW9|A Chain A, Solution Structure Of Apowln5-6 Length = 149 Back     alignment and structure 
Iteration: 1

 Score =  134 bits (337), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 63/138 (45%), Positives = 94/138 (68%)
Query: 131 VDGMKCQSCVKKIEATIGEKPGINSVLVALLAAKAEIRYSKDLISPTEIAASISELGFPA 190
           + GM C SCV  IE  + ++ G+ SVLVAL+A KAEI+Y  ++I P EIA  I +LGF A
Sbjct: 10  IKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEA 69
Query: 191 TVIDEAGSGEGELELKISGMSCASCVNKIETSVKKLAGIKSAVVALTTQRGKFRYDLEVT 250
            V+++    +G +EL I+GM+CASCV+ IE+ + +  GI  A VAL T +   ++D E+ 
Sbjct: 70  AVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEII 129
Query: 251 GPRDVMECIEKLGFTTAL 268
           GPRD+++ IE++GF  +L
Sbjct: 130 GPRDIIKIIEEIGFHASL 147
>pdb|2EW9|A Chain A, Solution Structure Of Apowln5-6 Length = 149 Back     alignment and structure
>pdb|2ROP|A Chain A, Solution Structure Of Domains 3 And 4 Of Human Atp7b Length = 202 Back     alignment and structure
>pdb|2ROP|A Chain A, Solution Structure Of Domains 3 And 4 Of Human Atp7b Length = 202 Back     alignment and structure
>pdb|1AW0|A Chain A, Fourth Metal-Binding Domain Of The Menkes Copper- Transporting Atpase, Nmr, 20 Structures Length = 72 Back     alignment and structure
>pdb|1AW0|A Chain A, Fourth Metal-Binding Domain Of The Menkes Copper- Transporting Atpase, Nmr, 20 Structures Length = 72 Back     alignment and structure
>pdb|1AW0|A Chain A, Fourth Metal-Binding Domain Of The Menkes Copper- Transporting Atpase, Nmr, 20 Structures Length = 72 Back     alignment and structure
>pdb|1YJU|A Chain A, Solution Structure Of The Apo Form Of The Sixth Soluble Domain Of Menkes Protein Length = 75 Back     alignment and structure
>pdb|1YJR|A Chain A, Solution Structure Of The Apo Form Of The Sixth Soluble Domain A69p Mutant Of Menkes Protein Length = 75 Back     alignment and structure
>pdb|3CJK|B Chain B, Crystal Structure Of The Adduct Hah1-Cd(Ii)-Mnk1 Length = 75 Back     alignment and structure
>pdb|3CJK|B Chain B, Crystal Structure Of The Adduct Hah1-Cd(Ii)-Mnk1 Length = 75 Back     alignment and structure
>pdb|3CJK|B Chain B, Crystal Structure Of The Adduct Hah1-Cd(Ii)-Mnk1 Length = 75 Back     alignment and structure
>pdb|1Y3K|A Chain A, Solution Structure Of The Apo Form Of The Fifth Domain Of Menkes Protein Length = 77 Back     alignment and structure
>pdb|1Y3K|A Chain A, Solution Structure Of The Apo Form Of The Fifth Domain Of Menkes Protein Length = 77 Back     alignment and structure
>pdb|2K1R|A Chain A, The Solution Nmr Structure Of The Complex Between Mnk1 And Hah1 Mediated By Cu(I) Length = 73 Back     alignment and structure
>pdb|2K1R|A Chain A, The Solution Nmr Structure Of The Complex Between Mnk1 And Hah1 Mediated By Cu(I) Length = 73 Back     alignment and structure
>pdb|2K1R|A Chain A, The Solution Nmr Structure Of The Complex Between Mnk1 And Hah1 Mediated By Cu(I) Length = 73 Back     alignment and structure
>pdb|1KVI|A Chain A, Solution Structure Of The Reduced Form Of The First Heavy Metal Binding Motif Of The Menkes Protein Length = 79 Back     alignment and structure
>pdb|1KVI|A Chain A, Solution Structure Of The Reduced Form Of The First Heavy Metal Binding Motif Of The Menkes Protein Length = 79 Back     alignment and structure
>pdb|1KVI|A Chain A, Solution Structure Of The Reduced Form Of The First Heavy Metal Binding Motif Of The Menkes Protein Length = 79 Back     alignment and structure
>pdb|2RML|A Chain A, Solution Structure Of The N-Terminal Soluble Domains Of Bacillus Subtilis Copa Length = 147 Back     alignment and structure
>pdb|1P6T|A Chain A, Structure Characterization Of The Water Soluble Region Of P- Type Atpase Copa From Bacillus Subtilis Length = 151 Back     alignment and structure
>pdb|1P8G|A Chain A, The Solution Structure Of Apo Copz From Bacillus Subtilis Length = 73 Back     alignment and structure
>pdb|1P8G|A Chain A, The Solution Structure Of Apo Copz From Bacillus Subtilis Length = 73 Back     alignment and structure
>pdb|2QIF|A Chain A, Crystal Structure Of A Metallochaperone With A Tetranuclear Cu(I) Cluster Length = 69 Back     alignment and structure
>pdb|2QIF|A Chain A, Crystal Structure Of A Metallochaperone With A Tetranuclear Cu(I) Cluster Length = 69 Back     alignment and structure
>pdb|1Q8L|A Chain A, Second Metal Binding Domain Of The Menkes Atpase Length = 84 Back     alignment and structure
>pdb|1Q8L|A Chain A, Second Metal Binding Domain Of The Menkes Atpase Length = 84 Back     alignment and structure
>pdb|1Q8L|A Chain A, Second Metal Binding Domain Of The Menkes Atpase Length = 84 Back     alignment and structure
>pdb|1S6O|A Chain A, Solution Structure And Backbone Dynamics Of The Apo-Form Of The Second Metal-Binding Domain Of The Menkes Protein Atp7a Length = 76 Back     alignment and structure
>pdb|1S6O|A Chain A, Solution Structure And Backbone Dynamics Of The Apo-Form Of The Second Metal-Binding Domain Of The Menkes Protein Atp7a Length = 76 Back     alignment and structure
>pdb|1S6O|A Chain A, Solution Structure And Backbone Dynamics Of The Apo-Form Of The Second Metal-Binding Domain Of The Menkes Protein Atp7a Length = 76 Back     alignment and structure
>pdb|1OPZ|A Chain A, A Core Mutation Affecting The Folding Properties Of A Soluble Domain Of The Atpase Protein Copa From Bacillus Subtilis Length = 76 Back     alignment and structure
>pdb|2L3M|A Chain A, Solution Structure Of The Putative Copper-Ion-Binding Protein From Bacillus Anthracis Str. Ames Length = 71 Back     alignment and structure
>pdb|1KQK|A Chain A, Solution Structure Of The N-Terminal Domain Of A Potential Copper-Translocating P-Type Atpase From Bacillus Subtilis In The Cu(I)loaded State Length = 80 Back     alignment and structure
>pdb|2VOY|A Chain A, Cryoem Model Of Copa, The Copper Transporting Atpase From Archaeoglobus Fulgidus Length = 80 Back     alignment and structure
>pdb|2GGP|B Chain B, Solution Structure Of The Atx1-Cu(I)-Ccc2a Complex Length = 72 Back     alignment and structure
>pdb|1FVS|A Chain A, Solution Structure Of The Yeast Copper Transporter Domain Ccc2a In The Apo And Cu(I) Load States Length = 72 Back     alignment and structure
>pdb|2G9O|A Chain A, Solution Structure Of The Apo Form Of The Third Metal- Binding Domain Of Atp7a Protein (Menkes Disease Protein) Length = 90 Back     alignment and structure
>pdb|2G9O|A Chain A, Solution Structure Of The Apo Form Of The Third Metal- Binding Domain Of Atp7a Protein (Menkes Disease Protein) Length = 90 Back     alignment and structure
>pdb|1CPZ|A Chain A, Copper Chaperone Of Enterococcus Hirae (Apo-Form) Length = 68 Back     alignment and structure
>pdb|3J09|A Chain A, High Resolution Helical Reconstruction Of The Bacterial P-Type Atpase Copper Transporter Copa Length = 723 Back     alignment and structure
>pdb|3J09|A Chain A, High Resolution Helical Reconstruction Of The Bacterial P-Type Atpase Copper Transporter Copa Length = 723 Back     alignment and structure
>pdb|2LDI|A Chain A, Nmr Solution Structure Of Ziaan Sub Mutant Length = 71 Back     alignment and structure
>pdb|2OFH|X Chain X, Solution Structure Of The N-Terminal Domain Of The Zinc(Ii) Atpase Ziaa In Its Apo Form Length = 111 Back     alignment and structure
>pdb|2OFG|X Chain X, Solution Structure Of The N-Terminal Domain Of The Zinc(Ii) Atpase Ziaa In Its Apo Form Length = 111 Back     alignment and structure
>pdb|2GCF|A Chain A, Solution Structure Of The N-Terminal Domain Of The Coppper(I) Atpase Pacs In Its Apo Form Length = 73 Back     alignment and structure
>pdb|2XMW|A Chain A, Pacs, N-Terminal Domain, From Synechocystis Pcc6803 Length = 71 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query287
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 6e-49
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 5e-41
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 2e-18
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 5e-18
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 2e-42
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 1e-38
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 1e-39
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 2e-19
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 4e-23
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 3e-15
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 7e-15
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 1e-20
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 7e-19
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 7e-17
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 1e-20
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 3e-18
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 4e-16
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 3e-20
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 3e-18
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 4e-16
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 4e-20
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 3e-18
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 2e-16
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 7e-20
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 1e-17
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 5e-17
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 8e-20
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 1e-16
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 4e-16
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 1e-19
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 1e-18
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 3e-15
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 2e-19
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 5e-19
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 4e-17
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 2e-19
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 5e-16
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 5e-15
1opz_A76 Potential copper-transporting ATPase; mutation, fo 1e-18
1opz_A76 Potential copper-transporting ATPase; mutation, fo 2e-13
1opz_A76 Potential copper-transporting ATPase; mutation, fo 4e-13
2l3m_A71 Copper-ION-binding protein; structural genomics, c 2e-18
2l3m_A71 Copper-ION-binding protein; structural genomics, c 2e-17
2l3m_A71 Copper-ION-binding protein; structural genomics, c 1e-14
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 3e-18
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 4e-15
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 7e-13
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 3e-18
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 1e-15
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 3e-15
2kkh_A95 Putative heavy metal transporter; zinc transport, 6e-18
2kkh_A95 Putative heavy metal transporter; zinc transport, 1e-17
2kkh_A95 Putative heavy metal transporter; zinc transport, 2e-16
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 8e-17
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 1e-14
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 3e-13
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1e-16
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 2e-16
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 3e-14
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 2e-16
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 1e-13
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 2e-13
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 4e-15
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 3e-13
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 3e-11
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 1e-14
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 1e-10
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 2e-08
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 3e-14
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 1e-12
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 2e-10
1yg0_A66 COP associated protein; open-faced beta-sandwich, 4e-13
1yg0_A66 COP associated protein; open-faced beta-sandwich, 4e-10
1yg0_A66 COP associated protein; open-faced beta-sandwich, 3e-09
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 4e-13
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 4e-12
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 1e-10
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 4e-12
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 9e-11
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 3e-10
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 2e-10
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 3e-07
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 2e-06
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 2e-09
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 5e-09
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 2e-07
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 1e-08
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 9e-08
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 3e-07
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 2e-08
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 5e-08
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 8e-06
2kyz_A67 Heavy metal binding protein; structural genomics, 3e-07
2kyz_A67 Heavy metal binding protein; structural genomics, 4e-07
2kyz_A67 Heavy metal binding protein; structural genomics, 3e-06
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 1e-06
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 3e-05
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 4e-05
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 1e-05
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 4e-04
1qup_A 222 Superoxide dismutase 1 copper chaperone; two domai 2e-04
1jk9_B 249 CCS, copper chaperone for superoxide dismutase; pr 2e-04
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 7e-04
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 9e-04
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 Back     alignment and structure
 Score =  158 bits (402), Expect = 6e-49
 Identities = 63/143 (44%), Positives = 95/143 (66%)

Query: 126 EATFTVDGMKCQSCVKKIEATIGEKPGINSVLVALLAAKAEIRYSKDLISPTEIAASISE 185
           +    + GM C SCV  IE  + ++ G+ SVLVAL+A KAEI+Y  ++I P EIA  I +
Sbjct: 5   KCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQD 64

Query: 186 LGFPATVIDEAGSGEGELELKISGMSCASCVNKIETSVKKLAGIKSAVVALTTQRGKFRY 245
           LGF A V+++    +G +EL I+GM+CASCV+ IE+ + +  GI  A VAL T +   ++
Sbjct: 65  LGFEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKF 124

Query: 246 DLEVTGPRDVMECIEKLGFTTAL 268
           D E+ GPRD+++ IE++GF  +L
Sbjct: 125 DPEIIGPRDIIKIIEEIGFHASL 147
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Length = 75 Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Length = 75 Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Length = 75 Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Length = 72 Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Length = 72 Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Length = 72 Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79 Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79 Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79 Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Length = 75 Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Length = 75 Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Length = 75 Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Length = 77 Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Length = 77 Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Length = 77 Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Length = 90 Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Length = 90 Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Length = 90 Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} Length = 74 Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} Length = 74 Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} Length = 74 Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Length = 72 Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Length = 72 Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Length = 72 Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Length = 84 Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Length = 84 Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Length = 84 Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Length = 76 Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Length = 76 Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Length = 76 Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Length = 71 Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Length = 71 Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Length = 71 Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Length = 68 Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Length = 68 Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Length = 68 Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95 Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95 Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95 Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Length = 72 Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Length = 72 Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Length = 72 Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Length = 80 Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Length = 80 Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Length = 80 Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723 Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723 Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723 Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Length = 73 Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Length = 73 Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Length = 73 Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Length = 71 Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Length = 71 Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Length = 71 Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66 Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66 Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66 Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Length = 69 Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Length = 69 Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Length = 69 Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Length = 71 Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Length = 71 Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Length = 71 Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85 Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85 Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85 Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Length = 73 Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Length = 73 Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Length = 73 Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64 Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64 Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64 Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Length = 67 Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Length = 67 Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Length = 67 Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query287
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 99.9
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 99.9
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 99.89
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 99.88
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 99.85
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 99.84
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 99.36
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 99.36
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 99.32
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 99.32
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 99.32
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 99.3
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 99.22
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 99.19
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.19
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 99.18
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.18
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 99.17
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 99.17
2l3m_A71 Copper-ION-binding protein; structural genomics, c 99.17
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 99.16
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 99.16
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 99.14
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 99.14
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 99.14
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 99.14
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 99.13
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 99.13
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 99.13
2l3m_A71 Copper-ION-binding protein; structural genomics, c 99.12
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 99.12
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 99.12
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 99.11
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 99.11
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 99.11
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 99.1
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 99.1
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 99.09
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 99.09
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 99.08
1opz_A76 Potential copper-transporting ATPase; mutation, fo 99.07
1yg0_A66 COP associated protein; open-faced beta-sandwich, 99.07
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 99.07
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 99.06
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 99.06
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 99.06
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 99.06
1opz_A76 Potential copper-transporting ATPase; mutation, fo 99.05
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 99.05
1yg0_A66 COP associated protein; open-faced beta-sandwich, 99.05
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 99.04
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 99.02
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 99.02
2kkh_A95 Putative heavy metal transporter; zinc transport, 99.02
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 99.01
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 99.01
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 99.0
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 98.99
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 98.98
2kkh_A95 Putative heavy metal transporter; zinc transport, 98.93
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 98.93
2kyz_A67 Heavy metal binding protein; structural genomics, 98.92
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 98.89
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 98.89
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 98.88
2kyz_A67 Heavy metal binding protein; structural genomics, 98.86
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 98.85
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 98.84
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 98.79
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 98.67
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 98.53
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 98.47
1qup_A 222 Superoxide dismutase 1 copper chaperone; two domai 98.45
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 98.41
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 98.33
1jk9_B 249 CCS, copper chaperone for superoxide dismutase; pr 98.3
4gwb_A168 Peptide methionine sulfoxide reductase MSRA 3; str 85.51
1fvg_A199 Peptide methionine sulfoxide reductase; oxidoreduc 83.29
3lvj_C82 Sulfurtransferase TUSA; protein-protein complex, s 82.44
4gwb_A168 Peptide methionine sulfoxide reductase MSRA 3; str 81.46
3bqh_A193 PILB, peptide methionine sulfoxide reductase MSRA/ 80.57
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
Probab=99.90  E-value=1.3e-22  Score=158.58  Aligned_cols=141  Identities=32%  Similarity=0.653  Sum_probs=126.4

Q ss_pred             ceEEEEEeeCCCChhhHHHHHHHHhcCCCeeEEEEeccCCeEEEEeCCCCCCHHHHHHHhhhccccccCCC----CCcee
Q psy13021         52 ASTVLISIDGMTCQSCVNTITDTIRAKPGVFNIKVSLEQKNANIRFNPIITNEETLRISIEDMGFDARLPS----TNDEA  127 (287)
Q Consensus        52 ~~~~~~~v~gm~C~~C~~~i~~~l~~~~gv~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~~~G~~~~~~~----~~~~~  127 (287)
                      |.+..|.|.||+|++|+..+++.|.+++||..+.+++..+.+.+.+++...+.+.+.+.+++.||.+....    .....
T Consensus         3 ~~~~~~~v~gm~C~~C~~~ie~~l~~~~gv~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~~~G~~~~~~~~~~~~~~~~   82 (149)
T 2ew9_A            3 PQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVMEDYAGSDGNI   82 (149)
T ss_dssp             CEEEEEEEECCCSSSHHHHHHHHHHTTSSCCCEEEETTTTEEEEEECTTTCCHHHHHHHHHHHTCEEEECSCSCCSSSEE
T ss_pred             cEEEEEEECCeecHHHHHHHHHHHhcCCCcEEEEEEecCCEEEEEEcCCCCCHHHHHHHHhcCCCceEeeccccccccee
Confidence            56788999999999999999999999999999999999999999998765577889999999999875322    12357


Q ss_pred             EEEECCCCChhHHHHHHHHhccCCCeeEEEEeeecceeeeeccCCCCChHHHHHHhhhcCCCcee
Q psy13021        128 TFTVDGMKCQSCVKKIEATIGEKPGINSVLVALLAAKAEIRYSKDLISPTEIAASISELGFPATV  192 (287)
Q Consensus       128 ~~~v~gm~C~~C~~~ie~~l~~~~gV~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~~~G~~~~~  192 (287)
                      .|.|.||+|++|+++|+++|.+++||..+.+|+.++++.+.|++..+..++|.+.++++||.+.+
T Consensus        83 ~~~v~gm~C~~C~~~ie~~l~~~~gv~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~~~Gy~~~~  147 (149)
T 2ew9_A           83 ELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHASL  147 (149)
T ss_dssp             EEEEESCCSHHHHHHHHHHHHHSSSCCEEEEETTTTEEEEECCTTTSCHHHHHHHHHHHTCEEEC
T ss_pred             EEEEEeccCHHHHHHHHHHHhcCCCeEEEEEEcCCCEEEEEECCCCCCHHHHHHHHHhCCCceEe
Confidence            89999999999999999999999999999999999999999998878899999999999998754
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>4gwb_A Peptide methionine sulfoxide reductase MSRA 3; structural genomics, protein structure initiative, nysgrc, R PSI-biology; 1.20A {Sinorhizobium meliloti} Back     alignment and structure
>1fvg_A Peptide methionine sulfoxide reductase; oxidoreductase; 1.60A {Bos taurus} SCOP: d.58.28.1 PDB: 1fva_A 2l90_A* Back     alignment and structure
>3lvj_C Sulfurtransferase TUSA; protein-protein complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PLP; 2.44A {Escherichia coli} SCOP: d.68.3.3 PDB: 3lvk_B* 1dcj_A Back     alignment and structure
>4gwb_A Peptide methionine sulfoxide reductase MSRA 3; structural genomics, protein structure initiative, nysgrc, R PSI-biology; 1.20A {Sinorhizobium meliloti} Back     alignment and structure
>3bqh_A PILB, peptide methionine sulfoxide reductase MSRA/MSRB; methionine sulfoxide reductase A, oxidized form, elect transport; 1.95A {Neisseria meningitidis} PDB: 3bqe_A 3bqf_A* 3bqg_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 287
d1p6ta279 d.58.17.1 (A:73-151) Potential copper-translocatin 2e-16
d1p6ta279 d.58.17.1 (A:73-151) Potential copper-translocatin 1e-15
d1p6ta279 d.58.17.1 (A:73-151) Potential copper-translocatin 7e-14
d1kvja_79 d.58.17.1 (A:) Menkes copper-transporting ATPase { 8e-16
d1kvja_79 d.58.17.1 (A:) Menkes copper-transporting ATPase { 5e-15
d1kvja_79 d.58.17.1 (A:) Menkes copper-transporting ATPase { 1e-14
d1osda_72 d.58.17.1 (A:) Mercuric ion binding protein MerP { 1e-15
d1osda_72 d.58.17.1 (A:) Mercuric ion binding protein MerP { 9e-15
d1osda_72 d.58.17.1 (A:) Mercuric ion binding protein MerP { 1e-14
d1p6ta172 d.58.17.1 (A:1-72) Potential copper-translocating 1e-15
d1p6ta172 d.58.17.1 (A:1-72) Potential copper-translocating 1e-13
d1p6ta172 d.58.17.1 (A:1-72) Potential copper-translocating 5e-13
d2aw0a_72 d.58.17.1 (A:) Menkes copper-transporting ATPase { 1e-15
d2aw0a_72 d.58.17.1 (A:) Menkes copper-transporting ATPase { 2e-15
d2aw0a_72 d.58.17.1 (A:) Menkes copper-transporting ATPase { 2e-14
d1q8la_84 d.58.17.1 (A:) Menkes copper-transporting ATPase { 1e-15
d1q8la_84 d.58.17.1 (A:) Menkes copper-transporting ATPase { 1e-13
d1q8la_84 d.58.17.1 (A:) Menkes copper-transporting ATPase { 1e-12
d1cpza_68 d.58.17.1 (A:) Copper chaperone {Enterococcus hira 3e-15
d1cpza_68 d.58.17.1 (A:) Copper chaperone {Enterococcus hira 1e-14
d1cpza_68 d.58.17.1 (A:) Copper chaperone {Enterococcus hira 7e-14
d2ggpb172 d.58.17.1 (B:1-72) Copper transporter domain ccc2a 2e-14
d2ggpb172 d.58.17.1 (B:1-72) Copper transporter domain ccc2a 2e-14
d2ggpb172 d.58.17.1 (B:1-72) Copper transporter domain ccc2a 2e-14
d2qifa169 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt 5e-14
d2qifa169 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt 8e-14
d2qifa169 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt 3e-13
d1mwza_73 d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, 2e-12
d1mwza_73 d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, 4e-12
d1mwza_73 d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, 3e-11
d1qupa272 d.58.17.1 (A:2-73) Copper chaperone for superoxide 3e-09
d1qupa272 d.58.17.1 (A:2-73) Copper chaperone for superoxide 6e-08
d1qupa272 d.58.17.1 (A:2-73) Copper chaperone for superoxide 1e-07
d1sb6a_64 d.58.17.1 (A:) Copper chaperone {Synechocystis sp. 1e-08
d1sb6a_64 d.58.17.1 (A:) Copper chaperone {Synechocystis sp. 4e-08
d1sb6a_64 d.58.17.1 (A:) Copper chaperone {Synechocystis sp. 1e-07
d1fe0a_66 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 9e-08
d1fe0a_66 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 2e-06
d1fe0a_66 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 2e-05
d1cc8a_72 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 8e-07
d1cc8a_72 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 3e-05
d1cc8a_72 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 7e-05
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Potential copper-translocating P-type ATPase CopA (YvgX)
species: Bacillus subtilis [TaxId: 1423]

 Score = 70.3 bits (172), Expect = 2e-16
 Identities = 18/77 (23%), Positives = 38/77 (49%)

Query: 125 DEATFTVDGMKCQSCVKKIEATIGEKPGINSVLVALLAAKAEIRYSKDLISPTEIAASIS 184
           ++A F ++GM C +C  +IE  + +  G+ +  V        + Y+    S +++  ++ 
Sbjct: 2   EKAEFDIEGMTCAACANRIEKRLNKIEGVANAPVNFALETVTVEYNPKEASVSDLKEAVD 61

Query: 185 ELGFPATVIDEAGSGEG 201
           +LG+   +  E  S EG
Sbjct: 62  KLGYKLKLKGEQDSIEG 78
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query287
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 99.59
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 99.56
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 99.55
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 99.55
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 99.55
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 99.54
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 99.53
d1p6ta279 Potential copper-translocating P-type ATPase CopA 99.53
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.52
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 99.52
d1p6ta279 Potential copper-translocating P-type ATPase CopA 99.51
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.51
d1p6ta172 Potential copper-translocating P-type ATPase CopA 99.51
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 99.51
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 99.51
d1p6ta172 Potential copper-translocating P-type ATPase CopA 99.5
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 99.5
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 99.5
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 99.37
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 99.36
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.35
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.32
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.26
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.25
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.23
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.23
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.22
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.19
d1dcja_81 SirA {Escherichia coli [TaxId: 562]} 84.85
d1je3a_97 hypothetical protein YedF (EC005) {Escherichia col 81.9
d1nwaa_168 Peptide methionine sulfoxide reductase {Mycobacter 81.05
d1jdqa_98 Hypothetical protein TM0983 {Thermotoga maritima [ 80.43
d1je3a_97 hypothetical protein YedF (EC005) {Escherichia col 80.07
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Copper chaperone
species: Enterococcus hirae [TaxId: 1354]

Probab=99.59  E-value=1.9e-15  Score=99.99  Aligned_cols=66  Identities=38%  Similarity=0.724  Sum_probs=63.1

Q ss_pred             eEEEECCCCChhHHHHHHHHhccCCCeeEEEEeeecceeeeeccCCCCChHHHHHHhhhcCCCcee
Q psy13021        127 ATFTVDGMKCQSCVKKIEATIGEKPGINSVLVALLAAKAEIRYSKDLISPTEIAASISELGFPATV  192 (287)
Q Consensus       127 ~~~~v~gm~C~~C~~~ie~~l~~~~gV~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~~~G~~~~~  192 (287)
                      ..|.|+||+|++|+++|++.|++++||.++++|+.++++.+.|++..+++++|.++|+++||++++
T Consensus         2 ~el~V~GM~C~~C~~~Ie~~l~~~~GV~~v~V~~~~~~v~v~~d~~~~~~~~i~~~i~~~Gy~a~v   67 (68)
T d1cpza_           2 QEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEV   67 (68)
T ss_dssp             CEEEESCCCSSSHHHHHHHHHHTSTTEEEEEEETTTTEEEEEECTTTCCHHHHHHHHHTTSSCEEE
T ss_pred             cEEEECCeEcHHHHHHHHHHHhcCCCcEEEEEECCCCEEEEEECCCCCCHHHHHHHHHhhCCCcEE
Confidence            369999999999999999999999999999999999999999999888999999999999999875
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcja_ d.68.3.3 (A:) SirA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1je3a_ d.68.3.3 (A:) hypothetical protein YedF (EC005) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nwaa_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jdqa_ d.68.3.3 (A:) Hypothetical protein TM0983 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1je3a_ d.68.3.3 (A:) hypothetical protein YedF (EC005) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure