Psyllid ID: psy13032

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
MERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIVDINVYSYLNDIEREQSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDEREYPIVLMLIYSAHNKAEKSLYSSSRRASSPLLP
ccccccccEEEEEcccHHHHHHHHHHHHHHccccccccccEEEEEHHHHHHcHHHHcccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHccccccEEEEccccccccHHHHHHHHHHHcccccccHHHHHHHHccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccc
ccccccccEEEEccccHHHHHHHHHccccccccccccccEEEEEEHHHEHHHHHHHHHHHHHHHHHHHHHHHHHHcHEEEHHcHHccHHHHHHHHHcccHccEEEccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHccHHHHHHHHHHHHHHHHHccccEEEEEEEcHHHHHHHccc
merfvpdfkvvpywgspqeRKILRQFWDmknlhtkdasFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIVDINVYSYLNDIEREQSMRWKLLLGFScrnrlllsgtpiQNSMAELWALLHFImpsmfdshdEFNEWFSKDIESHaenktsidereYPIVLMLIYSAHNKAEkslysssrrasspllp
merfvpdfkvvpywgspqeRKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIVDINVYSYLNDIEREQSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDIESHAenktsidereYPIVLMLIYSAHNkaekslysssrrasspllp
MERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIVDINVYSYLNDIEREQSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDEREYPIVLMLIYSAHNKAEKslysssrrasspllp
***FVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIVDINVYSYLNDIEREQSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDI*********IDEREYPIVLMLIYSA*********************
MERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIVDINVYSYLN*******MRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSK****************YPIVLMLIYSAHNKAEKSLYSSSRRASSPLLP
MERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIVDINVYSYLNDIEREQSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDEREYPIVLMLIYSAHNK******************
MERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIVDINVYSYLNDIEREQSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDEREYPIVLMLIYSAHNKAEKSLYSSSRRASS**L*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIVDINVYSYLNDIEREQSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDEREYPIVLMLIYSAHNKAEKSLYSSSRRASSPLLP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query190 2.2.26 [Sep-21-2011]
Q9VDY1 1638 Putative DNA helicase Ino yes N/A 0.810 0.094 0.777 2e-74
Q6ZPV2 1559 DNA helicase INO80 OS=Mus yes N/A 0.8 0.097 0.652 3e-63
Q9ULG1 1556 DNA helicase INO80 OS=Hom yes N/A 0.8 0.097 0.652 3e-63
Q6BGY8 1364 Putative DNA helicase INO yes N/A 0.768 0.107 0.647 3e-59
Q2UTQ9 1444 Putative DNA helicase ino yes N/A 0.8 0.105 0.624 1e-58
Q872I5 1997 Putative DNA helicase ino N/A N/A 0.8 0.076 0.630 2e-58
A1C9W6 1707 Putative DNA helicase ino N/A N/A 0.747 0.083 0.651 3e-58
Q74Z27 1414 Putative DNA helicase INO yes N/A 0.810 0.108 0.610 4e-58
A5E0W5 1575 Putative DNA helicase ino N/A N/A 0.810 0.097 0.610 5e-58
Q0CA78 1690 Putative DNA helicase ino N/A N/A 0.8 0.089 0.618 6e-58
>sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 Back     alignment and function desciption
 Score =  277 bits (709), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 129/166 (77%), Positives = 142/166 (85%), Gaps = 12/166 (7%)

Query: 1   MERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIK 60
           M RFVPDFKVVPYWGSP ERKILRQFWD K+LHT+DASFHVVITSYQLVVSD+KYFNRIK
Sbjct: 603 MSRFVPDFKVVPYWGSPAERKILRQFWDQKHLHTRDASFHVVITSYQLVVSDYKYFNRIK 662

Query: 61  WQYLILDEAQAIVDINVYSYLNDIEREQSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWA 120
           WQY++LDEAQA            I+   S RWKLLLGFSCRNRLLLSGTPIQNSMAELWA
Sbjct: 663 WQYMVLDEAQA------------IKSAASQRWKLLLGFSCRNRLLLSGTPIQNSMAELWA 710

Query: 121 LLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDEREYPIVLMLI 166
           LLHFIMP++FDSHDEFNEWFSKDIESHAENKT IDE++   + M++
Sbjct: 711 LLHFIMPTLFDSHDEFNEWFSKDIESHAENKTGIDEKQISRLHMIL 756
DNA helicase and probable main scaffold component of the chromatin remodeling Ino80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=2 SV=2 Back     alignment and function description
>sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 Back     alignment and function description
>sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 Back     alignment and function description
>sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 Back     alignment and function description
>sp|Q872I5|INO80_NEUCR Putative DNA helicase ino-80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ino-80 PE=3 SV=3 Back     alignment and function description
>sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 Back     alignment and function description
>sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 Back     alignment and function description
>sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 Back     alignment and function description
>sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query190
17862908 1638 SD02886p [Drosophila melanogaster] 0.810 0.094 0.777 1e-72
24648168 1638 Ino80 [Drosophila melanogaster] gi|75026 0.810 0.094 0.777 1e-72
158292419 1608 AGAP005035-PA [Anopheles gambiae str. PE 0.810 0.095 0.765 2e-72
194899976 1255 GG15975 [Drosophila erecta] gi|190651236 0.810 0.122 0.777 3e-72
195353647 1264 GM26907 [Drosophila sechellia] gi|194127 0.810 0.121 0.777 3e-72
195497948 1259 GE25128 [Drosophila yakuba] gi|194182418 0.810 0.122 0.777 3e-72
328786874 1636 PREDICTED: putative DNA helicase Ino80-l 0.810 0.094 0.771 9e-72
340721884 1631 PREDICTED: DNA helicase INO80-like [Bomb 0.810 0.094 0.771 9e-72
332024475 1115 Putative DNA helicase Ino80 [Acromyrmex 0.810 0.138 0.771 9e-72
350408082 1634 PREDICTED: DNA helicase INO80-like isofo 0.810 0.094 0.771 1e-71
>gi|17862908|gb|AAL39931.1| SD02886p [Drosophila melanogaster] Back     alignment and taxonomy information
 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 129/166 (77%), Positives = 142/166 (85%), Gaps = 12/166 (7%)

Query: 1   MERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIK 60
           M RFVPDFKVVPYWGSP ERKILRQFWD K+LHT+DASFHVVITSYQLVVSD+KYFNRIK
Sbjct: 603 MSRFVPDFKVVPYWGSPAERKILRQFWDQKHLHTRDASFHVVITSYQLVVSDYKYFNRIK 662

Query: 61  WQYLILDEAQAIVDINVYSYLNDIEREQSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWA 120
           WQY++LDEAQA            I+   S RWKLLLGFSCRNRLLLSGTPIQNSMAELWA
Sbjct: 663 WQYMVLDEAQA------------IKSAASQRWKLLLGFSCRNRLLLSGTPIQNSMAELWA 710

Query: 121 LLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDEREYPIVLMLI 166
           LLHFIMP++FDSHDEFNEWFSKDIESHAENKT IDE++   + M++
Sbjct: 711 LLHFIMPTLFDSHDEFNEWFSKDIESHAENKTGIDEKQISRLHMIL 756

Source: Drosophila melanogaster

Species: Drosophila melanogaster

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|24648168|ref|NP_732413.1| Ino80 [Drosophila melanogaster] gi|75026769|sp|Q9VDY1.2|INO80_DROME RecName: Full=Putative DNA helicase Ino80; Short=dINO80 gi|23171713|gb|AAF55658.2| Ino80 [Drosophila melanogaster] gi|383792226|gb|AFH41853.1| FI17525p1 [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|158292419|ref|XP_313902.4| AGAP005035-PA [Anopheles gambiae str. PEST] gi|157016983|gb|EAA09385.4| AGAP005035-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|194899976|ref|XP_001979533.1| GG15975 [Drosophila erecta] gi|190651236|gb|EDV48491.1| GG15975 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195353647|ref|XP_002043315.1| GM26907 [Drosophila sechellia] gi|194127429|gb|EDW49472.1| GM26907 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195497948|ref|XP_002096317.1| GE25128 [Drosophila yakuba] gi|194182418|gb|EDW96029.1| GE25128 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|328786874|ref|XP_393832.4| PREDICTED: putative DNA helicase Ino80-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340721884|ref|XP_003399343.1| PREDICTED: DNA helicase INO80-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|332024475|gb|EGI64673.1| Putative DNA helicase Ino80 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350408082|ref|XP_003488295.1| PREDICTED: DNA helicase INO80-like isoform 1 [Bombus impatiens] gi|350408084|ref|XP_003488296.1| PREDICTED: DNA helicase INO80-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query190
FB|FBgn0086613 1638 Ino80 "Ino80" [Drosophila mela 0.810 0.094 0.777 1.1e-65
MGI|MGI:1915392 1559 Ino80 "INO80 homolog (S. cerev 0.8 0.097 0.652 7.9e-57
UNIPROTKB|F1PKX5 1560 INO80 "Uncharacterized protein 0.8 0.097 0.652 8e-57
UNIPROTKB|E1BAN8 1566 INO80 "Uncharacterized protein 0.8 0.097 0.652 8.1e-57
UNIPROTKB|F1SSV0 1566 INO80 "Uncharacterized protein 0.8 0.097 0.652 8.1e-57
UNIPROTKB|H0YMN5 1104 INO80 "DNA helicase INO80" [Ho 0.8 0.137 0.652 1.2e-56
UNIPROTKB|Q9ULG1 1556 INO80 "DNA helicase INO80" [Ho 0.8 0.097 0.652 3.1e-56
UNIPROTKB|F1NYY9 1564 INO80 "Uncharacterized protein 0.8 0.097 0.652 3.1e-56
ZFIN|ZDB-GENE-041014-72 1582 ino80 "INO80 homolog (S. cerev 0.8 0.096 0.646 1.4e-55
CGD|CAL0000831 1387 orf19.1734 [Candida albicans ( 0.8 0.109 0.606 2.5e-51
FB|FBgn0086613 Ino80 "Ino80" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 681 (244.8 bits), Expect = 1.1e-65, P = 1.1e-65
 Identities = 129/166 (77%), Positives = 142/166 (85%)

Query:     1 MERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIK 60
             M RFVPDFKVVPYWGSP ERKILRQFWD K+LHT+DASFHVVITSYQLVVSD+KYFNRIK
Sbjct:   603 MSRFVPDFKVVPYWGSPAERKILRQFWDQKHLHTRDASFHVVITSYQLVVSDYKYFNRIK 662

Query:    61 WQYLILDEAQAIVDINVYSYLNDIEREQSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWA 120
             WQY++LDEAQAI            +   S RWKLLLGFSCRNRLLLSGTPIQNSMAELWA
Sbjct:   663 WQYMVLDEAQAI------------KSAASQRWKLLLGFSCRNRLLLSGTPIQNSMAELWA 710

Query:   121 LLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDEREYPIVLMLI 166
             LLHFIMP++FDSHDEFNEWFSKDIESHAENKT IDE++   + M++
Sbjct:   711 LLHFIMPTLFDSHDEFNEWFSKDIESHAENKTGIDEKQISRLHMIL 756
GO:0004386 "helicase activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0031011 "Ino80 complex" evidence=IDA
GO:0005700 "polytene chromosome" evidence=IDA
GO:0000975 "regulatory region DNA binding" evidence=IDA
GO:0010468 "regulation of gene expression" evidence=IMP
GO:0000790 "nuclear chromatin" evidence=IDA
MGI|MGI:1915392 Ino80 "INO80 homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PKX5 INO80 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BAN8 INO80 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SSV0 INO80 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|H0YMN5 INO80 "DNA helicase INO80" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ULG1 INO80 "DNA helicase INO80" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NYY9 INO80 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041014-72 ino80 "INO80 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
CGD|CAL0000831 orf19.1734 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8RXS6INO80_ARATH3, ., 6, ., 4, ., 1, 20.58860.76840.0968yesN/A
P0CO16INO80_CRYNJ3, ., 6, ., 4, ., 1, 20.58440.74210.0798yesN/A
Q74Z27INO80_ASHGO3, ., 6, ., 4, ., 1, 20.61070.81050.1089yesN/A
Q6ZPV2INO80_MOUSE3, ., 6, ., 4, ., 1, 20.65240.80.0974yesN/A
O14148INO80_SCHPO3, ., 6, ., 4, ., 1, 20.58680.81050.0960yesN/A
Q2UTQ9INO80_ASPOR3, ., 6, ., 4, ., 1, 20.62420.80.1052yesN/A
Q6CNY4INO80_KLULA3, ., 6, ., 4, ., 1, 20.59280.81050.1034yesN/A
P53115INO80_YEAST3, ., 6, ., 4, ., 1, 20.59880.81050.1034yesN/A
Q9ULG1INO80_HUMAN3, ., 6, ., 4, ., 1, 20.65240.80.0976yesN/A
A2R9H9INO80_ASPNC3, ., 6, ., 4, ., 1, 20.61070.81050.0907yesN/A
Q9VDY1INO80_DROME3, ., 6, ., 4, ., 1, 20.77710.81050.0940yesN/A
Q4WTV7INO80_ASPFU3, ., 6, ., 4, ., 1, 20.64510.74730.0831yesN/A
Q6BGY8INO80_DEBHA3, ., 6, ., 4, ., 1, 20.64770.76840.1070yesN/A
Q4IL82INO80_GIBZE3, ., 6, ., 4, ., 1, 20.60600.80.0798yesN/A
Q5BAZ5INO80_EMENI3, ., 6, ., 4, ., 1, 20.63870.74730.0880yesN/A
Q6FV37INO80_CANGA3, ., 6, ., 4, ., 1, 20.59280.81050.1037yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
pfam00176301 pfam00176, SNF2_N, SNF2 family N-terminal domain 1e-36
PLN03142 1033 PLN03142, PLN03142, Probable chromatin-remodeling 4e-26
COG0553 866 COG0553, HepA, Superfamily II DNA/RNA helicases, S 1e-20
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-10
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 2e-07
>gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain Back     alignment and domain information 
 Score =  128 bits (323), Expect = 1e-36
 Identities = 62/159 (38%), Positives = 87/159 (54%), Gaps = 20/159 (12%)

Query: 1   MERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKY---FN 57
            E++ P  +VV Y G  +ER  LRQ    K L T D    VVIT+Y+++  D K     N
Sbjct: 67  FEKWAPALRVVVYHGDGRERSKLRQS-MAKRLDTYD----VVITTYEVLRKDKKLLSLLN 121

Query: 58  RIKWQYLILDEAQAIVDINVYSYLNDIEREQSMRWKLLLGFSCRNRLLLSGTPIQNSMAE 117
           +++W  ++LDEA  +            +  +S  +K L     RNRLLL+GTPIQN++ E
Sbjct: 122 KVEWDRVVLDEAHRL------------KNSKSKLYKALKKLKTRNRLLLTGTPIQNNLEE 169

Query: 118 LWALLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDE 156
           LWALL+F+ P  F S   F EWF+  I + A+NK    E
Sbjct: 170 LWALLNFLRPGPFGSFKVFEEWFNIPIANTADNKNKNLE 208

This domain is found in proteins involved in a variety of processes including transcription regulation (e.g., SNF2, STH1, brahma, MOT1), DNA repair (e.g. ERCC6, RAD16, RAD5), DNA recombination (e.g. RAD54), and chromatin unwinding (e.g. ISWI) as well as a variety of other proteins with little functional information (e.g. lodestar, ETL1). Length = 301
>gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 190
KOG0391|consensus 1958 100.0
KOG0385|consensus 971 100.0
KOG0388|consensus 1185 100.0
KOG0392|consensus 1549 100.0
KOG0386|consensus 1157 99.97
KOG0389|consensus 941 99.96
KOG0387|consensus 923 99.96
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.96
KOG0384|consensus 1373 99.95
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.91
KOG4439|consensus 901 99.91
KOG1015|consensus 1567 99.88
KOG0390|consensus 776 99.87
KOG1002|consensus 791 99.85
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.84
KOG1016|consensus 1387 99.78
KOG0383|consensus 696 99.77
KOG1001|consensus 674 99.76
PRK04914 956 ATP-dependent helicase HepA; Validated 99.73
KOG0298|consensus 1394 99.73
KOG1000|consensus 689 99.7
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 99.11
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 98.65
PF04851184 ResIII: Type III restriction enzyme, res subunit; 98.49
PRK13766 773 Hef nuclease; Provisional 98.42
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 98.35
smart00487201 DEXDc DEAD-like helicases superfamily. 98.26
PHA02558 501 uvsW UvsW helicase; Provisional 98.19
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 97.98
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 97.94
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 97.84
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 97.67
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 97.67
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 97.61
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 97.58
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 97.57
KOG1123|consensus 776 97.57
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 97.5
PRK10689 1147 transcription-repair coupling factor; Provisional 97.4
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 97.37
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 97.36
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 97.18
PRK13767 876 ATP-dependent helicase; Provisional 97.16
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 97.15
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 97.11
COG1205 851 Distinct helicase family with a unique C-terminal 97.11
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 97.09
COG1204 766 Superfamily II helicase [General function predicti 97.08
COG4096 875 HsdR Type I site-specific restriction-modification 97.07
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 97.06
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 97.04
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 97.03
KOG0354|consensus 746 97.02
PRK00254 720 ski2-like helicase; Provisional 97.01
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 96.96
PRK02362 737 ski2-like helicase; Provisional 96.92
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 96.87
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 96.81
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 96.81
PTZ00424 401 helicase 45; Provisional 96.8
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 96.8
PTZ00110 545 helicase; Provisional 96.74
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 96.55
COG1201 814 Lhr Lhr-like helicases [General function predictio 96.54
PRK01172 674 ski2-like helicase; Provisional 96.39
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 96.36
TIGR00595 505 priA primosomal protein N'. All proteins in this f 96.23
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 96.13
PRK09401 1176 reverse gyrase; Reviewed 96.1
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 96.09
COG0610 962 Type I site-specific restriction-modification syst 96.05
smart00489289 DEXDc3 DEAD-like helicases superfamily. 96.04
smart00488289 DEXDc2 DEAD-like helicases superfamily. 96.04
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 95.99
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 95.93
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 95.75
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 95.53
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 95.31
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 95.0
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 94.89
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 94.87
PRK05580 679 primosome assembly protein PriA; Validated 94.8
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 94.65
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 94.61
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 94.4
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 94.18
COG4889 1518 Predicted helicase [General function prediction on 94.01
PRK10536262 hypothetical protein; Provisional 93.88
KOG0952|consensus 1230 93.64
PRK14701 1638 reverse gyrase; Provisional 93.6
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 93.43
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 93.23
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 93.11
KOG0330|consensus 476 92.58
KOG0343|consensus 758 92.16
PHA02653 675 RNA helicase NPH-II; Provisional 91.66
KOG0352|consensus 641 91.33
KOG0350|consensus 620 91.3
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 90.69
PRK09694 878 helicase Cas3; Provisional 90.33
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 90.09
KOG0331|consensus 519 89.85
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 89.59
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 89.32
KOG0345|consensus 567 88.21
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 87.95
KOG1132|consensus 945 87.54
KOG1803|consensus 649 87.48
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 87.29
KOG4284|consensus 980 86.47
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 86.35
KOG1133|consensus 821 86.23
KOG0947|consensus 1248 86.02
PLN03025 319 replication factor C subunit; Provisional 85.84
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 84.66
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 84.63
KOG0351|consensus 941 84.62
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 84.5
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 84.49
PF13173128 AAA_14: AAA domain 84.14
KOG0338|consensus 691 84.05
COG4098 441 comFA Superfamily II DNA/RNA helicase required for 84.0
COG4646637 DNA methylase [Transcription / DNA replication, re 82.08
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 82.04
COG1202 830 Superfamily II helicase, archaea-specific [General 81.97
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 81.81
PRK04296190 thymidine kinase; Provisional 81.72
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 81.62
PRK10875 615 recD exonuclease V subunit alpha; Provisional 81.47
KOG1131|consensus 755 80.78
>KOG0391|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.5e-35  Score=270.32  Aligned_cols=165  Identities=43%  Similarity=0.789  Sum_probs=150.9

Q ss_pred             CCccCCCCeEEEEeCCHHHHHHHHHHhhhhcccCCCCCccEEEecHHHHHhcHHHhhccCccEEEEcccccccCcccccc
Q psy13032          1 MERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIVDINVYSY   80 (190)
Q Consensus         1 i~k~~p~l~v~~~~G~~~~r~~~~~~~~~~~~~~~~~~~dvvitsy~~~~~~~~~l~~~~w~~vIvDEaH~lkn~~~~~~   80 (190)
                      |+||||+++++.|.|+.++|+..++-|      .+...||||||||..+..+...|....|.|+|+||||+|||      
T Consensus       684 lKRwcPglKILTYyGs~kErkeKRqgW------~kPnaFHVCItSYklv~qd~~AFkrkrWqyLvLDEaqnIKn------  751 (1958)
T KOG0391|consen  684 LKRWCPGLKILTYYGSHKERKEKRQGW------AKPNAFHVCITSYKLVFQDLTAFKRKRWQYLVLDEAQNIKN------  751 (1958)
T ss_pred             HhhhCCcceEeeecCCHHHHHHHhhcc------cCCCeeEEeehhhHHHHhHHHHHHhhccceeehhhhhhhcc------
Confidence            589999999999999999999999887      45678999999999999999999999999999999999999      


Q ss_pred             cchhhhhhhHHHHHHhcCCcCcEEEEecCCCCCCHHHHHHHHHhhCCCCCCChHHHHHHHhhhhhhhhhccCccchhhhh
Q psy13032         81 LNDIEREQSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDEREYP  160 (190)
Q Consensus        81 ~~~~~~~~s~~~~~~~~l~~~~r~lLTgTP~~n~~~el~~ll~fl~p~~~~~~~~F~~~~~~~~~~~~~~~~~~~~~~~~  160 (190)
                            .++.+|+++..+++.+|+||||||+||++.|||+||+||.|..|.+.+.|+.||.+|+..-.+....-....+.
T Consensus       752 ------fksqrWQAllnfnsqrRLLLtgTPLqNslmELWSLmhFLmP~~f~shd~fk~wfsnPltgmiEgsqeyn~klV~  825 (1958)
T KOG0391|consen  752 ------FKSQRWQALLNFNSQRRLLLTGTPLQNSLMELWSLMHFLMPQTFASHDIFKPWFSNPLTGMIEGSQEYNHKLVI  825 (1958)
T ss_pred             ------hhHHHHHHHhccchhheeeecCCchhhHHHHHHHHHHHhhchhhhhhhhHHHHhcCcchhhcccchhhchHHHH
Confidence                  99999999999999999999999999999999999999999999999999999999988777777777778888


Q ss_pred             hHHHhh-----cccCCHHHhHHHHHHHH
Q psy13032        161 IVLMLI-----YSAHNKAEKSLYSSSRR  183 (190)
Q Consensus       161 ~l~~~l-----~~~~~~~e~~ly~~~~~  183 (190)
                      +||+++     |+.+.+||++++.+.+.
T Consensus       826 RLHkVlrPfiLRRlK~dVEKQlpkKyEH  853 (1958)
T KOG0391|consen  826 RLHKVLRPFILRRLKRDVEKQLPKKYEH  853 (1958)
T ss_pred             HHHHHhHHHHHHHHHHHHHHhcchhhhh
Confidence            888864     56777888887777654

>KOG0385|consensus Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG1133|consensus Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4646 DNA methylase [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
3mwy_W 800 Crystal Structure Of The Chromodomain-atpase Portio 9e-16
1z6a_A 500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN 8e-11
1z63_A 500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COM 2e-10
1z3i_X 644 Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMA 1e-04
>pdb|3MWY|W Chain W, Crystal Structure Of The Chromodomain-atpase Portion Of The Yeast Chd1 Chromatin Remodeler Length = 800 Back     alignment and structure 
Iteration: 1

 Score = 79.7 bits (195), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 82/165 (49%), Gaps = 17/165 (10%)
Query: 2   ERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDAS---FHVVITSYQLVVSDFKYFNR 58
           E++ PD   + Y G+ + R  +R++    N   K      F+V++T+Y+ ++ D      
Sbjct: 306 EKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGS 365
Query: 59  IKWQYLILDEAQAIVDINVYSYLNDIEREQSMRWKLLLGFSCRNRLLLSGTPIQNSMAEL 118
           IKWQ++ +DEA  +            +  +S  ++ L  F   NR+L++GTP+QN++ EL
Sbjct: 366 IKWQFMAVDEAHRL------------KNAESSLYESLNSFKVANRMLITGTPLQNNIKEL 413
Query: 119 WALLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDEREYPIVL 163
            AL++F+MP  F    E +  F    E   E    +  R  P +L
Sbjct: 414 AALVNFLMPGRFTIDQEID--FENQDEEQEEYIHDLHRRIQPFIL 456
>pdb|1Z6A|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN Length = 500 Back     alignment and structure
>pdb|1Z63|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COMPLEX With Dsdna Length = 500 Back     alignment and structure
>pdb|1Z3I|X Chain X, Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMAIN OF EUKARYOTIC Rad54 Length = 644 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 4e-43
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 4e-33
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 3e-30
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 6e-20
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 Back     alignment and structure
 Score =  151 bits (384), Expect = 4e-43
 Identities = 40/143 (27%), Positives = 75/143 (52%), Gaps = 15/143 (10%)

Query: 2   ERFVPDFKVVPYWGSPQERKILRQ---FWDMKNLHTKDASFHVVITSYQLVVSDFKYFNR 58
           E++ PD   + Y G+ + R  +R+   + + +    K   F+V++T+Y+ ++ D      
Sbjct: 306 EKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGS 365

Query: 59  IKWQYLILDEAQAIVDINVYSYLNDIEREQSMRWKLLLGFSCRNRLLLSGTPIQNSMAEL 118
           IKWQ++ +DEA  +            +  +S  ++ L  F   NR+L++GTP+QN++ EL
Sbjct: 366 IKWQFMAVDEAHRL------------KNAESSLYESLNSFKVANRMLITGTPLQNNIKEL 413

Query: 119 WALLHFIMPSMFDSHDEFNEWFS 141
            AL++F+MP  F    E +    
Sbjct: 414 AALVNFLMPGRFTIDQEIDFENQ 436
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query190
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 99.93
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.93
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.91
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.67
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.32
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 98.9
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 98.77
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 98.74
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 98.72
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 98.72
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 98.71
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 98.68
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 98.67
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 98.65
4gl2_A 699 Interferon-induced helicase C domain-containing P; 98.57
3h1t_A 590 Type I site-specific restriction-modification syst 98.57
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 98.52
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 98.42
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 98.4
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 98.38
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 98.23
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 98.23
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 98.23
3b6e_A216 Interferon-induced helicase C domain-containing P; 98.22
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 98.22
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 98.18
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 98.17
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 98.1
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 98.09
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 98.08
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 98.03
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 98.02
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 97.97
3bor_A237 Human initiation factor 4A-II; translation initiat 97.97
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 97.95
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 97.93
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 97.92
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 97.89
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 97.81
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 97.81
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 97.8
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 97.79
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 97.78
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 97.75
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 97.75
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 97.73
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 97.6
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 97.52
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 97.48
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 97.47
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 97.45
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 97.41
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 97.33
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 97.32
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 97.31
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 97.3
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 97.3
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 97.04
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 97.01
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 96.98
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 96.69
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 96.09
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 95.89
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 95.65
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 95.63
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 95.37
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 95.14
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 94.9
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 94.67
1yks_A 440 Genome polyprotein [contains: flavivirin protease 94.64
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 94.07
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 93.71
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 93.57
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 93.2
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 91.11
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 90.21
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 89.89
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 89.52
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 88.68
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 84.68
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 84.52
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 84.1
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 80.12
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
Probab=99.93  E-value=6.8e-27  Score=211.23  Aligned_cols=171  Identities=20%  Similarity=0.288  Sum_probs=131.3

Q ss_pred             CCccCCC-CeEEEEe-CCHHHHHHHHHHhhhhcccCCCCCccEEEecHHHHHhcHHHhhccCccEEEEcccccccCcccc
Q psy13032          1 MERFVPD-FKVVPYW-GSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIVDINVY   78 (190)
Q Consensus         1 i~k~~p~-l~v~~~~-G~~~~r~~~~~~~~~~~~~~~~~~~dvvitsy~~~~~~~~~l~~~~w~~vIvDEaH~lkn~~~~   78 (190)
                      |++|+|. +.++.++ |+...+......+...  ......++|+||||++++.+.+.+....|++||+||||++||    
T Consensus       133 ~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~--~~~~~~~~vvi~ty~~l~~~~~~l~~~~~~~vI~DEaH~ikn----  206 (644)
T 1z3i_X          133 VGKWLGGRVQPVAIDGGSKDEIDSKLVNFISQ--QGMRIPTPILIISYETFRLHAEVLHKGKVGLVICDEGHRLKN----  206 (644)
T ss_dssp             HHHHHGGGCCEEEECSSCHHHHHHHHHHHHCC--CSSCCSCCEEEEEHHHHHHHTTTTTTSCCCEEEETTGGGCCT----
T ss_pred             HHHHcCCCeeEEEEeCCCHHHHHHHHHHHHHh--cCCCCCCcEEEeeHHHHHhhHHHhhcCCccEEEEECceecCC----
Confidence            3578774 6666555 4554443333222111  111246899999999999988888889999999999999999    


Q ss_pred             cccchhhhhhhHHHHHHhcCCcCcEEEEecCCCCCCHHHHHHHHHhhCCCCCCChHHHHHHHhhhhhhhhhccCccchh-
Q psy13032         79 SYLNDIEREQSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDER-  157 (190)
Q Consensus        79 ~~~~~~~~~~s~~~~~~~~l~~~~r~lLTgTP~~n~~~el~~ll~fl~p~~~~~~~~F~~~~~~~~~~~~~~~~~~~~~-  157 (190)
                              ..++.++++..+++.+||+|||||++|++.|||++++|+.|+.|++...|.++|..|+..+........+. 
T Consensus       207 --------~~~~~~~al~~l~~~~rl~LTgTPiqN~l~El~sll~fl~p~~l~~~~~F~~~f~~pi~~~~~~~~~~~~~~  278 (644)
T 1z3i_X          207 --------SDNQTYLALNSMNAQRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAQEFKKRFEIPILKGRDADASDKDRA  278 (644)
T ss_dssp             --------TCHHHHHHHHHHCCSEEEEECSSCSGGGGGGCHHHHHHHHHHHHCCHHHHHHHTHHHHHHHHSTTCCSHHHH
T ss_pred             --------hhhHHHHHHHhcccCcEEEEecCcccCCHHHHHHHHHhhCCCcCCCHHHHHHhhcchhhhcCCcCCCHHHHH
Confidence                    89999999999999999999999999999999999999999999999999999999998776544332211 


Q ss_pred             ----------------------------hhhhHHHhhcccCCHHHhHHHHHHHHhh
Q psy13032        158 ----------------------------EYPIVLMLIYSAHNKAEKSLYSSSRRAS  185 (190)
Q Consensus       158 ----------------------------~~~~l~~~l~~~~~~~e~~ly~~~~~~~  185 (190)
                                                  ++++...++.+.+++.|+++|+.+.+..
T Consensus       279 ~~~~~~~~L~~~l~~~~lRR~k~~v~~~LP~k~~~~v~~~ls~~q~~lY~~~~~~~  334 (644)
T 1z3i_X          279 AGEQKLQELISIVNRCLIRRTSDILSKYLPVKIEQVVCCNLTPLQKELYKLFLKQA  334 (644)
T ss_dssp             HHHHHHHHHHHHHHHHEECCCGGGGGGTSCCEEEEEEEECCCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHhhHHhHhhhCCCceEEEEEeCCCHHHHHHHHHHHHHH
Confidence                                        1222223345578999999999987654
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 190
d1z3ix2298 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fis 3e-14
d1z63a1230 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 h 1e-10
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 298 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Rad54-like, Rad54L
species: Zebra fish (Danio rerio) [TaxId: 7955]

 Score = 67.0 bits (162), Expect = 3e-14
 Identities = 28/158 (17%), Positives = 62/158 (39%), Gaps = 12/158 (7%)

Query: 1   MERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIK 60
           + +++             + +I  +  +  +         ++I SY+      +  ++ K
Sbjct: 133 VGKWLGGRVQPVAIDGGSKDEIDSKLVNFISQQGMRIPTPILIISYETFRLHAEVLHKGK 192

Query: 61  WQYLILDEAQAIVDINVYSYLNDIEREQSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWA 120
              +I DE   +            +   +  +  L   + + R+L+SGTPIQN + E ++
Sbjct: 193 VGLVICDEGHRL------------KNSDNQTYLALNSMNAQRRVLISGTPIQNDLLEYFS 240

Query: 121 LLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDERE 158
           L+HF+   +  +  EF + F   I    +   S  +R 
Sbjct: 241 LVHFVNSGILGTAQEFKKRFEIPILKGRDADASDKDRA 278
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 230 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query190
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.93
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.93
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 98.7
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 98.68
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 98.45
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 98.26
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 98.21
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.93
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 97.78
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 97.52
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 97.41
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 97.36
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 97.29
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 97.24
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 97.1
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 96.96
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 96.95
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 96.68
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 96.6
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 96.49
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 96.26
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 95.58
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 88.99
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 88.96
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 86.71
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Rad54-like, Rad54L
species: Zebra fish (Danio rerio) [TaxId: 7955]

Probab=99.93  E-value=1.8e-27  Score=194.46  Aligned_cols=141  Identities=20%  Similarity=0.327  Sum_probs=115.5

Q ss_pred             CCccCCC-CeEEEEeCCHHHH-HHHHHHhhhhcccCCCCCccEEEecHHHHHhcHHHhhccCccEEEEcccccccCcccc
Q psy13032          1 MERFVPD-FKVVPYWGSPQER-KILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIVDINVY   78 (190)
Q Consensus         1 i~k~~p~-l~v~~~~G~~~~r-~~~~~~~~~~~~~~~~~~~dvvitsy~~~~~~~~~l~~~~w~~vIvDEaH~lkn~~~~   78 (190)
                      |+||+|+ +.++.++|..+.+ ......+  .........++++|+||+.++.+.+.+....|++||+||||++||    
T Consensus       133 i~k~~~~~~~~v~~~~~~~~~~~~~~~~~--~~~~~~~~~~~v~i~sy~~~~~~~~~l~~~~~~~vI~DEaH~ikn----  206 (298)
T d1z3ix2         133 VGKWLGGRVQPVAIDGGSKDEIDSKLVNF--ISQQGMRIPTPILIISYETFRLHAEVLHKGKVGLVICDEGHRLKN----  206 (298)
T ss_dssp             HHHHHGGGCCEEEECSSCHHHHHHHHHHH--HCCCSSCCSCCEEEEEHHHHHHHTTTTTTSCCCEEEETTGGGCCT----
T ss_pred             HHhhcCCceeEEEEeCchHHHHHHHHHHh--hhccCccccceEEEEeecccccchhcccccceeeeeccccccccc----
Confidence            3578874 5666666655443 2222211  111223456789999999999999999999999999999999999    


Q ss_pred             cccchhhhhhhHHHHHHhcCCcCcEEEEecCCCCCCHHHHHHHHHhhCCCCCCChHHHHHHHhhhhhhhhhccCccc
Q psy13032         79 SYLNDIEREQSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSID  155 (190)
Q Consensus        79 ~~~~~~~~~~s~~~~~~~~l~~~~r~lLTgTP~~n~~~el~~ll~fl~p~~~~~~~~F~~~~~~~~~~~~~~~~~~~  155 (190)
                              ..|+.++++..++++++|+|||||++|++.|||++++||+|+.|++...|.++|+.|+..+...+....
T Consensus       207 --------~~s~~~~a~~~l~~~~rllLTGTPi~N~~~dl~~ll~fl~p~~~~~~~~F~~~f~~pi~~~~~~~~~~~  275 (298)
T d1z3ix2         207 --------SDNQTYLALNSMNAQRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAQEFKKRFEIPILKGRDADASDK  275 (298)
T ss_dssp             --------TCHHHHHHHHHHCCSEEEEECSSCSGGGGGGCHHHHHHHHHHHHCCHHHHHHHTHHHHHHHHSTTCCSH
T ss_pred             --------ccchhhhhhhccccceeeeecchHHhhhhHHHHHHHHHhCCCcCCCHHHHHHHHhhHHHhCcccCCcHH
Confidence                    999999999999999999999999999999999999999999999999999999999998876655443
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure