Psyllid ID: psy1304


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MTGRITAVSLKPLLTQILFEGEYLIFSKGTVTAKVLSSRKQRKEDRIGESQPFRGQTLSVQDKIRPGRGSNPRPSAYKADAPTSNLTRLGLLGARDCLYRENLIDIPIIIADLKNESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEYNTRAQESEVQKCT
ccccEEEEEEHHHHHHHHHcccEEEEEccEEEEEEEcccccccccccccccccccEEEEEEcEEEEEcccccccccEEEEEcccccccHHHHHccccccccccccccEEEEEcccHHHHHHHHHcccEEEEccccHHHHHHHHHHHHHHHcccEEEccccHHHHHHHHHHHHHHHHHcccEEcc
cccEEEEEccHHHHHHHHHcccEEEEEcccEEEEEEccccccccEEEEcccccccEEEEEEEEcccccccccHHHHHHHHHccccccEEEEEcccHHHHHHcHccccEEEEEcccHHHHHHHHHHcEEEEEccccHHHccHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHHHccccEcc
mtgritavslkpLLTQILFEGEYLIFSKGTVTAKVLSSRKqrkedrigesqpfrgqtlsvqdkirpgrgsnprpsaykadaptsnltrlgllgardclyrenliDIPIIIADLKNESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKthhvditgepyFMEYMQYEYNTRAQESEVQKCT
mtgritavslkpllTQILFEGEYLIFSKGTVTAKVlssrkqrkedrigesqpfrgqtlsvqdkirpgrgsnprpsaykadaptsnltrlGLLGARDCLYRENLIDIPIIIADLKNESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEYNtraqesevqkct
MTGRITAVSLKPLLTQILFEGEYLIFSKGTVTAKVLSSRKQRKEDRIGESQPFRGQTLSVQDKIRPGRGSNPRPSAYKADAPTSNLTRLGLLGARDCLYRENLIDIPIIIADLKNESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEYNTRAQESEVQKCT
****ITAVSLKPLLTQILFEGEYLIFSKGTVTAKV**************************************************LTRLGLLGARDCLYRENLIDIPIIIADLKNESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEYN************
****I*AVSLKPLLTQILFEGEYLIFSKGTVTAKVLSSRKQRKEDRIGESQPFRGQTLSVQDKIRPGRGSNPRPSAYKADAPTSNLTRLGLL*********NLIDIPIIIADLKNESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEYNTRAQESEVQKCT
MTGRITAVSLKPLLTQILFEGEYLIFSKGTVT**********************GQTLSVQDKIRPGRGSNPRPSAYKADAPTSNLTRLGLLGARDCLYRENLIDIPIIIADLKNESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEYNTR**********
*TGRITAVSLKPLLTQILFEGEYLIFSKGTVTAKVLSSRKQRKEDRIGESQPFRGQTLSVQDKIRPGRGSNPRPSAYKADAPTSNLTRLGLLGARDCLYRENLIDIPIIIADLKNESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEYNTRAQESE*QKC*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTGRITAVSLKPLLTQILFEGEYLIFSKGTVTAKVLSSRKQRKEDRIGESQPFRGQTLSVQDKIRPGRGSNPRPSAYKADAPTSNLTRLGLLGARDCLYRENLIDIPIIIADLKNESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEYNTRAQESEVQKCT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query184 2.2.26 [Sep-21-2011]
Q3T067 429 Saccharopine dehydrogenas yes N/A 0.413 0.177 0.513 5e-17
Q6AY30 429 Saccharopine dehydrogenas yes N/A 0.413 0.177 0.526 9e-17
Q8R127 429 Saccharopine dehydrogenas yes N/A 0.413 0.177 0.5 2e-16
Q8NBX0 429 Saccharopine dehydrogenas yes N/A 0.413 0.177 0.5 2e-16
Q5R5C9 429 Saccharopine dehydrogenas yes N/A 0.413 0.177 0.486 1e-15
Q8LGI2 454 Probable mitochondrial sa yes N/A 0.396 0.160 0.397 9e-12
Q7D745 419 Putative trans-acting eno yes N/A 0.472 0.207 0.375 1e-09
O53176 419 Putative trans-acting eno yes N/A 0.472 0.207 0.375 1e-09
P95139 418 Trans-acting enoyl reduct yes N/A 0.336 0.148 0.435 5e-09
A5U6W1 418 Trans-acting enoyl reduct no N/A 0.336 0.148 0.435 5e-09
>sp|Q3T067|SCPDL_BOVIN Saccharopine dehydrogenase-like oxidoreductase OS=Bos taurus GN=SCCPDH PE=2 SV=1 Back     alignment and function desciption
 Score = 87.0 bits (214), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 55/76 (72%)

Query: 105 DIPIIIADLKNESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFM 164
           ++ III D+ N +S+  MAK+  V+LNCVGPY +YGE V+KACIE  T  +DI+GEP F+
Sbjct: 71  EVGIIICDITNPASLDEMAKQATVVLNCVGPYRFYGEPVIKACIENGTSCIDISGEPQFL 130

Query: 165 EYMQYEYNTRAQESEV 180
           E M ++Y+ +A E  V
Sbjct: 131 ELMYWKYHEKAAEKGV 146





Bos taurus (taxid: 9913)
EC: 1EC: .EC: -EC: .EC: -EC: .EC: -
>sp|Q6AY30|SCPDL_RAT Saccharopine dehydrogenase-like oxidoreductase OS=Rattus norvegicus GN=Sccpdh PE=2 SV=1 Back     alignment and function description
>sp|Q8R127|SCPDL_MOUSE Saccharopine dehydrogenase-like oxidoreductase OS=Mus musculus GN=Sccpdh PE=2 SV=1 Back     alignment and function description
>sp|Q8NBX0|SCPDL_HUMAN Saccharopine dehydrogenase-like oxidoreductase OS=Homo sapiens GN=SCCPDH PE=1 SV=1 Back     alignment and function description
>sp|Q5R5C9|SCPDL_PONAB Saccharopine dehydrogenase-like oxidoreductase OS=Pongo abelii GN=SCCPDH PE=2 SV=1 Back     alignment and function description
>sp|Q8LGI2|SCPDL_ARATH Probable mitochondrial saccharopine dehydrogenase-like oxidoreductase At5g39410 OS=Arabidopsis thaliana GN=At5g39410 PE=1 SV=2 Back     alignment and function description
>sp|Q7D745|Y2525_MYCTU Putative trans-acting enoyl reductase MT2525 OS=Mycobacterium tuberculosis GN=MT2525 PE=3 SV=2 Back     alignment and function description
>sp|O53176|Y2449_MYCTU Putative trans-acting enoyl reductase Rv2449c OS=Mycobacterium tuberculosis GN=Rv2449c PE=1 SV=3 Back     alignment and function description
>sp|P95139|TAER_MYCTU Trans-acting enoyl reductase OS=Mycobacterium tuberculosis GN=Rv2953 PE=1 SV=1 Back     alignment and function description
>sp|A5U6W1|TAER_MYCTA Trans-acting enoyl reductase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_2980 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
289739645 427 putative saccharopine dehydrogenase [Glo 0.434 0.187 0.6 2e-23
195451958 430 GK13975 [Drosophila willistoni] gi|19416 0.440 0.188 0.604 3e-23
195055899 431 GH13859 [Drosophila grimshawi] gi|193892 0.440 0.187 0.592 9e-23
158290701 430 AGAP002652-PA [Anopheles gambiae str. PE 0.434 0.186 0.6 1e-22
198450546 612 GA18705 [Drosophila pseudoobscura pseudo 0.440 0.132 0.580 4e-22
195453709 434 GK14366 [Drosophila willistoni] gi|19416 0.440 0.186 0.580 4e-22
194742644 433 GF17952 [Drosophila ananassae] gi|190626 0.467 0.198 0.539 9e-22
237651917215 saccharopine dehydrogenase, partial [Dro 0.440 0.376 0.567 2e-21
157132590 425 hypothetical protein AaeL_AAEL002861 [Ae 0.434 0.188 0.55 3e-21
94469068 425 saccharopine dehydrogenase domain-contai 0.434 0.188 0.55 3e-21
>gi|289739645|gb|ADD18570.1| putative saccharopine dehydrogenase [Glossina morsitans morsitans] Back     alignment and taxonomy information
 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 66/80 (82%)

Query: 101 ENLIDIPIIIADLKNESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGE 160
           +NL+ IPII+AD+ +ESS+L MA++C V++NCVGPY +YGE VV+ACIE+ THHVD++GE
Sbjct: 56  KNLMSIPIIVADVDDESSLLQMARRCHVLVNCVGPYRFYGEPVVRACIESGTHHVDVSGE 115

Query: 161 PYFMEYMQYEYNTRAQESEV 180
           P +ME MQ +Y+  AQE  V
Sbjct: 116 PQYMETMQLKYDREAQEKNV 135




Source: Glossina morsitans morsitans

Species: Glossina morsitans

Genus: Glossina

Family: Glossinidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195451958|ref|XP_002073150.1| GK13975 [Drosophila willistoni] gi|194169235|gb|EDW84136.1| GK13975 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195055899|ref|XP_001994850.1| GH13859 [Drosophila grimshawi] gi|193892613|gb|EDV91479.1| GH13859 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|158290701|ref|XP_312273.4| AGAP002652-PA [Anopheles gambiae str. PEST] gi|347968293|ref|XP_003436201.1| AGAP002652-PB [Anopheles gambiae str. PEST] gi|157018022|gb|EAA08164.4| AGAP002652-PA [Anopheles gambiae str. PEST] gi|333468072|gb|EGK96812.1| AGAP002652-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|198450546|ref|XP_001358029.2| GA18705 [Drosophila pseudoobscura pseudoobscura] gi|198131084|gb|EAL27166.2| GA18705 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195453709|ref|XP_002073906.1| GK14366 [Drosophila willistoni] gi|194169991|gb|EDW84892.1| GK14366 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|194742644|ref|XP_001953811.1| GF17952 [Drosophila ananassae] gi|190626848|gb|EDV42372.1| GF17952 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|237651917|gb|ACR08647.1| saccharopine dehydrogenase, partial [Drosophila silvestris] Back     alignment and taxonomy information
>gi|157132590|ref|XP_001656085.1| hypothetical protein AaeL_AAEL002861 [Aedes aegypti] gi|157132592|ref|XP_001656086.1| hypothetical protein AaeL_AAEL002861 [Aedes aegypti] gi|108881659|gb|EAT45884.1| AAEL002861-PB [Aedes aegypti] gi|108881660|gb|EAT45885.1| AAEL002861-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|94469068|gb|ABF18383.1| saccharopine dehydrogenase domain-containing protein [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
FB|FBgn0038038 431 CG5167 [Drosophila melanogaste 0.467 0.199 0.516 1.1e-20
FB|FBgn0037298 430 CG2604 [Drosophila melanogaste 0.440 0.188 0.518 6.6e-20
ZFIN|ZDB-GENE-041010-211 429 sccpdhb "saccharopine dehydrog 0.472 0.202 0.471 1.4e-17
UNIPROTKB|F1MX05 429 SCCPDH "Saccharopine dehydroge 0.679 0.291 0.416 1.4e-16
UNIPROTKB|Q3T067 429 SCCPDH "Saccharopine dehydroge 0.679 0.291 0.416 1.4e-16
UNIPROTKB|F1Q2B1 385 SCCPDH "Uncharacterized protei 0.413 0.197 0.513 3.4e-16
RGD|1311440 429 Sccpdh "saccharopine dehydroge 0.413 0.177 0.526 3.8e-16
UNIPROTKB|Q6AY30 429 Sccpdh "Saccharopine dehydroge 0.413 0.177 0.526 3.8e-16
UNIPROTKB|Q8NBX0 429 SCCPDH "Saccharopine dehydroge 0.679 0.291 0.409 6.3e-16
UNIPROTKB|Q5ZMK3 434 SCCPDH "Uncharacterized protei 0.690 0.292 0.369 6.5e-16
FB|FBgn0038038 CG5167 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 248 (92.4 bits), Expect = 1.1e-20, P = 1.1e-20
 Identities = 46/89 (51%), Positives = 66/89 (74%)

Query:    92 LGARDCLYRENLIDIPIIIADLKNESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAK 151
             +GA+    + +L   PI+IAD+ NE+S+L MAK+CR+++N  GPY ++GE VV+ACIEA 
Sbjct:    51 MGAKS---KTDLSQTPIVIADVNNEASLLEMAKRCRILVNTAGPYRFFGERVVRACIEAG 107

Query:   152 THHVDITGEPYFMEYMQYEYNTRAQESEV 180
             THHVD++GEP +ME MQ  Y+  A+E  V
Sbjct:   108 THHVDVSGEPQYMETMQLRYHDLAKERGV 136




GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
FB|FBgn0037298 CG2604 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041010-211 sccpdhb "saccharopine dehydrogenase b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MX05 SCCPDH "Saccharopine dehydrogenase-like oxidoreductase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T067 SCCPDH "Saccharopine dehydrogenase-like oxidoreductase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q2B1 SCCPDH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1311440 Sccpdh "saccharopine dehydrogenase (putative)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6AY30 Sccpdh "Saccharopine dehydrogenase-like oxidoreductase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NBX0 SCCPDH "Saccharopine dehydrogenase-like oxidoreductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMK3 SCCPDH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3T067SCPDL_BOVIN1, ., -, ., -, ., -0.51310.41300.1771yesN/A
Q6AY30SCPDL_RAT1, ., -, ., -, ., -0.52630.41300.1771yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
COG3268 382 COG3268, COG3268, Uncharacterized conserved protei 2e-16
pfam03435 380 pfam03435, Saccharop_dh, Saccharopine dehydrogenas 6e-07
COG1748 389 COG1748, LYS9, Saccharopine dehydrogenase and rela 8e-04
>gnl|CDD|225807 COG3268, COG3268, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
 Score = 75.6 bits (186), Expect = 2e-16
 Identities = 29/72 (40%), Positives = 42/72 (58%)

Query: 112 DLKNESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEY 171
            L   +++  MA + +V+LNCVGPYT YGE +V AC  A T + DITGE  F E     Y
Sbjct: 58  PLGVPAALEAMASRTQVVLNCVGPYTRYGEPLVAACAAAGTDYADITGEIMFFENSIDLY 117

Query: 172 NTRAQESEVQKC 183
           + +A ++  +  
Sbjct: 118 HAQAADAGARII 129


Length = 382

>gnl|CDD|217556 pfam03435, Saccharop_dh, Saccharopine dehydrogenase Back     alignment and domain information
>gnl|CDD|224662 COG1748, LYS9, Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 184
KOG2733|consensus 423 99.95
COG3268 382 Uncharacterized conserved protein [Function unknow 99.88
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 99.72
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 99.45
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 98.86
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 97.96
PF01073 280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 97.77
CHL00194 317 ycf39 Ycf39; Provisional 97.69
PF05368 233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 97.55
PLN03209 576 translocon at the inner envelope of chloroplast su 97.06
KOG2865|consensus 391 96.92
TIGR01181 317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 96.9
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 96.84
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 96.82
PLN02214 342 cinnamoyl-CoA reductase 96.8
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 96.74
KOG0172|consensus 445 96.51
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 96.5
PRK06179 270 short chain dehydrogenase; Provisional 96.39
PLN02427 386 UDP-apiose/xylose synthase 96.36
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 96.28
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 96.26
PRK00048 257 dihydrodipicolinate reductase; Provisional 96.04
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 96.01
TIGR01179 328 galE UDP-glucose-4-epimerase. This enzyme intercon 96.01
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 96.0
TIGR01214 287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 95.99
PLN00198 338 anthocyanidin reductase; Provisional 95.95
PRK09009 235 C factor cell-cell signaling protein; Provisional 95.92
PRK07856 252 short chain dehydrogenase; Provisional 95.86
PLN02695 370 GDP-D-mannose-3',5'-epimerase 95.84
TIGR00715 256 precor6x_red precorrin-6x reductase. This enzyme w 95.8
COG3967 245 DltE Short-chain dehydrogenase involved in D-alani 95.77
PLN02653 340 GDP-mannose 4,6-dehydratase 95.67
COG1091 281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 95.62
PRK06079 252 enoyl-(acyl carrier protein) reductase; Provisiona 95.61
PRK06182 273 short chain dehydrogenase; Validated 95.49
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 95.48
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 95.46
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 95.42
PLN02260 668 probable rhamnose biosynthetic enzyme 95.35
PRK05865 854 hypothetical protein; Provisional 95.34
PRK09186 256 flagellin modification protein A; Provisional 95.33
PRK06398 258 aldose dehydrogenase; Validated 95.26
PLN02650 351 dihydroflavonol-4-reductase 95.25
PLN02240 352 UDP-glucose 4-epimerase 95.24
PLN02253 280 xanthoxin dehydrogenase 95.12
PRK07326237 short chain dehydrogenase; Provisional 95.12
PLN00016 378 RNA-binding protein; Provisional 95.09
PRK05876 275 short chain dehydrogenase; Provisional 95.08
TIGR02197 314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 94.98
PRK06138 252 short chain dehydrogenase; Provisional 94.91
PRK06523 260 short chain dehydrogenase; Provisional 94.88
PRK13304 265 L-aspartate dehydrogenase; Reviewed 94.87
PRK05867 253 short chain dehydrogenase; Provisional 94.8
PRK07024 257 short chain dehydrogenase; Provisional 94.8
PRK08264 238 short chain dehydrogenase; Validated 94.72
PRK07231 251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.72
PRK05866 293 short chain dehydrogenase; Provisional 94.66
PRK05854 313 short chain dehydrogenase; Provisional 94.65
PRK06196 315 oxidoreductase; Provisional 94.63
PRK07478 254 short chain dehydrogenase; Provisional 94.57
KOG1502|consensus 327 94.55
PRK13394 262 3-hydroxybutyrate dehydrogenase; Provisional 94.54
PRK06171 266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 94.51
PRK08265 261 short chain dehydrogenase; Provisional 94.48
PRK07453 322 protochlorophyllide oxidoreductase; Validated 94.47
PRK08309177 short chain dehydrogenase; Provisional 94.47
PRK05884223 short chain dehydrogenase; Provisional 94.45
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 94.42
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 94.35
PF04321 286 RmlD_sub_bind: RmlD substrate binding domain; Inte 94.35
PRK08267 260 short chain dehydrogenase; Provisional 94.3
PRK07533 258 enoyl-(acyl carrier protein) reductase; Provisiona 94.21
PRK12320 699 hypothetical protein; Provisional 94.17
PRK12367 245 short chain dehydrogenase; Provisional 94.16
PRK06172 253 short chain dehydrogenase; Provisional 94.1
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 94.08
PRK09987 299 dTDP-4-dehydrorhamnose reductase; Provisional 94.08
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 94.08
PRK07370 258 enoyl-(acyl carrier protein) reductase; Validated 94.05
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 94.05
PRK06463 255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.04
PRK08643 256 acetoin reductase; Validated 94.0
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.99
TIGR02632 676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 93.97
PRK07890 258 short chain dehydrogenase; Provisional 93.95
PRK07063 260 short chain dehydrogenase; Provisional 93.95
PRK07201 657 short chain dehydrogenase; Provisional 93.95
PRK06200 263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 93.91
PRK06949 258 short chain dehydrogenase; Provisional 93.87
TIGR01850 346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 93.87
PRK06197 306 short chain dehydrogenase; Provisional 93.75
PRK06057 255 short chain dehydrogenase; Provisional 93.7
PRK06482 276 short chain dehydrogenase; Provisional 93.7
PRK06124 256 gluconate 5-dehydrogenase; Provisional 93.69
PRK05717 255 oxidoreductase; Validated 93.68
PRK08177225 short chain dehydrogenase; Provisional 93.68
PRK08220 252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 93.67
PRK08862227 short chain dehydrogenase; Provisional 93.65
PRK06180 277 short chain dehydrogenase; Provisional 93.65
PRK08416 260 7-alpha-hydroxysteroid dehydrogenase; Provisional 93.65
PRK07067 257 sorbitol dehydrogenase; Provisional 93.63
PRK07454241 short chain dehydrogenase; Provisional 93.6
PRK09291 257 short chain dehydrogenase; Provisional 93.57
PRK06505 271 enoyl-(acyl carrier protein) reductase; Provisiona 93.57
PRK08415 274 enoyl-(acyl carrier protein) reductase; Provisiona 93.56
PRK09135 249 pteridine reductase; Provisional 93.53
COG0451 314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 93.49
PRK08251 248 short chain dehydrogenase; Provisional 93.49
PRK10675 338 UDP-galactose-4-epimerase; Provisional 93.48
PLN02896 353 cinnamyl-alcohol dehydrogenase 93.48
COG2910211 Putative NADH-flavin reductase [General function p 93.47
PRK07825 273 short chain dehydrogenase; Provisional 93.47
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 93.46
PRK08339 263 short chain dehydrogenase; Provisional 93.46
PRK07062 265 short chain dehydrogenase; Provisional 93.45
PRK00436 343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 93.44
PRK05993 277 short chain dehydrogenase; Provisional 93.43
PRK07889 256 enoyl-(acyl carrier protein) reductase; Provisiona 93.4
PRK12828239 short chain dehydrogenase; Provisional 93.35
PRK08628 258 short chain dehydrogenase; Provisional 93.31
PRK06194 287 hypothetical protein; Provisional 93.28
PLN02725 306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 93.27
PRK07523 255 gluconate 5-dehydrogenase; Provisional 93.25
PRK05693 274 short chain dehydrogenase; Provisional 93.25
PRK07577 234 short chain dehydrogenase; Provisional 93.22
COG4221 246 Short-chain alcohol dehydrogenase of unknown speci 93.21
PRK07424 406 bifunctional sterol desaturase/short chain dehydro 93.16
TIGR01746 367 Thioester-redct thioester reductase domain. It has 93.16
PRK10538 248 malonic semialdehyde reductase; Provisional 93.12
PRK06125 259 short chain dehydrogenase; Provisional 93.1
PRK07814 263 short chain dehydrogenase; Provisional 93.08
PRK12481 251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 93.07
PRK05565 247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.05
COG0300 265 DltE Short-chain dehydrogenases of various substra 93.03
PRK08936 261 glucose-1-dehydrogenase; Provisional 93.02
PRK06114 254 short chain dehydrogenase; Provisional 93.0
PLN02686 367 cinnamoyl-CoA reductase 92.98
PRK05650 270 short chain dehydrogenase; Provisional 92.96
PRK08226 263 short chain dehydrogenase; Provisional 92.95
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 92.92
PRK06841 255 short chain dehydrogenase; Provisional 92.9
PRK08690 261 enoyl-(acyl carrier protein) reductase; Provisiona 92.9
PRK05875 276 short chain dehydrogenase; Provisional 92.9
PLN02583 297 cinnamoyl-CoA reductase 92.87
PRK08263 275 short chain dehydrogenase; Provisional 92.85
TIGR00036 266 dapB dihydrodipicolinate reductase. 92.82
TIGR03325 262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 92.82
PRK07984 262 enoyl-(acyl carrier protein) reductase; Provisiona 92.81
PRK12826 251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 92.79
PRK13302 271 putative L-aspartate dehydrogenase; Provisional 92.78
PRK08594 257 enoyl-(acyl carrier protein) reductase; Provisiona 92.78
PRK06935 258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 92.72
PRK05872 296 short chain dehydrogenase; Provisional 92.72
PRK08063 250 enoyl-(acyl carrier protein) reductase; Provisiona 92.69
PRK06181 263 short chain dehydrogenase; Provisional 92.67
PRK12428 241 3-alpha-hydroxysteroid dehydrogenase; Provisional 92.67
PRK08589 272 short chain dehydrogenase; Validated 92.62
COG0702 275 Predicted nucleoside-diphosphate-sugar epimerases 92.6
PRK12429 258 3-hydroxybutyrate dehydrogenase; Provisional 92.58
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 92.56
PLN02968 381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 92.53
PRK06139 330 short chain dehydrogenase; Provisional 92.49
PRK06947 248 glucose-1-dehydrogenase; Provisional 92.48
PRK05653 246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.42
PRK08277 278 D-mannonate oxidoreductase; Provisional 92.41
PRK08278 273 short chain dehydrogenase; Provisional 92.4
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 92.4
PRK06101 240 short chain dehydrogenase; Provisional 92.38
COG1088 340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 92.38
PRK05557 248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.36
PLN02778 298 3,5-epimerase/4-reductase 92.35
PRK07806 248 short chain dehydrogenase; Provisional 92.34
PRK05855 582 short chain dehydrogenase; Validated 92.33
PRK06198 260 short chain dehydrogenase; Provisional 92.31
PRK07109 334 short chain dehydrogenase; Provisional 92.27
TIGR01832 248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 92.26
PRK12823 260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 92.22
PRK09134 258 short chain dehydrogenase; Provisional 92.21
PRK14874 334 aspartate-semialdehyde dehydrogenase; Provisional 92.15
PRK07576 264 short chain dehydrogenase; Provisional 92.11
PRK08017 256 oxidoreductase; Provisional 92.08
PRK12748 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 92.05
PRK06914 280 short chain dehydrogenase; Provisional 92.04
PRK06603 260 enoyl-(acyl carrier protein) reductase; Provisiona 92.04
PRK08159 272 enoyl-(acyl carrier protein) reductase; Provisiona 92.01
TIGR01830 239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 91.99
TIGR03206 250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 91.93
PRK06483 236 dihydromonapterin reductase; Provisional 91.9
PRK07677 252 short chain dehydrogenase; Provisional 91.83
TIGR01500 256 sepiapter_red sepiapterin reductase. This model de 91.82
PRK07102 243 short chain dehydrogenase; Provisional 91.8
PRK07201 657 short chain dehydrogenase; Provisional 91.79
PRK07074 257 short chain dehydrogenase; Provisional 91.77
PRK07097 265 gluconate 5-dehydrogenase; Provisional 91.74
PRK08340 259 glucose-1-dehydrogenase; Provisional 91.7
PRK12829 264 short chain dehydrogenase; Provisional 91.66
PRK12935 247 acetoacetyl-CoA reductase; Provisional 91.65
PRK12939 250 short chain dehydrogenase; Provisional 91.51
PRK06500 249 short chain dehydrogenase; Provisional 91.46
PRK07041 230 short chain dehydrogenase; Provisional 91.44
PRK12384 259 sorbitol-6-phosphate dehydrogenase; Provisional 91.41
PRK06701 290 short chain dehydrogenase; Provisional 91.4
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 91.33
PRK08219227 short chain dehydrogenase; Provisional 91.31
PRK07023 243 short chain dehydrogenase; Provisional 91.3
PRK11150 308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 91.29
PRK12746 254 short chain dehydrogenase; Provisional 91.28
PRK06113 255 7-alpha-hydroxysteroid dehydrogenase; Validated 91.27
PLN02572 442 UDP-sulfoquinovose synthase 91.27
PRK12745 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 91.26
PRK07831 262 short chain dehydrogenase; Provisional 91.26
PRK12937 245 short chain dehydrogenase; Provisional 91.26
TIGR02415 254 23BDH acetoin reductases. One member of this famil 91.25
PRK12825 249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.16
PRK09072 263 short chain dehydrogenase; Provisional 91.14
PRK06123 248 short chain dehydrogenase; Provisional 91.11
PRK13303 265 L-aspartate dehydrogenase; Provisional 91.04
PRK06732229 phosphopantothenate--cysteine ligase; Validated 91.02
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 91.01
PRK06484 520 short chain dehydrogenase; Validated 91.01
PRK07774 250 short chain dehydrogenase; Provisional 90.97
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 90.96
TIGR03855 229 NAD_NadX aspartate dehydrogenase. Members of this 90.9
PRK07069 251 short chain dehydrogenase; Validated 90.88
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.66
PRK07832 272 short chain dehydrogenase; Provisional 90.52
PRK12548289 shikimate 5-dehydrogenase; Provisional 90.49
PRK12744 257 short chain dehydrogenase; Provisional 90.47
PRK06550 235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.44
TIGR01777 292 yfcH conserved hypothetical protein TIGR01777. Thi 90.44
PRK09242 257 tropinone reductase; Provisional 90.39
PRK07578199 short chain dehydrogenase; Provisional 90.37
PRK08057 248 cobalt-precorrin-6x reductase; Reviewed 90.35
PRK06484 520 short chain dehydrogenase; Validated 90.27
PRK05671 336 aspartate-semialdehyde dehydrogenase; Reviewed 90.22
PRK08993 253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 90.18
PRK05599 246 hypothetical protein; Provisional 90.12
PRK07775 274 short chain dehydrogenase; Provisional 90.11
PRK08642 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.08
PRK08085 254 gluconate 5-dehydrogenase; Provisional 90.07
PRK08217 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.05
TIGR01296 339 asd_B aspartate-semialdehyde dehydrogenase (peptid 90.05
PRK08213 259 gluconate 5-dehydrogenase; Provisional 90.03
PRK06997 260 enoyl-(acyl carrier protein) reductase; Provisiona 89.97
PLN02996 491 fatty acyl-CoA reductase 89.96
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 89.96
PLN02206 442 UDP-glucuronate decarboxylase 89.94
PRK07060 245 short chain dehydrogenase; Provisional 89.74
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 89.5
PRK12742 237 oxidoreductase; Provisional 89.49
PRK07904 253 short chain dehydrogenase; Provisional 89.44
PRK07791 286 short chain dehydrogenase; Provisional 89.37
PRK12936 245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 89.35
smart00822180 PKS_KR This enzymatic domain is part of bacterial 89.22
KOG1430|consensus 361 89.02
TIGR01829 242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 88.84
PLN02166 436 dTDP-glucose 4,6-dehydratase 88.7
PRK06940 275 short chain dehydrogenase; Provisional 88.61
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 88.59
PRK12827 249 short chain dehydrogenase; Provisional 88.56
PRK12743 256 oxidoreductase; Provisional 88.53
PRK06349 426 homoserine dehydrogenase; Provisional 88.06
PRK12938 246 acetyacetyl-CoA reductase; Provisional 87.99
PF13561 241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 87.89
PLN00015 308 protochlorophyllide reductase 87.89
PRK13301 267 putative L-aspartate dehydrogenase; Provisional 87.84
PRK06077 252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 87.67
TIGR01963 255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 87.62
PRK06924 251 short chain dehydrogenase; Provisional 87.55
PRK08703239 short chain dehydrogenase; Provisional 87.51
PRK12824 245 acetoacetyl-CoA reductase; Provisional 87.44
TIGR01921 324 DAP-DH diaminopimelate dehydrogenase. This model r 87.42
PRK06953222 short chain dehydrogenase; Provisional 87.38
PLN02383 344 aspartate semialdehyde dehydrogenase 87.32
PRK07035 252 short chain dehydrogenase; Provisional 87.23
COG2099 257 CobK Precorrin-6x reductase [Coenzyme metabolism] 86.99
TIGR03450 351 mycothiol_INO1 inositol 1-phosphate synthase, Acti 86.64
PRK06128 300 oxidoreductase; Provisional 86.56
KOG1200|consensus 256 86.56
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 86.53
PRK06720169 hypothetical protein; Provisional 86.52
PRK08303 305 short chain dehydrogenase; Provisional 86.36
COG0673 342 MviM Predicted dehydrogenases and related proteins 86.26
PRK08324 681 short chain dehydrogenase; Validated 86.03
PRK08040 336 putative semialdehyde dehydrogenase; Provisional 85.96
PLN02503 605 fatty acyl-CoA reductase 2 85.94
PRK09730 247 putative NAD(P)-binding oxidoreductase; Provisiona 85.86
PRK11579 346 putative oxidoreductase; Provisional 85.48
PF07994295 NAD_binding_5: Myo-inositol-1-phosphate synthase; 85.44
KOG0725|consensus 270 85.43
KOG1208|consensus 314 85.4
TIGR02685 267 pter_reduc_Leis pteridine reductase. Pteridine red 85.28
TIGR01831 239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 85.2
PRK07985 294 oxidoreductase; Provisional 85.17
PRK06270 341 homoserine dehydrogenase; Provisional 85.16
TIGR01851 310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 84.45
KOG1611|consensus 249 84.32
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 83.94
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 83.71
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 83.54
cd01483143 E1_enzyme_family Superfamily of activating enzymes 83.25
PRK12747 252 short chain dehydrogenase; Provisional 83.06
PRK10206 344 putative oxidoreductase; Provisional 82.87
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.72
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 82.42
PF02719 293 Polysacc_synt_2: Polysaccharide biosynthesis prote 81.07
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 80.68
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 80.38
TIGR00978 341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 80.06
PRK12549284 shikimate 5-dehydrogenase; Reviewed 80.05
>KOG2733|consensus Back     alignment and domain information
Probab=99.95  E-value=6.6e-28  Score=218.13  Aligned_cols=124  Identities=42%  Similarity=0.599  Sum_probs=112.2

Q ss_pred             ccccc-cccCccccceeeecccccCCCCCCCchhhhhhh--CCCCCceeEEeeeeccccc-----------ccCCCCCCE
Q psy1304          43 KEDRI-GESQPFRGQTLSVQDKIRPGRGSNPRPSAYKAD--APTSNLTRLGLLGARDCLY-----------RENLIDIPI  108 (184)
Q Consensus        43 ~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~La~--~~~~~~~~iaLAGrr~~lg-----------~~~~~~v~~  108 (184)
                      +||+| .+-++|+||-                +++++.+  ..++  ++||+|||++.+-           ...+.+..+
T Consensus         5 ~yDvVIyGASGfTG~y----------------ivee~v~~~~~~~--~slavAGRn~~KL~~vL~~~~~k~~~~ls~~~i   66 (423)
T KOG2733|consen    5 RYDVVIYGASGFTGKY----------------IVEEAVSSQVFEG--LSLAVAGRNEKKLQEVLEKVGEKTGTDLSSSVI   66 (423)
T ss_pred             eeeEEEEcccccccee----------------eHHHHhhhhcccC--ceEEEecCCHHHHHHHHHHHhhccCCCcccceE
Confidence            68887 8999999999                8888886  7777  9999999987422           223355559


Q ss_pred             EEEeCCCHHHHHHHhhcCcEEEeccccccccchHHHHHHHHcCCCEeeCCCChHHHHHHHHHhHHHHHHcCCeeeC
Q psy1304         109 IIADLKNESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEYNTRAQESEVQKCT  184 (184)
Q Consensus       109 v~vDv~D~~sL~a~l~~~dVVIN~aGPf~~~g~~VaeACieAGthYVDltGE~~~~~~ii~~lhe~AkaaGV~Ivt  184 (184)
                      +.+|.+|+++|.+|++++.+||||+|||..+|++|++||+++|+||+|++||+.|++.++.+||++|+++||+||+
T Consensus        67 ~i~D~~n~~Sl~emak~~~vivN~vGPyR~hGE~VVkacienG~~~vDISGEP~f~E~mq~kYhd~A~ekGVYIVs  142 (423)
T KOG2733|consen   67 LIADSANEASLDEMAKQARVIVNCVGPYRFHGEPVVKACIENGTHHVDISGEPQFMERMQLKYHDLAKEKGVYIVS  142 (423)
T ss_pred             EEecCCCHHHHHHHHhhhEEEEeccccceecCcHHHHHHHHcCCceeccCCCHHHHHHHHHHHHHHHHhcCeEEEe
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999985



>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>KOG2865|consensus Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>KOG0172|consensus Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>TIGR03855 NAD_NadX aspartate dehydrogenase Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08057 cobalt-precorrin-6x reductase; Reviewed Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>KOG1430|consensus Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2099 CobK Precorrin-6x reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03450 mycothiol_INO1 inositol 1-phosphate synthase, Actinobacterial type Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PF07994 NAD_binding_5: Myo-inositol-1-phosphate synthase; InterPro: IPR002587 1L-myo-Inositol-1-phosphate synthase (5 Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>KOG1611|consensus Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 2e-08
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Length = 118 Back     alignment and structure
 Score = 49.0 bits (117), Expect = 2e-08
 Identities = 11/72 (15%), Positives = 27/72 (37%), Gaps = 3/72 (4%)

Query: 105 DIPIIIADLKNESSILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFM 164
            +     D K+E+ +         +++   P+ +    + KA   A  H+ D+T +    
Sbjct: 49  GVATKQVDAKDEAGLAKALGGFDAVISAA-PF-FLTPIIAKAAKAAGAHYFDLTEDVAAT 106

Query: 165 EYMQYEYNTRAQ 176
             ++      +Q
Sbjct: 107 NAVR-ALVEDSQ 117


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 99.64
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 99.17
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 99.12
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 99.11
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 98.72
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 98.52
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 98.23
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 98.21
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 98.01
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 97.99
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 97.99
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 97.97
1xq6_A253 Unknown protein; structural genomics, protein stru 97.92
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 97.91
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 97.81
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 97.81
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 97.79
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 97.77
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 97.76
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 97.75
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 97.73
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 97.71
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 97.65
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 97.63
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.62
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 97.57
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 97.56
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 97.55
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 97.49
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 97.48
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 97.46
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 97.45
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 97.44
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 97.44
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 97.41
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 97.41
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 97.4
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.39
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 97.36
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 97.34
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 97.29
3ay3_A 267 NAD-dependent epimerase/dehydratase; glucuronic ac 97.26
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 97.25
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 97.25
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 97.13
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 97.1
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 97.05
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 97.03
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 96.99
2ggs_A 273 273AA long hypothetical DTDP-4-dehydrorhamnose red 96.96
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 96.86
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 96.85
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 96.84
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 96.84
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 96.79
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 96.79
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 96.77
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 96.76
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 96.75
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 96.75
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 96.71
4b79_A 242 PA4098, probable short-chain dehydrogenase; oxidor 96.7
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 96.69
2p5y_A 311 UDP-glucose 4-epimerase; TTHA0591, structural geno 96.65
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 96.61
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 96.61
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 96.59
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 96.59
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 96.55
3imf_A 257 Short chain dehydrogenase; structural genomics, in 96.54
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 96.51
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 96.48
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 96.47
3tpc_A 257 Short chain alcohol dehydrogenase-related dehydro; 96.44
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 96.43
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 96.41
1yo6_A 250 Putative carbonyl reductase sniffer; tyrosine-depe 96.4
1eq2_A 310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 96.4
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 96.37
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 96.37
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 96.33
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 96.29
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 96.26
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 96.26
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 96.25
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 96.22
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 96.22
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 96.14
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 96.12
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 96.11
4b8w_A 319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 96.11
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 96.09
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 96.09
3un1_A 260 Probable oxidoreductase; structural genomics, PSI- 96.03
4dqx_A 277 Probable oxidoreductase protein; structural genomi 96.02
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 96.02
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 95.99
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 95.98
2pnf_A 248 3-oxoacyl-[acyl-carrier-protein] reductase; short 95.97
1geg_A 256 Acetoin reductase; SDR family, oxidoreductase; HET 95.96
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 95.95
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 95.94
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 95.93
2h7i_A 269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 95.92
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 95.92
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 95.87
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 95.85
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 95.85
3rwb_A 247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 95.85
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 95.85
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 95.84
3afn_B 258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 95.84
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 95.84
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 95.82
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 95.82
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 95.81
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 95.79
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 95.78
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 95.78
4fs3_A 256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 95.77
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 95.77
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 95.76
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 95.75
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 95.73
2o23_A 265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 95.72
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 95.72
4dyv_A 272 Short-chain dehydrogenase/reductase SDR; structura 95.72
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 95.7
4e4y_A 244 Short chain dehydrogenase family protein; structur 95.69
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 95.68
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 95.68
3kzv_A 254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 95.67
2cfc_A 250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 95.66
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 95.66
1uay_A 242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 95.64
3gem_A 260 Short chain dehydrogenase; structural genomics, AP 95.64
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 95.63
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 95.62
3asu_A 248 Short-chain dehydrogenase/reductase SDR; SDR famil 95.61
1iy8_A 267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 95.61
3qiv_A 253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 95.61
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 95.6
1spx_A 278 Short-chain reductase family member (5L265); paral 95.57
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 95.57
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 95.57
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 95.56
1zk4_A 251 R-specific alcohol dehydrogenase; short chain redu 95.53
3i4f_A 264 3-oxoacyl-[acyl-carrier protein] reductase; struct 95.53
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 95.52
3a28_C 258 L-2.3-butanediol dehydrogenase; chiral substrate r 95.52
2pd6_A 264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 95.48
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 95.48
2nwq_A 272 Probable short-chain dehydrogenase; oxidoreductase 95.47
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 95.47
3grp_A 266 3-oxoacyl-(acyl carrierprotein) reductase; structu 95.45
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 95.45
3op4_A 248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 95.45
3d3w_A 244 L-xylulose reductase; uronate cycle, short-chain d 95.44
3tl3_A 257 Short-chain type dehydrogenase/reductase; ssgcid, 95.42
1nff_A 260 Putative oxidoreductase RV2002; directed evolution 95.42
3dii_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 95.4
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 95.39
2nm0_A 253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 95.38
1x1t_A 260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 95.38
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 95.36
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 95.35
2uvd_A 246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 95.34
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 95.33
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 95.33
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 95.32
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 95.32
2jah_A 247 Clavulanic acid dehydrogenase; short-chain dehydro 95.29
4f6c_A 427 AUSA reductase domain protein; thioester reductase 95.28
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 95.27
1uls_A 245 Putative 3-oxoacyl-acyl carrier protein reductase; 95.27
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 95.26
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 95.25
1xkq_A 280 Short-chain reductase family member (5D234); parra 95.25
3nyw_A 250 Putative oxidoreductase; fatty acid synthesis,3-ox 95.24
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 95.23
3rih_A 293 Short chain dehydrogenase or reductase; structural 95.23
3v2g_A 271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 95.22
2ew8_A 249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 95.2
1yb1_A 272 17-beta-hydroxysteroid dehydrogenase type XI; shor 95.2
3ijr_A 291 Oxidoreductase, short chain dehydrogenase/reducta; 95.2
1cyd_A 244 Carbonyl reductase; short-chain dehydrogenase, oxi 95.18
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 95.17
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 95.17
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 95.16
2d1y_A 256 Hypothetical protein TT0321; strucrtural genomics, 95.15
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 95.14
1xg5_A 279 ARPG836; short chain dehydrogenase, human, SGC, st 95.14
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 95.1
1xhl_A 297 Short-chain dehydrogenase/reductase family member 95.09
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 95.09
3cxt_A 291 Dehydrogenase with different specificities; rossma 95.08
1hxh_A 253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 95.06
4f6l_B 508 AUSA reductase domain protein; thioester reductase 95.06
3gaf_A 256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 95.06
1sny_A 267 Sniffer CG10964-PA; alpha and beta protein, rossma 95.06
3lyl_A 247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 95.05
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 95.05
2hq1_A 247 Glucose/ribitol dehydrogenase; CTH-1438, structura 95.04
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 95.04
2zat_A 260 Dehydrogenase/reductase SDR family member 4; alpha 95.03
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 95.03
4h15_A 261 Short chain alcohol dehydrogenase-related dehydro; 95.02
1mxh_A 276 Pteridine reductase 2; SDR topology, protein-subst 95.02
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 95.02
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 95.02
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 95.02
2q2v_A 255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 95.0
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 94.95
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 94.94
4iin_A 271 3-ketoacyl-acyl carrier protein reductase (FABG); 94.94
2dc1_A 236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 94.94
3ftp_A 270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 94.91
3gk3_A 269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 94.9
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 94.9
4eso_A 255 Putative oxidoreductase; NADP, structural genomics 94.89
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 94.89
4dry_A 281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 94.88
4dmm_A 269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 94.88
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 94.87
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 94.86
4imr_A 275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 94.86
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 94.85
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 94.85
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 94.84
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 94.84
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 94.83
1dhr_A 241 Dihydropteridine reductase; oxidoreductase(acting 94.83
3ctm_A 279 Carbonyl reductase; alcohol dehydrogenase, short-c 94.81
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 94.8
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 94.79
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 94.79
1qsg_A 265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 94.76
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 94.74
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 94.73
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 94.73
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 94.73
2ag5_A 246 DHRS6, dehydrogenase/reductase (SDR family) member 94.73
3gdg_A 267 Probable NADP-dependent mannitol dehydrogenase; ro 94.72
1ooe_A 236 Dihydropteridine reductase; structural genomics, P 94.7
2b4q_A 276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 94.69
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 94.68
2wsb_A 254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 94.62
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 94.62
2c07_A 285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 94.61
3osu_A 246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 94.61
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 94.6
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 94.6
3f9i_A 249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 94.6
3oid_A 258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 94.53
2ph3_A 245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 94.51
3f1l_A 252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 94.49
1edo_A 244 Beta-keto acyl carrier protein reductase; nucleoti 94.47
1uzm_A 247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 94.44
1xq1_A 266 Putative tropinone reducatse; structural genomics, 94.39
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 94.38
3ksu_A 262 3-oxoacyl-acyl carrier protein reductase; structur 94.37
3edm_A 259 Short chain dehydrogenase; structural genomics, ox 94.36
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 94.31
1sby_A 254 Alcohol dehydrogenase; ternary complex, NAD, trifl 94.3
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 94.22
1oaa_A 259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 94.21
2x9g_A 288 PTR1, pteridine reductase; short chain dehydrogena 94.12
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 94.02
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 94.0
3bio_A 304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 93.91
2dkn_A 255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 93.89
3uf0_A 273 Short-chain dehydrogenase/reductase SDR; gluconate 93.89
3rku_A 287 Oxidoreductase YMR226C; substrate fingerprint, sho 93.84
3uce_A 223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 93.81
4gkb_A 258 3-oxoacyl-[acyl-carrier protein] reductase; putati 93.76
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 93.72
4iiu_A 267 3-oxoacyl-[acyl-carrier protein] reductase; struct 93.7
2qq5_A 260 DHRS1, dehydrogenase/reductase SDR family member 1 93.64
4e3z_A 272 Putative oxidoreductase protein; PSI-biology, stru 93.63
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 93.62
1fjh_A 257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 93.61
3ged_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 93.57
2z5l_A 511 Tylkr1, tylactone synthase starter module and modu 93.54
3orf_A 251 Dihydropteridine reductase; alpha-beta-alpha sandw 93.45
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 93.36
1p9l_A 245 Dihydrodipicolinate reductase; oxidoreductase, lys 93.27
3ezl_A 256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 93.22
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 93.21
1e7w_A 291 Pteridine reductase; dihydrofolate reductase, shor 93.11
3ppi_A 281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 93.05
3r3s_A 294 Oxidoreductase; structural genomics, csgid, center 93.04
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 92.99
2ekp_A 239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 92.86
3u5t_A 267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 92.83
2qhx_A 328 Pteridine reductase 1; oxidoreductase, short-chain 92.68
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 92.68
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 92.66
2fr1_A 486 Erythromycin synthase, eryai; short chain dehydrog 92.46
4h3v_A 390 Oxidoreductase domain protein; structural genomics 92.28
1f06_A 320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 92.16
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 92.1
3c8m_A 331 Homoserine dehydrogenase; structural genomics, APC 91.78
3c1a_A 315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 91.42
1lc0_A 294 Biliverdin reductase A; oxidoreductase, tetrapyrro 91.4
3uuw_A 308 Putative oxidoreductase with NAD(P)-binding rossm 91.22
3fhl_A 362 Putative oxidoreductase; NAD-binding domain, PSI-2 91.05
3u0b_A 454 Oxidoreductase, short chain dehydrogenase/reducta 91.04
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 91.03
1dih_A 273 Dihydrodipicolinate reductase; oxidoreductase; HET 90.94
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 90.84
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 90.82
4f3y_A 272 DHPR, dihydrodipicolinate reductase; structural ge 90.75
3o9z_A 312 Lipopolysaccaride biosynthesis protein WBPB; oxido 90.73
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 90.57
2nu8_A 288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 90.53
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 90.34
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 90.23
2p2s_A 336 Putative oxidoreductase; YP_050235.1, structural g 90.23
4hp8_A 247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 90.21
3icc_A 255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 90.13
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 89.89
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 89.68
3qp9_A 525 Type I polyketide synthase pikaii; rossmann fold, 89.65
3f4l_A 345 Putative oxidoreductase YHHX; structural genomics, 89.57
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 89.53
3ijp_A 288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 89.5
1tlt_A 319 Putative oxidoreductase (virulence factor MVIM HO; 89.38
3mje_A 496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 89.37
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 89.29
1ydw_A 362 AX110P-like protein; structural genomics, protein 89.28
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 89.15
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 89.09
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 89.02
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 88.97
1o5i_A 249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 88.88
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 88.79
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 88.71
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 88.56
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 88.35
2yv1_A 294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 88.2
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 88.01
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 87.97
4gmf_A 372 Yersiniabactin biosynthetic protein YBTU; rossmann 87.94
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 87.7
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 87.67
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 87.36
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 87.31
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 87.06
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 86.98
3oa2_A 318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 86.83
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 86.78
1j5p_A 253 Aspartate dehydrogenase; TM1643, structural genomi 86.58
3oqb_A 383 Oxidoreductase; structural genomics, protein struc 86.5
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 86.38
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 86.31
4ew6_A 330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 85.91
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 85.86
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 85.73
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 85.56
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 85.4
2yv2_A 297 Succinyl-COA synthetase alpha chain; COA-binding d 85.3
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 85.27
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 85.25
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 85.04
4had_A 350 Probable oxidoreductase protein; structural genomi 84.62
4dpk_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 84.38
4dpl_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 84.38
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 84.37
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 84.27
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 84.07
3pwk_A 366 Aspartate-semialdehyde dehydrogenase; NADP binding 83.7
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 83.56
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 83.48
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 83.42
1oi7_A 288 Succinyl-COA synthetase alpha chain; SCS, ligase, 83.17
3u3x_A 361 Oxidoreductase; structural genomics, PSI-biology, 83.15
3ing_A 325 Homoserine dehydrogenase; NP_394635.1, structural 82.66
3tz6_A 344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 81.78
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 81.7
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 81.41
2hjs_A 340 USG-1 protein homolog; aspartate-semialdehyde dehy 81.26
3dr3_A 337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 81.05
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 80.97
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 80.67
2r00_A 336 Aspartate-semialdehyde dehydrogenase; conformation 80.63
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 80.43
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 80.4
3e9n_A 245 Putative short-chain dehydrogenase/reductase; stru 80.2
1vjp_A 394 MYO-inositol-1-phosphate synthase-related protein; 80.08
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
Probab=99.64  E-value=1.3e-16  Score=138.66  Aligned_cols=118  Identities=14%  Similarity=0.086  Sum_probs=91.8

Q ss_pred             hhhhccccc-cccCccccceeeecccccCCCCCCCchhhhhhhCCCCCceeEEeeeecccccccCCCCCCEEEEeCCCHH
Q psy1304          39 RKQRKEDRI-GESQPFRGQTLSVQDKIRPGRGSNPRPSAYKADAPTSNLTRLGLLGARDCLYRENLIDIPIIIADLKNES  117 (184)
Q Consensus        39 ~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~La~~~~~~~~~iaLAGrr~~lg~~~~~~v~~v~vDv~D~~  117 (184)
                      .|.||--++ .++ +|-|+.                ++.+|++.     -.|.+++++.+.-.........+++|++|.+
T Consensus        12 ~~g~~mkilvlGa-G~vG~~----------------~~~~L~~~-----~~v~~~~~~~~~~~~~~~~~~~~~~d~~d~~   69 (365)
T 3abi_A           12 IEGRHMKVLILGA-GNIGRA----------------IAWDLKDE-----FDVYIGDVNNENLEKVKEFATPLKVDASNFD   69 (365)
T ss_dssp             ----CCEEEEECC-SHHHHH----------------HHHHHTTT-----SEEEEEESCHHHHHHHTTTSEEEECCTTCHH
T ss_pred             ccCCccEEEEECC-CHHHHH----------------HHHHHhcC-----CCeEEEEcCHHHHHHHhccCCcEEEecCCHH
Confidence            445554443 666 888887                77888753     3467788765433323356778899999999


Q ss_pred             HHHHHhhcCcEEEeccccccccchHHHHHHHHcCCCEeeCCCChHHHHHHHHHhHHHHHHcCCeeeC
Q psy1304         118 SILIMAKKCRVILNCVGPYTWYGEAVVKACIEAKTHHVDITGEPYFMEYMQYEYNTRAQESEVQKCT  184 (184)
Q Consensus       118 sL~a~l~~~dVVIN~aGPf~~~g~~VaeACieAGthYVDltGE~~~~~~ii~~lhe~AkaaGV~Ivt  184 (184)
                      +|.++++++|+||||+|||+  +.+++++|+++|+||||+|++.++.    +++|++|+++|++++.
T Consensus        70 ~l~~~~~~~DvVi~~~p~~~--~~~v~~~~~~~g~~yvD~s~~~~~~----~~l~~~a~~~g~~~i~  130 (365)
T 3abi_A           70 KLVEVMKEFELVIGALPGFL--GFKSIKAAIKSKVDMVDVSFMPENP----LELRDEAEKAQVTIVF  130 (365)
T ss_dssp             HHHHHHTTCSEEEECCCGGG--HHHHHHHHHHHTCEEEECCCCSSCG----GGGHHHHHHTTCEEEC
T ss_pred             HHHHHHhCCCEEEEecCCcc--cchHHHHHHhcCcceEeeeccchhh----hhhhhhhccCCceeee
Confidence            99999999999999999984  5799999999999999999988753    4689999999999874



>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1vjp_A MYO-inositol-1-phosphate synthase-related protein; TM1419, structural genomics, JCSG, PSI, protein structure initiative; HET: NAD; 1.70A {Thermotoga maritima} PDB: 3cin_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.91
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.4
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 97.33
d2q46a1 252 Hypothetical protein At5g02240 (T7H20_290) {Thale 97.24
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 96.82
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 96.81
d1uzma1 237 beta-keto acyl carrier protein reductase {Mycobact 96.45
d2ew8a1 247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 96.2
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 96.17
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 96.1
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 96.06
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 96.02
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 96.0
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 95.97
d1cyda_ 242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 95.97
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 95.94
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 95.87
d1yo6a1 250 Putative carbonyl reductase sniffer {Caenorhabditi 95.86
d1nffa_ 244 Putative oxidoreductase Rv2002 {Mycobacterium tube 95.8
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 95.78
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 95.59
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 95.58
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 95.56
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 95.48
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 95.46
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 95.45
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 95.45
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 95.41
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 95.36
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 95.22
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 95.18
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 95.17
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 95.13
d2a4ka1 241 beta-keto acyl carrier protein reductase {Thermus 95.09
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 95.07
d1ulua_ 256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 95.06
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 94.94
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 94.94
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 94.84
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 94.83
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 94.82
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 94.81
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 94.79
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 94.76
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 94.69
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 94.66
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 94.53
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 94.5
d1snya_ 248 Carbonyl reductase sniffer {Fruit fly (Drosophila 94.47
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 94.44
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 94.25
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 93.91
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 93.67
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 93.67
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 93.49
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 93.25
d1oaaa_ 259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 93.17
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 93.07
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 92.82
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 92.69
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 92.44
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 92.03
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 91.89
d1edoa_ 244 beta-keto acyl carrier protein reductase {Oil seed 91.82
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 91.78
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 91.24
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 91.17
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 90.94
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 90.77
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 90.72
d2fr1a1 259 Erythromycin synthase, eryAI, 1st ketoreductase mo 90.58
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 90.36
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 90.29
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 90.03
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 89.48
d1r6da_ 322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 89.38
d1sbya1 254 Drosophila alcohol dehydrogenase {Fly (Drosophila 89.18
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 89.06
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 89.03
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 88.99
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 88.68
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 88.17
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 88.06
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 88.0
d1o5ia_ 234 beta-keto acyl carrier protein reductase {Thermoto 87.33
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 87.33
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 87.24
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 86.91
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 85.37
d1vjpa1275 Hypothetical protein TM1419 {Thermotoga maritima [ 84.98
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 84.48
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 83.95
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 81.53
d1u1ia1287 Myo-inositol 1-phosphate synthase {Archaeoglobus f 81.02
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 80.56
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 80.07
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Biliverdin IX beta reductase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.91  E-value=1.9e-05  Score=60.34  Aligned_cols=92  Identities=13%  Similarity=0.053  Sum_probs=68.3

Q ss_pred             ccccCccccceeeecccccCCCCCCCchhhhhhhCCCCCceeEEeeeeccccccc-CCCCCCEEEEeCCCHHHHHHHhhc
Q psy1304          47 IGESQPFRGQTLSVQDKIRPGRGSNPRPSAYKADAPTSNLTRLGLLGARDCLYRE-NLIDIPIIIADLKNESSILIMAKK  125 (184)
Q Consensus        47 ~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~La~~~~~~~~~iaLAGrr~~lg~~-~~~~v~~v~vDv~D~~sL~a~l~~  125 (184)
                      |.+.++|-|.-                ++..|.+..    -++.+..|+..+... ...+++++.+|+.|++++.+++++
T Consensus         8 V~GatG~iG~~----------------v~~~Ll~~g----~~V~~~~R~~~~~~~~~~~~~~~~~gD~~d~~~l~~al~~   67 (205)
T d1hdoa_           8 IFGATGQTGLT----------------TLAQAVQAG----YEVTVLVRDSSRLPSEGPRPAHVVVGDVLQAADVDKTVAG   67 (205)
T ss_dssp             EESTTSHHHHH----------------HHHHHHHTT----CEEEEEESCGGGSCSSSCCCSEEEESCTTSHHHHHHHHTT
T ss_pred             EECCCCHHHHH----------------HHHHHHHCc----CEEEEEEcChhhcccccccccccccccccchhhHHHHhcC
Confidence            46667777776                667777653    456666676554332 226789999999999999999999


Q ss_pred             CcEEEecccccccc---------chHHHHHHHHcCCC-EeeCC
Q psy1304         126 CRVILNCVGPYTWY---------GEAVVKACIEAKTH-HVDIT  158 (184)
Q Consensus       126 ~dVVIN~aGPf~~~---------g~~VaeACieAGth-YVDlt  158 (184)
                      +|+||+|+|+....         -.+++++|.++|+. ++-++
T Consensus        68 ~d~vi~~~g~~~~~~~~~~~~~~~~~l~~aa~~~~v~r~i~~s  110 (205)
T d1hdoa_          68 QDAVIVLLGTRNDLSPTTVMSEGARNIVAAMKAHGVDKVVACT  110 (205)
T ss_dssp             CSEEEECCCCTTCCSCCCHHHHHHHHHHHHHHHHTCCEEEEEC
T ss_pred             CCEEEEEeccCCchhhhhhhHHHHHHHHHHHHhcCCCeEEEEe
Confidence            99999999975332         15799999999986 66654



>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vjpa1 c.2.1.3 (A:0-209,A:317-381) Hypothetical protein TM1419 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1u1ia1 c.2.1.3 (A:1-227,A:333-392) Myo-inositol 1-phosphate synthase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure