Psyllid ID: psy13120
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 384 | ||||||
| 170032325 | 644 | conserved hypothetical protein [Culex qu | 0.963 | 0.574 | 0.594 | 1e-128 | |
| 242014336 | 5078 | protocadherin-16 precursor, putative [Pe | 0.960 | 0.072 | 0.587 | 1e-126 | |
| 270006423 | 3284 | cadherin-like protein [Tribolium castane | 0.966 | 0.112 | 0.583 | 1e-125 | |
| 189236209 | 4974 | PREDICTED: similar to AGAP007924-PA [Tri | 0.966 | 0.074 | 0.583 | 1e-125 | |
| 321458298 | 5030 | hypothetical protein DAPPUDRAFT_329129 [ | 0.945 | 0.072 | 0.588 | 1e-122 | |
| 357614377 | 3180 | cadherin-like protein [Danaus plexippus] | 0.955 | 0.115 | 0.576 | 1e-120 | |
| 158297299 | 5159 | AGAP007924-PA [Anopheles gambiae str. PE | 0.963 | 0.071 | 0.532 | 1e-120 | |
| 340708971 | 5085 | PREDICTED: cadherin-related tumor suppre | 0.963 | 0.072 | 0.572 | 1e-118 | |
| 350418958 | 4964 | PREDICTED: LOW QUALITY PROTEIN: cadherin | 0.963 | 0.074 | 0.570 | 1e-117 | |
| 312374399 | 3475 | hypothetical protein AND_15952 [Anophele | 0.963 | 0.106 | 0.505 | 1e-117 |
| >gi|170032325|ref|XP_001844032.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167872318|gb|EDS35701.1| conserved hypothetical protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
Score = 462 bits (1190), Expect = e-128, Method: Compositional matrix adjust.
Identities = 229/385 (59%), Positives = 298/385 (77%), Gaps = 15/385 (3%)
Query: 2 NGRLEYSIVSGDDEEIFTINPSNGTLSNLKHLDRETKSSYNLVVMATDMAKPPQKRLSST 61
NGR+EYSI SGDD E F I SNGT+ + LDRE+KSSY+L+V A D AK P+K+LSST
Sbjct: 256 NGRIEYSITSGDDNEDFQI-LSNGTIRTRRALDRESKSSYSLIVSARDCAKEPEKQLSST 314
Query: 62 TQVSIVIRDVNDNAPEFITANETTIPENSPLNTVVAALKAIDRDEGQNSYVEYSIINSEA 121
QV+IV++DVND APEF+T NET++ EN P+NTV+ A+KA+DRDEG+N YVEY + +
Sbjct: 315 VQVTIVLKDVNDLAPEFVTPNETSVAENIPINTVIMAIKAVDRDEGRNGYVEYQLDPAVQ 374
Query: 122 TPFSLGPVDGLLRVAQKLDREIKSNYTLEIKAKDRGEPSKSSRTKFFIRLLDENDNNPIF 181
TPF++G DGLLRV+ +LDRE KS+Y L + AKDRGEP KSS++K I +LDENDN+PIF
Sbjct: 375 TPFTVGSADGLLRVSGRLDRETKSSYELTVTAKDRGEPPKSSQSKIRIHVLDENDNSPIF 434
Query: 182 DSKSYSASVPENISVGATVLQVSATDLDDGINGRVRYTIISGDDNHDLTISEDNGLLRIA 241
D K YSA++ EN S+GA+VLQVSATD+D+G NGRVR++I +GDDN D TISED+G++R+A
Sbjct: 435 DPKQYSAAIAENASIGASVLQVSATDIDEGANGRVRFSIAAGDDNRDFTISEDSGVVRVA 494
Query: 242 KNLNYERKAQYSLTIQAEDCGGDTE--ERIRFDTATVSILVSDINDNYPVFLHSPYLALV 299
KNLNYERK+ Y++T++AED DTE +RFDTA +SI ++DINDN P FL SPYLA V
Sbjct: 495 KNLNYERKSHYTVTVRAEDSASDTENGSEVRFDTARLSITITDINDNPPTFLDSPYLAYV 554
Query: 300 NENTLPGPSFRIMTVQAHDADSLPFNGLVRYFLKDSGASSGNSQTQGGTGDLFRVNSTTG 359
EN +P ++TV+A+DAD+ PFN VRYFLK+ G D F++N++TG
Sbjct: 555 MENVIPPNGGYVITVRAYDADTPPFNSQVRYFLKE------------GDTDFFKINASTG 602
Query: 360 DIYLLKSLDREKQAEYLLTLQAMDS 384
+I LL++LDRE QAEY+LTL AMD+
Sbjct: 603 EISLLRALDREMQAEYILTLVAMDT 627
|
Source: Culex quinquefasciatus Species: Culex quinquefasciatus Genus: Culex Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242014336|ref|XP_002427847.1| protocadherin-16 precursor, putative [Pediculus humanus corporis] gi|212512316|gb|EEB15109.1| protocadherin-16 precursor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|270006423|gb|EFA02871.1| cadherin-like protein [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|189236209|ref|XP_971084.2| PREDICTED: similar to AGAP007924-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|321458298|gb|EFX69368.1| hypothetical protein DAPPUDRAFT_329129 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|357614377|gb|EHJ69044.1| cadherin-like protein [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|158297299|ref|XP_317558.4| AGAP007924-PA [Anopheles gambiae str. PEST] gi|157015128|gb|EAA12848.4| AGAP007924-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|340708971|ref|XP_003393090.1| PREDICTED: cadherin-related tumor suppressor-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350418958|ref|XP_003492024.1| PREDICTED: LOW QUALITY PROTEIN: cadherin-related tumor suppressor-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|312374399|gb|EFR21960.1| hypothetical protein AND_15952 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 384 | ||||||
| FB|FBgn0001075 | 5147 | ft "fat" [Drosophila melanogas | 0.833 | 0.062 | 0.553 | 1.4e-99 | |
| UNIPROTKB|Q6V0I7 | 4981 | FAT4 "Protocadherin Fat 4" [Ho | 0.838 | 0.064 | 0.462 | 4e-68 | |
| MGI|MGI:3045256 | 4981 | Fat4 "FAT tumor suppressor hom | 0.838 | 0.064 | 0.441 | 6.6e-68 | |
| UNIPROTKB|E1B949 | 4983 | FAT4 "Uncharacterized protein" | 0.838 | 0.064 | 0.444 | 8.4e-68 | |
| UNIPROTKB|E2RR85 | 4982 | FAT4 "Uncharacterized protein" | 0.838 | 0.064 | 0.447 | 1.2e-66 | |
| RGD|1564291 | 4981 | Fat4 "FAT tumor suppressor hom | 0.843 | 0.065 | 0.435 | 8.5e-66 | |
| UNIPROTKB|F1NLP0 | 4964 | FAT4 "Uncharacterized protein" | 0.843 | 0.065 | 0.447 | 4.6e-65 | |
| UNIPROTKB|F1NWW5 | 4592 | FAT1 "Uncharacterized protein" | 0.934 | 0.078 | 0.357 | 8e-52 | |
| UNIPROTKB|E1BKL9 | 4587 | FAT1 "Uncharacterized protein" | 0.833 | 0.069 | 0.388 | 1.5e-50 | |
| UNIPROTKB|F1SER9 | 4587 | FAT1 "Uncharacterized protein" | 0.833 | 0.069 | 0.382 | 3.1e-50 |
| FB|FBgn0001075 ft "fat" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 931 (332.8 bits), Expect = 1.4e-99, Sum P(2) = 1.4e-99
Identities = 190/343 (55%), Positives = 246/343 (71%)
Query: 50 MAKPPQKRLSSTTQVSIVIRDVNDNAPEFITANETTIPENSPLNTVVAALKAIDRDEGQN 109
+A Q+RLSST +V+I+I+DVND P FI+ANET I EN +NTVV A+KA+D DEG+N
Sbjct: 2139 LAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIMENVAINTVVIAVKAVDNDEGRN 2198
Query: 110 SYVEY--------SIINSEATPFSLGPVDGLLRVAQKLDREIKSNYTLEIKAKDRGEPSK 161
Y++Y + S+ PFSL P DG LRV LDRE++S+Y L I A+DRGEP +
Sbjct: 2199 GYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQ 2258
Query: 162 SSRTKFFIRLLDENDNNPIFDSKSYSASVPENISVGATVLQVSATDLDDGINGRVRYTII 221
S+ ++ IR+LDENDN+P+FD K YSASV EN S+GA VLQVSATD+D+G NGR+RY+I+
Sbjct: 2259 STESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIV 2318
Query: 222 SGDDNHDLTISEDNGLLRIAKNLNYERKAQYSLTIQAEDCGGDTEERIRFDTATVSILVS 281
GD NHD +ISED G++R+AKNLNYER ++YSLT++AEDC E DTA ++I +
Sbjct: 2319 LGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCA---LENPAGDTAELTINIL 2375
Query: 282 DINDNYPVFLHSPYLALVNENTLPGPSFRIMTVQAHDADSLPFNGLVRYFLKDXXXXXXX 341
DINDN P FL SPYLA V ENT+P ++TV A+DAD+ P N VRYFLK+
Sbjct: 2376 DINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDS---- 2431
Query: 342 XXXXXXXXDLFRVNSTTGDIYLLKSLDREKQAEYLLTLQAMDS 384
DLFR+N+++GDI LLK LDRE+Q+EY LTL AMD+
Sbjct: 2432 --------DLFRINASSGDIALLKPLDREQQSEYTLTLVAMDT 2466
|
|
| UNIPROTKB|Q6V0I7 FAT4 "Protocadherin Fat 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:3045256 Fat4 "FAT tumor suppressor homolog 4 (Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1B949 FAT4 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RR85 FAT4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1564291 Fat4 "FAT tumor suppressor homolog 4 (Drosophila)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NLP0 FAT4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NWW5 FAT1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BKL9 FAT1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SER9 FAT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 384 | |||
| cd11304 | 98 | cd11304, Cadherin_repeat, Cadherin tandem repeat d | 8e-31 | |
| cd11304 | 98 | cd11304, Cadherin_repeat, Cadherin tandem repeat d | 4e-28 | |
| smart00112 | 81 | smart00112, CA, Cadherin repeats | 5e-23 | |
| pfam00028 | 92 | pfam00028, Cadherin, Cadherin domain | 1e-22 | |
| cd11304 | 98 | cd11304, Cadherin_repeat, Cadherin tandem repeat d | 3e-22 | |
| smart00112 | 81 | smart00112, CA, Cadherin repeats | 4e-21 | |
| smart00112 | 81 | smart00112, CA, Cadherin repeats | 7e-21 | |
| pfam00028 | 92 | pfam00028, Cadherin, Cadherin domain | 5e-20 | |
| cd11304 | 98 | cd11304, Cadherin_repeat, Cadherin tandem repeat d | 6e-17 | |
| pfam00028 | 92 | pfam00028, Cadherin, Cadherin domain | 1e-16 | |
| pfam00028 | 92 | pfam00028, Cadherin, Cadherin domain | 2e-14 | |
| smart00112 | 81 | smart00112, CA, Cadherin repeats | 8e-11 |
| >gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain | Back alignment and domain information |
|---|
Score = 112 bits (283), Expect = 8e-31
Identities = 47/102 (46%), Positives = 61/102 (59%), Gaps = 4/102 (3%)
Query: 185 SYSASVPENISVGATVLQVSATDLDDGINGRVRYTIISGDDNHDLTISEDNGLLRIAKNL 244
SY SVPEN G VL VSATD D G NG V Y+I+SG+++ +I G + AK L
Sbjct: 1 SYEVSVPENAPPGTVVLTVSATDPDSGENGEVTYSIVSGNEDGLFSIDPSTGEITTAKPL 60
Query: 245 NYERKAQYSLTIQAEDCGGDTEERIRFDTATVSILVSDINDN 286
+ E ++ Y+LT+ A D GG TATV+I V D+NDN
Sbjct: 61 DREEQSSYTLTVTATDGGGPP----LSSTATVTITVLDVNDN 98
|
Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers. Length = 98 |
| >gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain | Back alignment and domain information |
|---|
| >gnl|CDD|214520 smart00112, CA, Cadherin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain | Back alignment and domain information |
|---|
| >gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain | Back alignment and domain information |
|---|
| >gnl|CDD|214520 smart00112, CA, Cadherin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|214520 smart00112, CA, Cadherin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain | Back alignment and domain information |
|---|
| >gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain | Back alignment and domain information |
|---|
| >gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain | Back alignment and domain information |
|---|
| >gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain | Back alignment and domain information |
|---|
| >gnl|CDD|214520 smart00112, CA, Cadherin repeats | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 384 | |||
| KOG4289|consensus | 2531 | 100.0 | ||
| KOG4289|consensus | 2531 | 100.0 | ||
| KOG1219|consensus | 4289 | 100.0 | ||
| KOG1219|consensus | 4289 | 100.0 | ||
| cd00031 | 199 | CA Cadherin repeat domain; Cadherins are glycoprot | 100.0 | |
| cd00031 | 199 | CA Cadherin repeat domain; Cadherins are glycoprot | 99.97 | |
| KOG1834|consensus | 952 | 99.74 | ||
| PF00028 | 93 | Cadherin: Cadherin domain; InterPro: IPR002126 Cad | 99.73 | |
| PF00028 | 93 | Cadherin: Cadherin domain; InterPro: IPR002126 Cad | 99.72 | |
| KOG1834|consensus | 952 | 99.71 | ||
| smart00112 | 79 | CA Cadherin repeats. Cadherins are glycoproteins i | 99.63 | |
| smart00112 | 79 | CA Cadherin repeats. Cadherins are glycoproteins i | 99.62 | |
| TIGR01965 | 99 | VCBS_repeat VCBS repeat. This domain of about 100 | 97.22 | |
| PF08266 | 84 | Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad | 97.11 | |
| smart00736 | 97 | CADG Dystroglycan-type cadherin-like domains. Cadh | 97.1 | |
| PF08758 | 90 | Cadherin_pro: Cadherin prodomain like; InterPro: I | 97.02 | |
| smart00736 | 97 | CADG Dystroglycan-type cadherin-like domains. Cadh | 96.98 | |
| PF08758 | 90 | Cadherin_pro: Cadherin prodomain like; InterPro: I | 96.88 | |
| PF08266 | 84 | Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad | 96.82 | |
| TIGR01965 | 99 | VCBS_repeat VCBS repeat. This domain of about 100 | 96.53 | |
| PF13750 | 158 | Big_3_3: Bacterial Ig-like domain (group 3) | 96.47 | |
| PF13750 | 158 | Big_3_3: Bacterial Ig-like domain (group 3) | 96.4 | |
| PF05345 | 49 | He_PIG: Putative Ig domain; InterPro: IPR008009 Th | 94.71 | |
| KOG3597|consensus | 442 | 93.64 | ||
| PF05345 | 49 | He_PIG: Putative Ig domain; InterPro: IPR008009 Th | 93.44 | |
| KOG3597|consensus | 442 | 92.85 | ||
| TIGR00845 | 928 | caca sodium/calcium exchanger 1. This model is spe | 92.4 | |
| TIGR00845 | 928 | caca sodium/calcium exchanger 1. This model is spe | 90.89 | |
| PF07495 | 66 | Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi | 88.96 | |
| TIGR00864 | 2740 | PCC polycystin cation channel protein. Note: this | 84.55 | |
| TIGR03660 | 137 | T1SS_rpt_143 T1SS-143 repeat domain. This model re | 84.31 | |
| TIGR00864 | 2740 | PCC polycystin cation channel protein. Note: this | 83.8 | |
| TIGR03660 | 137 | T1SS_rpt_143 T1SS-143 repeat domain. This model re | 82.07 |
| >KOG4289|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-61 Score=473.06 Aligned_cols=357 Identities=36% Similarity=0.554 Sum_probs=338.5
Q ss_pred CccEEEEEEeC---CCCCcEEEeCCCcEEEECccCCcCCCcEEEEEEEEEeCCCCCCCCceeEEEEEEEEEeecCCCCEE
Q psy13120 2 NGRLEYSIVSG---DDEEIFTINPSNGTLSNLKHLDRETKSSYNLVVMATDMAKPPQKRLSSTTQVSIVIRDVNDNAPEF 78 (384)
Q Consensus 2 ~~~i~Y~i~~~---~~~~~F~id~~tG~i~~~~~lD~E~~~~~~l~v~a~d~~~~~~~~~s~~~~v~I~V~dvNd~~P~f 78 (384)
-+++.|++..- -..++|+||+.+|.|++++.||||....+.|+|+|.|.+.|. .|++++|+|.|.|+|||.|+|
T Consensus 193 a~rl~Ysm~al~dsRS~~lFslD~~sG~irta~~lDREt~e~HvlrVtA~d~~~P~---~SAtttv~V~V~D~nDhsPvF 269 (2531)
T KOG4289|consen 193 AGRLYYSMVALFDSRSQNLFSLDPMSGAIRTAKSLDRETKETHVLRVTAQDHGDPR---RSATTTVTVLVLDTNDHSPVF 269 (2531)
T ss_pred cCceEEEeeeccchhccccEeeccccccchhhhhhhhhhhheeEEEEEeeecCCCc---ccceeEEEEEEeecCCCCccc
Confidence 36789999642 234689999999999999999999999999999999999875 699999999999999999999
Q ss_pred ccC-ceeEeeCCCCCCcEEEEEEEEeCCCCCCceEEEEEEcC-CCCCeeeeCcceEEEEceeCCccCCCeEEEEEEEEeC
Q psy13120 79 ITA-NETTIPENSPLNTVVAALKAIDRDEGQNSYVEYSIINS-EATPFSLGPVDGLLRVAQKLDREIKSNYTLEIKAKDR 156 (384)
Q Consensus 79 ~~~-~~~~v~E~~~~gt~v~~~~a~D~D~~~~~~~~y~l~~~-~~~~F~i~~~~G~i~~~~~ld~e~~~~~~l~V~a~d~ 156 (384)
.+. |...+.||.+.|..|.++.|+|.|.++|+.+.|++.++ ....|.|++.+|.|++..+||||+...|.|.|.|+|.
T Consensus 270 Eq~~Y~e~lREn~evGy~vLtvrAtD~Dsp~Nani~Yrl~eg~~~~~f~in~rSGvI~T~a~lDRE~~~~y~L~VeAsDq 349 (2531)
T KOG4289|consen 270 EQDEYREELRENLEVGYEVLTVRATDGDSPPNANIRYRLLEGNAKNVFEINPRSGVISTRAPLDREELESYQLDVEASDQ 349 (2531)
T ss_pred chhHHHHHHhhccccCceEEEEEeccCCCCCCCceEEEecCCCccceeEEcCccceeeccCccCHHhhhheEEEEEeccC
Confidence 998 99999999999999999999999999999999999999 5678999999999999999999999999999999999
Q ss_pred CCCCCceeEEEEEEeccCCCCCCceeccceEEEEecCCCCCcEEEEEEEEeCCCCCCceEEEEEEeCCCCCCeEEECCCc
Q psy13120 157 GEPSKSSRTKFFIRLLDENDNNPIFDSKSYSASVPENISVGATVLQVSATDLDDGINGRVRYTIISGDDNHDLTISEDNG 236 (384)
Q Consensus 157 ~~~~~~~~~~v~I~V~dvnd~~P~f~~~~~~~~v~E~~~~g~~v~~v~a~D~D~~~~~~i~y~i~~~~~~~~f~i~~~~G 236 (384)
|.++...++.|.|+|.|+|||+|+|....|.++|.|+..+++.|.+|.|+|.|.+.|+.+.|+|.+|+..+.|.||..+|
T Consensus 350 G~~pgp~Ta~V~itV~D~NDNaPqFse~~Yvvqv~Edvt~~avvlrV~AtDrD~g~Ng~VHYsi~Sgn~~G~f~id~~tG 429 (2531)
T KOG4289|consen 350 GRPPGPRTAMVEITVEDENDNAPQFSEKRYVVQVREDVTPPAVVLRVTATDRDKGTNGKVHYSIASGNGRGQFYIDSLTG 429 (2531)
T ss_pred CCCCCCceEEEEEEEEecCCCCccccccceEEEecccCCCCceEEEEEecccCCCcCceEEEEeeccCccccEEEecccc
Confidence 99888889999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEEcccCCccccCeEEEEEEEEECCCCCcceeeeeEEEEEEEEeecCCCCCcccCCCeeEEEcCCCCCCCceEEEEEEE
Q psy13120 237 LLRIAKNLNYERKAQYSLTIQAEDCGGDTEERIRFDTATVSILVSDINDNYPVFLHSPYLALVNENTLPGPSFRIMTVQA 316 (384)
Q Consensus 237 ~l~~~~~lD~e~~~~~~l~V~a~D~~~~~~~~~~~~~~~v~i~V~dvNd~~P~f~~~~~~~~v~e~~~~~~g~~i~~v~a 316 (384)
+|.+..+||+|.. .|++.|+|.|++.|++ +.+.-+.|+|.|+|||+|.|...++.++|.|+. +.|..+..+.|
T Consensus 430 el~vv~plD~e~~-~ytl~IrAqDggrPpL----sn~sgl~iqVlDINDhaPifvstpfq~tvlEnv--~lg~~v~~vqa 502 (2531)
T KOG4289|consen 430 ELDVVEPLDFENS-EYTLRIRAQDGGRPPL----SNTSGLVIQVLDINDHAPIFVSTPFQATVLENV--PLGYLVCHVQA 502 (2531)
T ss_pred eEEEeccccccCC-eeEEEEEcccCCCCCc----cCCCceEEEEEecCCCCceeEechhhhhhhhcc--cccceEEEEec
Confidence 9999999999998 9999999999999987 677778899999999999999999999999999 55899999999
Q ss_pred ecCCCCCCCceEEEEEecCCCCCCCCcCCCCCCCceEEeCCcceEEEcccCCcccccEEEEEEEEEc
Q psy13120 317 HDADSLPFNGLVRYFLKDSGASSGNSQTQGGTGDLFRVNSTTGDIYLLKSLDREKQAEYLLTLQAMD 383 (384)
Q Consensus 317 ~D~D~~~~~~~i~y~l~~~~~~~~~~~~~~~~~~~f~Id~~tG~i~~~~~ld~e~~~~~~l~V~a~D 383 (384)
.|+|.+. |+.+.|++.+ .+.|.|+..+|+|++++.||||+...|.|.|+|+|
T Consensus 503 idadsg~-na~l~y~laG--------------~~pf~I~~~SG~Itvtk~ldrEt~~~ysl~V~ard 554 (2531)
T KOG4289|consen 503 IDADSGE-NARLHYSLAG--------------VGPFQINNGSGWITVTKELDRETVEHYSLGVEARD 554 (2531)
T ss_pred ccCCCCc-ccceeeeecc--------------CCCeeEecCCceEEEeecccccccceEEEEEEEcC
Confidence 9999999 9999999976 34899999999999999999999999999999998
|
|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here | Back alignment and domain information |
|---|
| >cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here | Back alignment and domain information |
|---|
| >KOG1834|consensus | Back alignment and domain information |
|---|
| >PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] | Back alignment and domain information |
|---|
| >PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] | Back alignment and domain information |
|---|
| >KOG1834|consensus | Back alignment and domain information |
|---|
| >smart00112 CA Cadherin repeats | Back alignment and domain information |
|---|
| >smart00112 CA Cadherin repeats | Back alignment and domain information |
|---|
| >TIGR01965 VCBS_repeat VCBS repeat | Back alignment and domain information |
|---|
| >PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] | Back alignment and domain information |
|---|
| >smart00736 CADG Dystroglycan-type cadherin-like domains | Back alignment and domain information |
|---|
| >PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion | Back alignment and domain information |
|---|
| >smart00736 CADG Dystroglycan-type cadherin-like domains | Back alignment and domain information |
|---|
| >PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion | Back alignment and domain information |
|---|
| >PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] | Back alignment and domain information |
|---|
| >TIGR01965 VCBS_repeat VCBS repeat | Back alignment and domain information |
|---|
| >PF13750 Big_3_3: Bacterial Ig-like domain (group 3) | Back alignment and domain information |
|---|
| >PF13750 Big_3_3: Bacterial Ig-like domain (group 3) | Back alignment and domain information |
|---|
| >PF05345 He_PIG: Putative Ig domain; InterPro: IPR008009 This alignment represents the conserved core region of a ~90 residue repeat found in several haemagglutinins and other cell surface proteins | Back alignment and domain information |
|---|
| >KOG3597|consensus | Back alignment and domain information |
|---|
| >PF05345 He_PIG: Putative Ig domain; InterPro: IPR008009 This alignment represents the conserved core region of a ~90 residue repeat found in several haemagglutinins and other cell surface proteins | Back alignment and domain information |
|---|
| >KOG3597|consensus | Back alignment and domain information |
|---|
| >TIGR00845 caca sodium/calcium exchanger 1 | Back alignment and domain information |
|---|
| >TIGR00845 caca sodium/calcium exchanger 1 | Back alignment and domain information |
|---|
| >PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators | Back alignment and domain information |
|---|
| >TIGR00864 PCC polycystin cation channel protein | Back alignment and domain information |
|---|
| >TIGR03660 T1SS_rpt_143 T1SS-143 repeat domain | Back alignment and domain information |
|---|
| >TIGR00864 PCC polycystin cation channel protein | Back alignment and domain information |
|---|
| >TIGR03660 T1SS_rpt_143 T1SS-143 repeat domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 384 | ||||
| 2a62_A | 322 | Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length | 1e-32 | ||
| 2a62_A | 322 | Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length | 1e-17 | ||
| 2a62_A | 322 | Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length | 1e-10 | ||
| 3q2w_A | 559 | Crystal Structure Of Mouse N-Cadherin Ectodomain Le | 2e-23 | ||
| 3q2w_A | 559 | Crystal Structure Of Mouse N-Cadherin Ectodomain Le | 7e-12 | ||
| 3q2v_A | 550 | Crystal Structure Of Mouse E-Cadherin Ectodomain Le | 5e-20 | ||
| 1q55_A | 880 | W-Shaped Trans Interactions Of Cadherins Model Base | 2e-18 | ||
| 1q55_A | 880 | W-Shaped Trans Interactions Of Cadherins Model Base | 1e-16 | ||
| 1q55_A | 880 | W-Shaped Trans Interactions Of Cadherins Model Base | 1e-07 | ||
| 1l3w_A | 546 | C-Cadherin Ectodomain Length = 546 | 2e-18 | ||
| 1l3w_A | 546 | C-Cadherin Ectodomain Length = 546 | 5e-17 | ||
| 1l3w_A | 546 | C-Cadherin Ectodomain Length = 546 | 6e-08 | ||
| 1edh_A | 226 | E-Cadherin Domains 1 And 2 In Complex With Calcium | 1e-17 | ||
| 1edh_A | 226 | E-Cadherin Domains 1 And 2 In Complex With Calcium | 4e-09 | ||
| 3lnd_A | 207 | Crystal Structure Of Cadherin-6 Ec12 W4a Length = 2 | 1e-17 | ||
| 3lnd_A | 207 | Crystal Structure Of Cadherin-6 Ec12 W4a Length = 2 | 5e-06 | ||
| 3mvs_A | 210 | Structure Of The N-Terminus Of Cadherin 23 Length = | 3e-17 | ||
| 3mvs_A | 210 | Structure Of The N-Terminus Of Cadherin 23 Length = | 4e-09 | ||
| 3ubh_A | 419 | Crystal Structure Of Drosophila N-Cadherin Ec1-4 Le | 4e-17 | ||
| 4aqe_A | 214 | Crystal Structure Of Deafness Associated Mutant Mou | 9e-17 | ||
| 4aqe_A | 214 | Crystal Structure Of Deafness Associated Mutant Mou | 3e-09 | ||
| 1ncj_A | 215 | N-Cadherin, Two-Domain Fragment Length = 215 | 1e-16 | ||
| 1ncj_A | 215 | N-Cadherin, Two-Domain Fragment Length = 215 | 4e-12 | ||
| 2wcp_A | 214 | Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length | 1e-16 | ||
| 2wcp_A | 214 | Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length | 4e-09 | ||
| 2qvi_A | 215 | Crystal Structure Of N-Cadherin Domains Ec12 Length | 1e-16 | ||
| 2qvi_A | 215 | Crystal Structure Of N-Cadherin Domains Ec12 Length | 5e-12 | ||
| 2a4e_A | 215 | Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length | 5e-16 | ||
| 2a4e_A | 215 | Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length | 3e-09 | ||
| 2wd0_A | 214 | Crystal Structure Of Nonsyndromic Deafness (Dfnb12) | 5e-16 | ||
| 2wd0_A | 214 | Crystal Structure Of Nonsyndromic Deafness (Dfnb12) | 2e-08 | ||
| 1ff5_A | 219 | Structure Of E-Cadherin Double Domain Length = 219 | 1e-15 | ||
| 1ff5_A | 219 | Structure Of E-Cadherin Double Domain Length = 219 | 4e-09 | ||
| 3ppe_A | 203 | Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Leng | 2e-14 | ||
| 3lni_A | 213 | Crystal Structure Of E-Cadherin Ec12 E89a Length = | 7e-14 | ||
| 3lni_A | 213 | Crystal Structure Of E-Cadherin Ec12 E89a Length = | 2e-08 | ||
| 3ubf_A | 316 | Crystal Structure Of Drosophila N-Cadherin Ec1-3, I | 9e-14 | ||
| 3q2l_A | 213 | Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 | 9e-14 | ||
| 3q2l_A | 213 | Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 | 2e-09 | ||
| 3lne_A | 213 | Crystal Structure Of E-Cadherin Ec12 K14e Length = | 1e-13 | ||
| 3lne_A | 213 | Crystal Structure Of E-Cadherin Ec12 K14e Length = | 5e-09 | ||
| 3lng_A | 215 | Crystal Structure Of E-Cadherin Ec12 Aa Extension L | 1e-13 | ||
| 3lng_A | 215 | Crystal Structure Of E-Cadherin Ec12 Aa Extension L | 4e-09 | ||
| 3lnf_A | 213 | Crystal Structure Of E-Cadherin Ec12 K14ew2a Length | 1e-13 | ||
| 3lnf_A | 213 | Crystal Structure Of E-Cadherin Ec12 K14ew2a Length | 4e-09 | ||
| 1q1p_A | 212 | E-Cadherin Activation Length = 212 | 1e-13 | ||
| 1q1p_A | 212 | E-Cadherin Activation Length = 212 | 5e-09 | ||
| 2qvf_B | 213 | Mouse E-cadherin Domains 1,2 Length = 213 | 1e-13 | ||
| 2qvf_B | 213 | Mouse E-cadherin Domains 1,2 Length = 213 | 5e-09 | ||
| 3lnh_A | 213 | Crystal Structure Of E-Cadherin Ec12 W2a Length = 2 | 1e-13 | ||
| 3lnh_A | 213 | Crystal Structure Of E-Cadherin Ec12 W2a Length = 2 | 4e-09 | ||
| 3qrb_A | 213 | Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Lengt | 1e-13 | ||
| 3qrb_A | 213 | Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Lengt | 4e-09 | ||
| 3q2n_A | 213 | Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 | 1e-13 | ||
| 3q2n_A | 213 | Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 | 4e-08 | ||
| 2o72_A | 213 | Crystal Structure Analysis Of Human E-Cadherin (1-2 | 2e-13 | ||
| 2o72_A | 213 | Crystal Structure Analysis Of Human E-Cadherin (1-2 | 2e-09 | ||
| 2yst_A | 119 | Solution Structure Of The Third Cadherin Domain Fro | 5e-11 | ||
| 3k5s_A | 217 | Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Len | 2e-10 | ||
| 3k5s_A | 217 | Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Len | 6e-06 | ||
| 2ee0_A | 114 | Solution Structures Of The Ca Domain Of Human Proto | 7e-10 | ||
| 2ee0_A | 114 | Solution Structures Of The Ca Domain Of Human Proto | 3e-04 | ||
| 3k5r_A | 218 | Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Lengt | 7e-09 | ||
| 4apx_B | 242 | Crystal Structure Of Mouse Cadherin-23 Ec1-2 And Pr | 1e-08 | ||
| 1suh_A | 146 | Amino-Terminal Domain Of Epithelial Cadherin In The | 3e-08 | ||
| 1suh_A | 146 | Amino-Terminal Domain Of Epithelial Cadherin In The | 4e-05 | ||
| 1zxk_A | 98 | Crystal Structure Of Cadherin8 Ec1 Domain Length = | 4e-05 | ||
| 1nch_A | 110 | Structural Basis Of Cell-Cell Adhesion By Cadherins | 3e-04 |
| >pdb|2A62|A Chain A, Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length = 322 | Back alignment and structure |
|
| >pdb|2A62|A Chain A, Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length = 322 | Back alignment and structure |
| >pdb|2A62|A Chain A, Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length = 322 | Back alignment and structure |
| >pdb|3Q2W|A Chain A, Crystal Structure Of Mouse N-Cadherin Ectodomain Length = 559 | Back alignment and structure |
| >pdb|3Q2W|A Chain A, Crystal Structure Of Mouse N-Cadherin Ectodomain Length = 559 | Back alignment and structure |
| >pdb|3Q2V|A Chain A, Crystal Structure Of Mouse E-Cadherin Ectodomain Length = 550 | Back alignment and structure |
| >pdb|1Q55|A Chain A, W-Shaped Trans Interactions Of Cadherins Model Based On Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes Obtained By Electron Tomography Length = 880 | Back alignment and structure |
| >pdb|1Q55|A Chain A, W-Shaped Trans Interactions Of Cadherins Model Based On Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes Obtained By Electron Tomography Length = 880 | Back alignment and structure |
| >pdb|1Q55|A Chain A, W-Shaped Trans Interactions Of Cadherins Model Based On Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes Obtained By Electron Tomography Length = 880 | Back alignment and structure |
| >pdb|1L3W|A Chain A, C-Cadherin Ectodomain Length = 546 | Back alignment and structure |
| >pdb|1L3W|A Chain A, C-Cadherin Ectodomain Length = 546 | Back alignment and structure |
| >pdb|1L3W|A Chain A, C-Cadherin Ectodomain Length = 546 | Back alignment and structure |
| >pdb|1EDH|A Chain A, E-Cadherin Domains 1 And 2 In Complex With Calcium Length = 226 | Back alignment and structure |
| >pdb|1EDH|A Chain A, E-Cadherin Domains 1 And 2 In Complex With Calcium Length = 226 | Back alignment and structure |
| >pdb|3LND|A Chain A, Crystal Structure Of Cadherin-6 Ec12 W4a Length = 207 | Back alignment and structure |
| >pdb|3LND|A Chain A, Crystal Structure Of Cadherin-6 Ec12 W4a Length = 207 | Back alignment and structure |
| >pdb|3MVS|A Chain A, Structure Of The N-Terminus Of Cadherin 23 Length = 210 | Back alignment and structure |
| >pdb|3MVS|A Chain A, Structure Of The N-Terminus Of Cadherin 23 Length = 210 | Back alignment and structure |
| >pdb|3UBH|A Chain A, Crystal Structure Of Drosophila N-Cadherin Ec1-4 Length = 419 | Back alignment and structure |
| >pdb|4AQE|A Chain A, Crystal Structure Of Deafness Associated Mutant Mouse Cadherin-23 Ec1-2s70p And Protocadherin-15 Ec1-2 Form I Length = 214 | Back alignment and structure |
| >pdb|4AQE|A Chain A, Crystal Structure Of Deafness Associated Mutant Mouse Cadherin-23 Ec1-2s70p And Protocadherin-15 Ec1-2 Form I Length = 214 | Back alignment and structure |
| >pdb|1NCJ|A Chain A, N-Cadherin, Two-Domain Fragment Length = 215 | Back alignment and structure |
| >pdb|1NCJ|A Chain A, N-Cadherin, Two-Domain Fragment Length = 215 | Back alignment and structure |
| >pdb|2WCP|A Chain A, Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length = 214 | Back alignment and structure |
| >pdb|2WCP|A Chain A, Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length = 214 | Back alignment and structure |
| >pdb|2QVI|A Chain A, Crystal Structure Of N-Cadherin Domains Ec12 Length = 215 | Back alignment and structure |
| >pdb|2QVI|A Chain A, Crystal Structure Of N-Cadherin Domains Ec12 Length = 215 | Back alignment and structure |
| >pdb|2A4E|A Chain A, Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length = 215 | Back alignment and structure |
| >pdb|2A4E|A Chain A, Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length = 215 | Back alignment and structure |
| >pdb|2WD0|A Chain A, Crystal Structure Of Nonsyndromic Deafness (Dfnb12) Associated Mutant D124g Of Mouse Cadherin-23 Ec1-2 Length = 214 | Back alignment and structure |
| >pdb|2WD0|A Chain A, Crystal Structure Of Nonsyndromic Deafness (Dfnb12) Associated Mutant D124g Of Mouse Cadherin-23 Ec1-2 Length = 214 | Back alignment and structure |
| >pdb|1FF5|A Chain A, Structure Of E-Cadherin Double Domain Length = 219 | Back alignment and structure |
| >pdb|1FF5|A Chain A, Structure Of E-Cadherin Double Domain Length = 219 | Back alignment and structure |
| >pdb|3PPE|A Chain A, Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Length = 203 | Back alignment and structure |
| >pdb|3LNI|A Chain A, Crystal Structure Of E-Cadherin Ec12 E89a Length = 213 | Back alignment and structure |
| >pdb|3LNI|A Chain A, Crystal Structure Of E-Cadherin Ec12 E89a Length = 213 | Back alignment and structure |
| >pdb|3UBF|A Chain A, Crystal Structure Of Drosophila N-Cadherin Ec1-3, I Length = 316 | Back alignment and structure |
| >pdb|3Q2L|A Chain A, Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 | Back alignment and structure |
| >pdb|3Q2L|A Chain A, Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 | Back alignment and structure |
| >pdb|3LNE|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14e Length = 213 | Back alignment and structure |
| >pdb|3LNE|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14e Length = 213 | Back alignment and structure |
| >pdb|3LNG|A Chain A, Crystal Structure Of E-Cadherin Ec12 Aa Extension Length = 215 | Back alignment and structure |
| >pdb|3LNG|A Chain A, Crystal Structure Of E-Cadherin Ec12 Aa Extension Length = 215 | Back alignment and structure |
| >pdb|3LNF|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14ew2a Length = 213 | Back alignment and structure |
| >pdb|3LNF|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14ew2a Length = 213 | Back alignment and structure |
| >pdb|1Q1P|A Chain A, E-Cadherin Activation Length = 212 | Back alignment and structure |
| >pdb|1Q1P|A Chain A, E-Cadherin Activation Length = 212 | Back alignment and structure |
| >pdb|2QVF|B Chain B, Mouse E-cadherin Domains 1,2 Length = 213 | Back alignment and structure |
| >pdb|2QVF|B Chain B, Mouse E-cadherin Domains 1,2 Length = 213 | Back alignment and structure |
| >pdb|3LNH|A Chain A, Crystal Structure Of E-Cadherin Ec12 W2a Length = 213 | Back alignment and structure |
| >pdb|3LNH|A Chain A, Crystal Structure Of E-Cadherin Ec12 W2a Length = 213 | Back alignment and structure |
| >pdb|3QRB|A Chain A, Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Length = 213 | Back alignment and structure |
| >pdb|3QRB|A Chain A, Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Length = 213 | Back alignment and structure |
| >pdb|3Q2N|A Chain A, Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 | Back alignment and structure |
| >pdb|3Q2N|A Chain A, Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 | Back alignment and structure |
| >pdb|2O72|A Chain A, Crystal Structure Analysis Of Human E-Cadherin (1-213) Length = 213 | Back alignment and structure |
| >pdb|2O72|A Chain A, Crystal Structure Analysis Of Human E-Cadherin (1-213) Length = 213 | Back alignment and structure |
| >pdb|2YST|A Chain A, Solution Structure Of The Third Cadherin Domain From Human Protocadherin 7 Length = 119 | Back alignment and structure |
| >pdb|3K5S|A Chain A, Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Length = 217 | Back alignment and structure |
| >pdb|3K5S|A Chain A, Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Length = 217 | Back alignment and structure |
| >pdb|2EE0|A Chain A, Solution Structures Of The Ca Domain Of Human Protocadherin 9 Length = 114 | Back alignment and structure |
| >pdb|2EE0|A Chain A, Solution Structures Of The Ca Domain Of Human Protocadherin 9 Length = 114 | Back alignment and structure |
| >pdb|3K5R|A Chain A, Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Length = 218 | Back alignment and structure |
| >pdb|4APX|B Chain B, Crystal Structure Of Mouse Cadherin-23 Ec1-2 And Protocadherin-15 Ec1-2 Form I Length = 242 | Back alignment and structure |
| >pdb|1SUH|A Chain A, Amino-Terminal Domain Of Epithelial Cadherin In The Calcium Bound State, Nmr, 20 Structures Length = 146 | Back alignment and structure |
| >pdb|1SUH|A Chain A, Amino-Terminal Domain Of Epithelial Cadherin In The Calcium Bound State, Nmr, 20 Structures Length = 146 | Back alignment and structure |
| >pdb|1ZXK|A Chain A, Crystal Structure Of Cadherin8 Ec1 Domain Length = 98 | Back alignment and structure |
| >pdb|1NCH|A Chain A, Structural Basis Of Cell-Cell Adhesion By Cadherins Length = 110 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 384 | |||
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 1e-108 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 1e-98 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 4e-74 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 1e-72 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 2e-11 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 1e-106 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 1e-102 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 4e-73 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 2e-71 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 1e-44 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 3e-12 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 1e-106 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 5e-76 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 5e-74 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 4e-44 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 1e-105 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 2e-95 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 2e-73 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 3e-71 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 3e-37 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 4e-92 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 1e-82 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 3e-61 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 4e-36 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 1e-33 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 8e-08 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 1e-89 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 2e-81 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 2e-47 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 3e-45 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 6e-14 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 9e-14 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 1e-78 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 1e-78 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 1e-40 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 1e-17 | |
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 3e-67 | |
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 3e-59 | |
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 3e-57 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 1e-60 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 1e-54 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 5e-51 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 9e-22 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 3e-17 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 1e-60 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 8e-48 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 8e-45 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 1e-13 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 4e-60 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 3e-48 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 1e-46 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 4e-16 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 2e-13 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 3e-57 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 6e-50 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 7e-50 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 2e-17 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 7e-17 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 9e-55 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 1e-50 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 3e-43 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 4e-13 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 7e-54 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 2e-51 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 4e-47 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 1e-12 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 7e-52 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 2e-47 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 4e-39 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 1e-33 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 2e-32 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 1e-21 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 5e-17 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 4e-30 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 3e-27 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 2e-20 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 3e-10 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 2e-26 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 2e-23 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 7e-22 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 2e-13 | |
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 3e-22 | |
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 2e-21 | |
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 9e-21 | |
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 9e-14 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 3e-20 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 4e-19 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 1e-16 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 3e-12 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 5e-19 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 8e-19 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 7e-16 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 2e-13 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 7e-19 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 8e-18 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 2e-15 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 1e-11 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 1e-18 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 5e-18 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 2e-14 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 3e-14 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 1e-16 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 1e-16 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 5e-15 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 1e-14 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 3e-16 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 1e-15 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 3e-14 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 5e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-06 | |
| 1wyj_A | 125 | Protocadherin beta 14; SS bond, structural genomic | 5e-06 | |
| 1op4_A | 159 | Neural-cadherin; beta sandwich, cadherin-like doma | 4e-04 |
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
Score = 326 bits (839), Expect = e-108
Identities = 106/408 (25%), Positives = 175/408 (42%), Gaps = 47/408 (11%)
Query: 2 NGRLEYSIVSGDDEE----IFTINPSNGTLSNLKHLDRETKSSYNLVVMATDMAKPPQKR 57
++ YSI ++ +F I G L + LDRE + Y L A
Sbjct: 31 ETKVFYSITGQGADKPPVGVFIIERETGWLKVTQPLDREAIAKYILYSHAVSSNGEA--- 87
Query: 58 LSSTTQVSIVIRDVNDNAPEFITAN-ETTIPENSPLNTVVAALKAIDRDEG---QNSYVE 113
+ ++ I + D NDN PEF E ++ E + T V + A D D+ N+ +
Sbjct: 88 VEDPMEIVITVTDQNDNRPEFTQEVFEGSVAEGAVPGTSVMKVSATDADDDVNTYNAAIA 147
Query: 114 YSIINSEATP-----FSLGPVDGLLRVAQK-LDREIKSNYTLEIKAKDRGEPSKSSRTKF 167
Y+I++ + F++ G++ V LDRE YTL ++A D S+ K
Sbjct: 148 YTIVSQDPELPHKNMFTVNRDTGVISVLTSGLDRESYPTYTLVVQAADLQGEGLSTTAKA 207
Query: 168 FIRLLDENDNNPIFDSKSYSASVPENISVGATVLQVSATDLDDGING--RVRYTIISGDD 225
I + D NDN P+F+ +Y VPEN V A + + TD D + YT+++ D
Sbjct: 208 VITVKDINDNAPVFNPSTYQGQVPEN-EVNARIATLKVTDDDAPNTPAWKAVYTVVNDPD 266
Query: 226 NHDLTISEDN----GLLRIAKNLNYERKAQYSLTIQAEDCGGDTEERIRFDTATVSILVS 281
+ D G+L+ AK L++E K QY L ++ E+ + TATV++ V
Sbjct: 267 QQ-FVVVTDPTTNDGILKTAKGLDFEAKQQYILHVRVENEEPFEGSLVP-STATVTVDVV 324
Query: 282 DINDNYPVFLHSPYLALVNENTLPGPSFRIMTVQAHDADSLPFNGLVRYFLKDSGASSGN 341
D+N+ P+F+ + V E+ G I + A + D+ + + Y +
Sbjct: 325 DVNEA-PIFMPAERRVEVPEDFGVGQE--ITSYTAREPDTFM-DQKITYRI--------- 371
Query: 342 SQTQGGTGDLFRVNSTTGDIYLLKSLDRE-----KQAEYLLTLQAMDS 384
T + +N TG I+ +DRE K + Y+ + A D
Sbjct: 372 ---WRDTANWLEINPETGAIFTRAEMDREDAEHVKNSTYVALIIATDD 416
|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 | Back alignment and structure |
|---|
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 | Back alignment and structure |
|---|
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 | Back alignment and structure |
|---|
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 | Back alignment and structure |
|---|
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Length = 125 | Back alignment and structure |
|---|
| >1op4_A Neural-cadherin; beta sandwich, cadherin-like domain, cell adhesion; NMR {Mus musculus} SCOP: b.1.6.1 Length = 159 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 384 | |||
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 100.0 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 100.0 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 100.0 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 100.0 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 100.0 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 100.0 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 100.0 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 100.0 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 100.0 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 100.0 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 100.0 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 100.0 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 100.0 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 100.0 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 100.0 | |
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 100.0 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 100.0 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 100.0 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 100.0 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 100.0 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 100.0 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 100.0 | |
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 100.0 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 100.0 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 100.0 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 100.0 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 100.0 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 100.0 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 100.0 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 100.0 | |
| 4apx_B | 242 | Protocadherin-15, otocadherin; cell adhesion, hear | 99.98 | |
| 4apx_B | 242 | Protocadherin-15, otocadherin; cell adhesion, hear | 99.95 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 99.94 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 99.94 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 99.91 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 99.91 | |
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 99.86 | |
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 99.85 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 99.83 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 99.81 | |
| 1wyj_A | 125 | Protocadherin beta 14; SS bond, structural genomic | 99.77 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 99.75 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 99.74 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 99.73 | |
| 1wyj_A | 125 | Protocadherin beta 14; SS bond, structural genomic | 99.72 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 99.72 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 99.7 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 99.69 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 99.69 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 99.69 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 99.68 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 99.66 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 99.66 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 99.64 | |
| 1wuz_A | 103 | Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p | 99.42 | |
| 1wuz_A | 103 | Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p | 99.34 | |
| 3pdd_A | 190 | Glycoside hydrolase, family 9; CBHA, beta-sandwich | 96.32 | |
| 3pdd_A | 190 | Glycoside hydrolase, family 9; CBHA, beta-sandwich | 96.04 | |
| 3rb5_A | 298 | Na/Ca exchange protein; CBD12, calcium binding and | 94.89 | |
| 3rb5_A | 298 | Na/Ca exchange protein; CBD12, calcium binding and | 94.36 | |
| 2kpn_A | 103 | Bacillolysin; solution structure, BIG_3 domain, PF | 92.67 | |
| 2yhg_A | 437 | SDE_182CT, cellulose-binding protein; hydrolase, g | 92.16 | |
| 2yhg_A | 437 | SDE_182CT, cellulose-binding protein; hydrolase, g | 91.85 | |
| 2yrl_A | 102 | KIAA1837 protein; PKD domain, NPPSFA, national pro | 91.54 | |
| 1op4_A | 159 | Neural-cadherin; beta sandwich, cadherin-like doma | 90.56 | |
| 1op4_A | 159 | Neural-cadherin; beta sandwich, cadherin-like doma | 89.29 | |
| 2yrl_A | 102 | KIAA1837 protein; PKD domain, NPPSFA, national pro | 87.88 | |
| 3ead_A | 137 | Na/Ca exchange protein; CBD1, calcium regulation, | 84.02 |
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} | Back alignment and structure |
|---|
Probab=100.00 E-value=2e-66 Score=512.17 Aligned_cols=363 Identities=30% Similarity=0.435 Sum_probs=329.4
Q ss_pred CccEEEEEEeCCC----CCcEEEeCCCcEEEECccCCcCCCcEEEEEEEEEeCCCCCCCCceeEEEEEEEEEeecCCCCE
Q psy13120 2 NGRLEYSIVSGDD----EEIFTINPSNGTLSNLKHLDRETKSSYNLVVMATDMAKPPQKRLSSTTQVSIVIRDVNDNAPE 77 (384)
Q Consensus 2 ~~~i~Y~i~~~~~----~~~F~id~~tG~i~~~~~lD~E~~~~~~l~v~a~d~~~~~~~~~s~~~~v~I~V~dvNd~~P~ 77 (384)
|+.|+|+|.+++. .++|.||+.+|.|++.+.||||....|.|+|+|+|+++++ +++++.|.|.|.|+|||+|.
T Consensus 31 n~~i~Ysi~~~~~~~~~~~~F~id~~tG~l~~~~~LDrE~~~~y~l~v~a~D~g~~~---~~~~~~v~I~V~DvNDn~P~ 107 (559)
T 3q2w_A 31 NLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRAHAVDINGNQ---VENPIDIVINVIDMNDNRPE 107 (559)
T ss_dssp TSCEEEEEESBTTTBSSTTSEEECTTTCEEEECSCCCTTTCSEEEEEEEEEETTSCE---EEEEEEEEEEEECCCCCCCE
T ss_pred CcEEEEEEECCCCCCCCCceEEEeCCceEEEECCccCCCCCceEEEEEEEEECCCCc---cceeEEEEEEEEeCCCCCCc
Confidence 6789999987544 3689999999999999999999999999999999998764 68889999999999999999
Q ss_pred EccC-ceeEeeCCCCCCcEEEEEEEEeCCCC--CCceEEEEEEcCCC-----CCeeeeCcceEEEEce-eCCccCCCeEE
Q psy13120 78 FITA-NETTIPENSPLNTVVAALKAIDRDEG--QNSYVEYSIINSEA-----TPFSLGPVDGLLRVAQ-KLDREIKSNYT 148 (384)
Q Consensus 78 f~~~-~~~~v~E~~~~gt~v~~~~a~D~D~~--~~~~~~y~l~~~~~-----~~F~i~~~~G~i~~~~-~ld~e~~~~~~ 148 (384)
|... |.++|+|++++|+.++++.|+|+|.+ .|+.++|+|.++.. +.|.|++.+|.|++.+ .||||....|.
T Consensus 108 F~~~~y~~~V~En~~~Gt~v~~v~A~D~D~g~~~n~~v~Ysi~~~~~~~~~~~~F~Id~~tG~i~~~~~~LD~E~~~~y~ 187 (559)
T 3q2w_A 108 FLHQVWNGSVPEGSKPGTYVMTVTAIDADDPNALNGMLRYRILSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYT 187 (559)
T ss_dssp ESCSEEEEEEETTCCTTCEEEECCEECSSCTTSGGGCCEEEEEEEESCCSCTTCEEECTTTCEEEECCSCCCTTTCCEEE
T ss_pred cCCCeeEEEEeCCCCCCcEEEEEEEEcCCCCCCCceEEEEEEecCCCCCCCcceEEEeCCceEEEEEeccCCcccCCEEE
Confidence 9988 99999999999999999999999987 58899999987632 6899999999999987 99999999999
Q ss_pred EEEEEEeCCC---CCCceeEEEEEEeccCCCCCCceeccceEEEEecCCCCCcEEEEEEEEeCCCCC--CceEEEEEEeC
Q psy13120 149 LEIKAKDRGE---PSKSSRTKFFIRLLDENDNNPIFDSKSYSASVPENISVGATVLQVSATDLDDGI--NGRVRYTIISG 223 (384)
Q Consensus 149 l~V~a~d~~~---~~~~~~~~v~I~V~dvnd~~P~f~~~~~~~~v~E~~~~g~~v~~v~a~D~D~~~--~~~i~y~i~~~ 223 (384)
|+|+|+|+++ ++++++++|+|+|.|+|||+|.|....|.+.|+|+. +|+.++++.|+|+|.+. ++.+.|+|.++
T Consensus 188 l~V~A~D~~g~p~~~~s~t~~v~I~V~DvNDn~P~f~~~~y~~~V~En~-~g~~v~~v~a~D~D~~~~~n~~~~y~i~~g 266 (559)
T 3q2w_A 188 LIIQATDMEGNPTYGLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENR-VDVIVANLTVTDKDQPHTPAWNAAYRISGG 266 (559)
T ss_dssp EEEEEEHHHHCTTTCCEEEEEEEEEEECCSCSCCEESSSEEEEEEESSC-SSEEEEEEEEECCSCTTSTTTSBCCEEEES
T ss_pred EEEEEEECCCCCCCCccceEEEEEEEEeCCCCCCccccccceeEecCCC-CCcEEEEEEEEcCCCCCCCceeEEEEEecC
Confidence 9999999854 358999999999999999999999999999999997 89999999999999865 56799999999
Q ss_pred CCCCCeEE----ECCCcEEEEcccCCccccCeEEEEEEEEECCCCCc--ceeeeeEEEEEEEEeecCCCCCcccCCCeeE
Q psy13120 224 DDNHDLTI----SEDNGLLRIAKNLNYERKAQYSLTIQAEDCGGDTE--ERIRFDTATVSILVSDINDNYPVFLHSPYLA 297 (384)
Q Consensus 224 ~~~~~f~i----~~~~G~l~~~~~lD~e~~~~~~l~V~a~D~~~~~~--~~~~~~~~~v~i~V~dvNd~~P~f~~~~~~~ 297 (384)
+..+.|.| ++.+|.|++.++||||....|.|+|+|+|++.... .+.++++++|+|.|.|+|| +|.|.+..|.+
T Consensus 267 ~~~~~F~I~~~~~~~~G~i~~~~~LD~E~~~~y~l~V~A~D~~~~~~g~~~~~~s~~~v~I~V~DvND-~P~f~~~~~~~ 345 (559)
T 3q2w_A 267 DPTGRFAILTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNE-NPYFAPNPKII 345 (559)
T ss_dssp CTTCCEEEEECTTTCEEEEEECSCCCTTTCSEEEEEEECCBSSCCCTTCCCCGGGEEEEEEEEECCCC-CCEESSSEEEE
T ss_pred CCCCceEEEecCCCCcEEEEeCCCCCCccCceEEEEEEEEcCCccccCCCCCCceEEEEEEEEEeCCC-CCcccccceEE
Confidence 98999999 46799999999999999999999999999753110 0113789999999999999 79999999999
Q ss_pred EEcCCCCCCCceEEEEEEEecCCCCCCCceEEEEEecCCCCCCCCcCCCCCCCceEEeCCcceEEEcccCCcccc----c
Q psy13120 298 LVNENTLPGPSFRIMTVQAHDADSLPFNGLVRYFLKDSGASSGNSQTQGGTGDLFRVNSTTGDIYLLKSLDREKQ----A 373 (384)
Q Consensus 298 ~v~e~~~~~~g~~i~~v~a~D~D~~~~~~~i~y~l~~~~~~~~~~~~~~~~~~~f~Id~~tG~i~~~~~ld~e~~----~ 373 (384)
.|.|+..+ |..++++.|+|+|.+. ++.++|+|.. +..++|.|++.+|.|++.+.||||.. .
T Consensus 346 ~v~En~~~--g~~v~~v~A~D~D~g~-n~~i~Ysi~~------------~~~~~f~Id~~tG~i~~~~~lDrE~~~~~~~ 410 (559)
T 3q2w_A 346 RQEEGLHA--GTMLTTLTAQDPDRYM-QQNIRYTKLS------------DPANWLKIDPVNGQITTIAVLDRESPNVKNN 410 (559)
T ss_dssp EEESCCCT--TCEEEECCEECSCSSS-CCCEEEEEEE------------CTTCCEEECTTTCEEEESSCCCSSSTTSCSS
T ss_pred EEeCCCCC--CCEEEEEEEECCCCCC-CCceEEEEcc------------CCccceEecCCceEEEEccccCcccccccCC
Confidence 99999944 8899999999999987 8999999987 56789999999999999999999986 9
Q ss_pred EEEEEEEEEcC
Q psy13120 374 EYLLTLQAMDS 384 (384)
Q Consensus 374 ~~~l~V~a~D~ 384 (384)
.|+|+|+|+|+
T Consensus 411 ~y~l~V~A~D~ 421 (559)
T 3q2w_A 411 IYNATFLASDN 421 (559)
T ss_dssp EEEEEEEEEEC
T ss_pred EEEEEEEEEcC
Confidence 99999999995
|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A | Back alignment and structure |
|---|
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} | Back alignment and structure |
|---|
| >4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* | Back alignment and structure |
|---|
| >4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A | Back alignment and structure |
|---|
| >1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} | Back alignment and structure |
|---|
| >1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B | Back alignment and structure |
|---|
| >1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A | Back alignment and structure |
|---|
| >3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A | Back alignment and structure |
|---|
| >3rb5_A Na/Ca exchange protein; CBD12, calcium binding and regulation, metal binding protein; 2.35A {Drosophila melanogaster} PDB: 3rb7_A 3e9u_A | Back alignment and structure |
|---|
| >3rb5_A Na/Ca exchange protein; CBD12, calcium binding and regulation, metal binding protein; 2.35A {Drosophila melanogaster} PDB: 3rb7_A 3e9u_A | Back alignment and structure |
|---|
| >2kpn_A Bacillolysin; solution structure, BIG_3 domain, PF07523, PSI BIG-open NESG, cell WALL, hydrolase, peptidoglycan-anchor; NMR {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >2yhg_A SDE_182CT, cellulose-binding protein; hydrolase, glycoside hydrolase; HET: BTB; 1.08A {Saccharophagus degradans} | Back alignment and structure |
|---|
| >2yhg_A SDE_182CT, cellulose-binding protein; hydrolase, glycoside hydrolase; HET: BTB; 1.08A {Saccharophagus degradans} | Back alignment and structure |
|---|
| >2yrl_A KIAA1837 protein; PKD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1op4_A Neural-cadherin; beta sandwich, cadherin-like domain, cell adhesion; NMR {Mus musculus} SCOP: b.1.6.1 | Back alignment and structure |
|---|
| >1op4_A Neural-cadherin; beta sandwich, cadherin-like domain, cell adhesion; NMR {Mus musculus} SCOP: b.1.6.1 | Back alignment and structure |
|---|
| >2yrl_A KIAA1837 protein; PKD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ead_A Na/Ca exchange protein; CBD1, calcium regulation, membrane, transmembrane, membrane; 2.25A {Drosophila melanogaster} SCOP: b.1.27.0 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 384 | ||||
| d1l3wa3 | 113 | b.1.6.1 (A:214-326) C-cadherin ectodomain {African | 5e-17 | |
| d1l3wa3 | 113 | b.1.6.1 (A:214-326) C-cadherin ectodomain {African | 2e-10 | |
| d1l3wa3 | 113 | b.1.6.1 (A:214-326) C-cadherin ectodomain {African | 9e-07 | |
| d1l3wa3 | 113 | b.1.6.1 (A:214-326) C-cadherin ectodomain {African | 4e-06 | |
| d1l3wa4 | 107 | b.1.6.1 (A:327-433) C-cadherin ectodomain {African | 3e-16 | |
| d1l3wa4 | 107 | b.1.6.1 (A:327-433) C-cadherin ectodomain {African | 8e-16 | |
| d1l3wa4 | 107 | b.1.6.1 (A:327-433) C-cadherin ectodomain {African | 2e-07 | |
| d1l3wa4 | 107 | b.1.6.1 (A:327-433) C-cadherin ectodomain {African | 2e-06 | |
| d1l3wa2 | 113 | b.1.6.1 (A:101-213) C-cadherin ectodomain {African | 1e-15 | |
| d1l3wa2 | 113 | b.1.6.1 (A:101-213) C-cadherin ectodomain {African | 1e-12 | |
| d1l3wa2 | 113 | b.1.6.1 (A:101-213) C-cadherin ectodomain {African | 1e-07 | |
| d1l3wa2 | 113 | b.1.6.1 (A:101-213) C-cadherin ectodomain {African | 5e-06 | |
| d1ncja2 | 114 | b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu | 1e-15 | |
| d1ncja2 | 114 | b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu | 6e-10 | |
| d1ncja2 | 114 | b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu | 8e-08 | |
| d1ncja2 | 114 | b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu | 4e-07 | |
| d1edha2 | 112 | b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse | 1e-14 | |
| d1edha2 | 112 | b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse | 8e-12 | |
| d1edha2 | 112 | b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse | 2e-08 | |
| d1edha2 | 112 | b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse | 1e-05 | |
| d2omzb1 | 104 | b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human | 2e-14 | |
| d2omzb1 | 104 | b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human | 4e-13 | |
| d2omzb1 | 104 | b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human | 1e-08 | |
| d2omzb1 | 104 | b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human | 2e-05 | |
| d1l3wa1 | 100 | b.1.6.1 (A:1-100) C-cadherin ectodomain {African c | 7e-14 | |
| d1l3wa1 | 100 | b.1.6.1 (A:1-100) C-cadherin ectodomain {African c | 3e-13 | |
| d1l3wa1 | 100 | b.1.6.1 (A:1-100) C-cadherin ectodomain {African c | 1e-09 | |
| d1l3wa1 | 100 | b.1.6.1 (A:1-100) C-cadherin ectodomain {African c | 4e-05 | |
| d1op4a_ | 136 | b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu | 9e-13 | |
| d1op4a_ | 136 | b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu | 7e-12 | |
| d1op4a_ | 136 | b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu | 4e-04 | |
| d1ncia_ | 102 | b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu | 3e-12 | |
| d1ncia_ | 102 | b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu | 1e-11 | |
| d1ncia_ | 102 | b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu | 2e-07 | |
| d1ncia_ | 102 | b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu | 2e-04 | |
| d1l3wa5 | 107 | b.1.6.1 (A:434-540) C-cadherin ectodomain {African | 9e-10 | |
| d1l3wa5 | 107 | b.1.6.1 (A:434-540) C-cadherin ectodomain {African | 3e-07 |
| >d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Cadherin-like family: Cadherin domain: C-cadherin ectodomain species: African clawed frog (Xenopus laevis) [TaxId: 8355]
Score = 74.3 bits (181), Expect = 5e-17
Identities = 41/114 (35%), Positives = 58/114 (50%), Gaps = 7/114 (6%)
Query: 175 NDNNPIFDSKSYSASVPENISVGATVLQVSATDLDDGINGR-VRYTIISGDDNHDLTISE 233
NDN PIFD K+Y+A VPEN +G V ++S TDLD I ++ I+
Sbjct: 2 NDNAPIFDPKTYTALVPEN-EIGFEVQRLSVTDLDMPGTPAWQAVYKIRVNEGGFFNITT 60
Query: 234 D----NGLLRIAKNLNYERKAQYSLTIQAEDCGGDTEERIRFDTATVSILVSDI 283
D G+L AK L++E + QY L I E+ + TATV++ V D+
Sbjct: 61 DPESNQGILTTAKGLDFELRKQYVLQITVENAEPFSVPL-PTSTATVTVTVEDV 113
|
| >d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 | Back information, alignment and structure |
|---|
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 | Back information, alignment and structure |
|---|
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 | Back information, alignment and structure |
|---|
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 | Back information, alignment and structure |
|---|
| >d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 | Back information, alignment and structure |
|---|
| >d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 | Back information, alignment and structure |
|---|
| >d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 | Back information, alignment and structure |
|---|
| >d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 | Back information, alignment and structure |
|---|
| >d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 | Back information, alignment and structure |
|---|
| >d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 | Back information, alignment and structure |
|---|
| >d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 | Back information, alignment and structure |
|---|
| >d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
| >d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 384 | |||
| d1l3wa4 | 107 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.83 | |
| d1l3wa2 | 113 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.81 | |
| d1edha2 | 112 | E-cadherin (epithelial) {Mouse (Mus musculus) [Tax | 99.81 | |
| d1l3wa2 | 113 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.81 | |
| d1edha2 | 112 | E-cadherin (epithelial) {Mouse (Mus musculus) [Tax | 99.8 | |
| d1l3wa4 | 107 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.79 | |
| d1ncja2 | 114 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.77 | |
| d1ncja2 | 114 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.75 | |
| d1op4a_ | 136 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.73 | |
| d1op4a_ | 136 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.72 | |
| d1l3wa3 | 113 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.7 | |
| d1l3wa3 | 113 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.68 | |
| d1l3wa5 | 107 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.61 | |
| d1l3wa5 | 107 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.6 | |
| d1l3wa1 | 100 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.57 | |
| d1ncia_ | 102 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.56 | |
| d2omzb1 | 104 | E-cadherin (epithelial) {Human (Homo sapiens) [Tax | 99.54 | |
| d1ncia_ | 102 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.52 | |
| d1l3wa1 | 100 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.51 | |
| d2omzb1 | 104 | E-cadherin (epithelial) {Human (Homo sapiens) [Tax | 99.49 | |
| d1u2ca1 | 103 | Dystroglycan, N-terminal domain {Mouse (Mus muscul | 95.84 | |
| d1u2ca1 | 103 | Dystroglycan, N-terminal domain {Mouse (Mus muscul | 93.48 |
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Cadherin-like family: Cadherin domain: C-cadherin ectodomain species: African clawed frog (Xenopus laevis) [TaxId: 8355]
Probab=99.83 E-value=9.3e-21 Score=143.12 Aligned_cols=102 Identities=25% Similarity=0.359 Sum_probs=95.3
Q ss_pred CCCCEEccC-ceeEeeCCCCCCcEEEEEEEEeCCCCCCceEEEEEEcCCCCCeeeeCcceEEEEceeCCccC----CCeE
Q psy13120 73 DNAPEFITA-NETTIPENSPLNTVVAALKAIDRDEGQNSYVEYSIINSEATPFSLGPVDGLLRVAQKLDREI----KSNY 147 (384)
Q Consensus 73 d~~P~f~~~-~~~~v~E~~~~gt~v~~~~a~D~D~~~~~~~~y~l~~~~~~~F~i~~~~G~i~~~~~ld~e~----~~~~ 147 (384)
||+|.|... +.+.|+|+.++|+.++++.|+|+|.+.++.++|++.+...++|.|++.+|.|++++.||||. ...|
T Consensus 1 Dn~P~F~~~~~~~~v~E~~~~g~~v~~v~A~D~D~~~~~~i~y~i~~~~~~~F~id~~tG~i~~~~~lD~E~~~~~~~~y 80 (107)
T d1l3wa4 1 NEAPFFVPAVSRVDVSEDLSRGEKIISLVAQDPDKQQIQKLSYFIGNDPARWLTVNKDNGIVTGNGNLDRESEYVKNNTY 80 (107)
T ss_dssp CCCCEESSCEECCCBCTTCCSSEEEEECCEECCCTTCCCCEEEEECCCSSCCCEEETTTTEEEECSCCCTTSSSCCSSCC
T ss_pred CcCCCcCCCeEEEEEECCCCCCCEEEEeEEecCCcCcCCceeEEecCCCcccceeccccceEEEccccChhhccccCCeE
Confidence 579999988 89999999999999999999999999999999999887778999999999999999999995 3679
Q ss_pred EEEEEEEeCCCCCCceeEEEEEEeccC
Q psy13120 148 TLEIKAKDRGEPSKSSRTKFFIRLLDE 174 (384)
Q Consensus 148 ~l~V~a~d~~~~~~~~~~~v~I~V~dv 174 (384)
.|.|.|+|.|.|++++++++.|+|.||
T Consensus 81 ~l~v~a~D~g~p~~~~t~~v~V~V~DV 107 (107)
T d1l3wa4 81 TVIMLVTDDGVSVGTGTGTLILHVLDV 107 (107)
T ss_dssp EEEEEEEECSSSCCCCCEEEECCBCCC
T ss_pred EEEEEEEECCcCCcEEEEEEEEEEEeC
Confidence 999999999999999999999999886
|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|