Psyllid ID: psy13135
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 996 | ||||||
| 242009414 | 950 | conserved hypothetical protein [Pediculu | 0.460 | 0.483 | 0.770 | 0.0 | |
| 385258475 | 988 | chitinase [Plutella xylostella] | 0.460 | 0.464 | 0.753 | 0.0 | |
| 270008875 | 984 | hypothetical protein TcasGA2_TC015481 [T | 0.460 | 0.466 | 0.753 | 0.0 | |
| 110431374 | 980 | chitinase 7 precursor [Tribolium castane | 0.460 | 0.468 | 0.753 | 0.0 | |
| 193690615 | 998 | PREDICTED: hypothetical protein LOC10016 | 0.456 | 0.455 | 0.754 | 0.0 | |
| 357628787 | 768 | hypothetical protein KGM_22454 [Danaus p | 0.460 | 0.597 | 0.722 | 0.0 | |
| 158286667 | 1017 | AGAP006898-PA [Anopheles gambiae str. PE | 0.461 | 0.452 | 0.730 | 0.0 | |
| 322779473 | 973 | hypothetical protein SINV_08232 [Solenop | 0.474 | 0.486 | 0.725 | 0.0 | |
| 170054146 | 984 | brain chitinase and chia [Culex quinquef | 0.461 | 0.467 | 0.734 | 0.0 | |
| 332020739 | 987 | Putative chitinase 3 [Acromyrmex echinat | 0.460 | 0.465 | 0.736 | 0.0 |
| >gi|242009414|ref|XP_002425481.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212509328|gb|EEB12743.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 804 bits (2076), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 379/492 (77%), Positives = 422/492 (85%), Gaps = 33/492 (6%)
Query: 261 VCEMLRNGAGYVWDDEMKVPYLVHGDQWVGFDDEKSIRYKMNWLKDNGYGGAMVWTVDMD 320
+CEMLR GA Y+WDDEMKVPYLV GDQWVGFDDEKSIR+KM WLK NG+GGAMVWTVDMD
Sbjct: 344 ICEMLRKGASYIWDDEMKVPYLVDGDQWVGFDDEKSIRHKMKWLKSNGFGGAMVWTVDMD 403
Query: 321 DFTGTVCGGDVKYPLIGAMREELNGIPRANNAKDVDWAKVAGNVEVETVTKPAPIKIDI- 379
DFTGT+CGG VKYPLIGAMREEL GIPR NNAKD+DW+KVA ++ + KP PIKID+
Sbjct: 404 DFTGTICGGKVKYPLIGAMREELLGIPRENNAKDIDWSKVANSIVEVNIEKPEPIKIDVS 463
Query: 380 -----------------------------FCYMTSWSQARPGAGKFGPENIDPKLCTHVI 410
FCYMTSWSQ RPGAGKF PE++D LCTHV+
Sbjct: 464 DLLSKFKKPTKAKTVENVITSTNERDPQVFCYMTSWSQKRPGAGKFTPEDVDAGLCTHVV 523
Query: 411 YAFGTLKDHKLTLNEDKEKDEAGKFEALMQLREKNPDIKILLAIGGWAFGSTPFKELTGN 470
YAF TLK+HKL+ +DK+ + ++ ++ LREKNP++K+LLAIGGWAFGSTPFKELT N
Sbjct: 524 YAFATLKNHKLSEADDKDGE---MYDRVVALREKNPNLKVLLAIGGWAFGSTPFKELTSN 580
Query: 471 VFRMNQFVYESIEFLREHKFNGLDVDWEYPRGADDRASYVNLLKELRLAFEGEAKTSGEP 530
FRMNQFVYE+IEFLRE+KFNGLDVDWEYPRGADDR+SYVNLLKELRLAFEGEAK+S +P
Sbjct: 581 TFRMNQFVYEAIEFLREYKFNGLDVDWEYPRGADDRSSYVNLLKELRLAFEGEAKSSNQP 640
Query: 531 RLLLTAAVPASFEAIAAGYDVPEISKYLDFINVMTYDFHGQWERQVGHNSPLKPLEGATS 590
RLLL+AAVPASFEAIAAGYDVPEISKYLDFINVMTYDFHGQWERQVGHNSPL L+ ATS
Sbjct: 641 RLLLSAAVPASFEAIAAGYDVPEISKYLDFINVMTYDFHGQWERQVGHNSPLYSLDSATS 700
Query: 591 YQKKLTVEYSAKEWVKQGAPKEKLMIGMPTYGRSFTLVDPTKFDIGAPASGGGEPGKYTA 650
YQKKLTV+YSA+EWVKQGAPKEKLMIGMPTYGRSFTLV+ ++FDIGAPASGGG PGKYT
Sbjct: 701 YQKKLTVDYSAREWVKQGAPKEKLMIGMPTYGRSFTLVNESQFDIGAPASGGGTPGKYTG 760
Query: 651 EAGFMSYYEVCDFLKKDNTTLVWDNEQQVPFAYKDDQWVGFDDERSLKMKMDWLKEDGYG 710
EAGFMSYYEVCDFL+KDNTTLVWDNEQQVPFAYK+DQWVGFDDERSLK KM+WLKE+G+G
Sbjct: 761 EAGFMSYYEVCDFLQKDNTTLVWDNEQQVPFAYKEDQWVGFDDERSLKTKMEWLKEEGFG 820
Query: 711 GIMIWSVDMDDL 722
GIMIWSVDMDD
Sbjct: 821 GIMIWSVDMDDF 832
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|385258475|gb|AFI55112.1| chitinase [Plutella xylostella] | Back alignment and taxonomy information |
|---|
| >gi|270008875|gb|EFA05323.1| hypothetical protein TcasGA2_TC015481 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|110431374|ref|NP_001036035.1| chitinase 7 precursor [Tribolium castaneum] gi|109895306|gb|ABG47445.1| chitinase 7 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|193690615|ref|XP_001950380.1| PREDICTED: hypothetical protein LOC100165452 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|357628787|gb|EHJ77971.1| hypothetical protein KGM_22454 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|158286667|ref|XP_308858.4| AGAP006898-PA [Anopheles gambiae str. PEST] gi|157020578|gb|EAA04006.4| AGAP006898-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|322779473|gb|EFZ09665.1| hypothetical protein SINV_08232 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|170054146|ref|XP_001862994.1| brain chitinase and chia [Culex quinquefasciatus] gi|167874514|gb|EDS37897.1| brain chitinase and chia [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|332020739|gb|EGI61144.1| Putative chitinase 3 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 996 | ||||||
| FB|FBgn0035398 | 1013 | Cht7 "Cht7" [Drosophila melano | 0.382 | 0.376 | 0.720 | 2.1e-270 | |
| FB|FBgn0250907 | 2286 | Cht3 "Chitinase 3" [Drosophila | 0.329 | 0.143 | 0.392 | 1.5e-109 | |
| UNIPROTKB|G3H3K7 | 719 | I79_004795 "Chitinase-3-like p | 0.353 | 0.489 | 0.408 | 2.2e-109 | |
| UNIPROTKB|F1MH27 | 472 | CHIA "Acidic mammalian chitina | 0.345 | 0.728 | 0.482 | 9.2e-107 | |
| UNIPROTKB|Q95M17 | 472 | CHIA "Acidic mammalian chitina | 0.345 | 0.728 | 0.482 | 1.2e-106 | |
| UNIPROTKB|E2R8B1 | 483 | CHIA "Uncharacterized protein" | 0.343 | 0.708 | 0.468 | 3.5e-105 | |
| UNIPROTKB|Q9BZP6 | 476 | CHIA "Acidic mammalian chitina | 0.343 | 0.718 | 0.457 | 2.4e-102 | |
| UNIPROTKB|E1BZP3 | 473 | CHIA "Uncharacterized protein" | 0.343 | 0.723 | 0.445 | 3.1e-102 | |
| UNIPROTKB|E1BZP6 | 480 | CHIA "Uncharacterized protein" | 0.343 | 0.712 | 0.445 | 3.1e-102 | |
| UNIPROTKB|F1NM31 | 479 | CHIA "Uncharacterized protein" | 0.343 | 0.713 | 0.445 | 3.1e-102 |
| FB|FBgn0035398 Cht7 "Cht7" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 1502 (533.8 bits), Expect = 2.1e-270, Sum P(4) = 2.1e-270
Identities = 281/390 (72%), Positives = 328/390 (84%)
Query: 334 PLIGAMREELNGIPRANNAKDVDWAKVAGNVEVETVTKPAPIKIDIFCYMTSWSQARPGA 393
P+ ++ E LN + R + K N V + T+PA +FCY+TSWS RPGA
Sbjct: 521 PIKISVDEILNKV-RKPQVQKKQRIKSGANA-VASNTRPA----QVFCYLTSWSAKRPGA 574
Query: 394 GKFGPENIDPKLCTHVIYAFGTLKDHKLTLNEDKEKDEAGKFEALMQLREKNPDIKILLA 453
GKF PENIDPKLCTH++YAF TL+D+KLT D D+ +E+++ LR+ NPD++ILLA
Sbjct: 575 GKFQPENIDPKLCTHIVYAFATLQDYKLTEATD---DDPENYESVIALRDNNPDLQILLA 631
Query: 454 IGGWAFGSTPFKELTGNVFRMNQFVYESIEFLREHKFNGLDVDWEYPRGADDRASYVNLL 513
IGGWAFGSTPFKELT NVFRMNQFVYE+I+FLR++KFNGLDVDWEYPRGA+DR +YV+LL
Sbjct: 632 IGGWAFGSTPFKELTSNVFRMNQFVYEAIDFLRDYKFNGLDVDWEYPRGAEDRVAYVSLL 691
Query: 514 KELRLAFEGEAKTSGEPRLLLTAAVPASFEAIAAGYDVPEISKYLDFINVMTYDFHGQWE 573
KELR+AFEGEAK+SG PRLLLTAAVPASFEAIAAGYDVPEISKYLDFINVMTYDFHGQWE
Sbjct: 692 KELRVAFEGEAKSSGLPRLLLTAAVPASFEAIAAGYDVPEISKYLDFINVMTYDFHGQWE 751
Query: 574 RQVGHNSPLKPLEGATSYQKKLTVEYSAKEWVKQGAPKEKLMIGMPTYGRSFTLVDPTKF 633
R VGHNSPL LE AT YQKKLTV+YSA+EWVKQGAPKEKL+IGMPTYGRSF LV+ T+F
Sbjct: 752 RTVGHNSPLFALESATGYQKKLTVDYSAREWVKQGAPKEKLLIGMPTYGRSFELVNDTQF 811
Query: 634 DIGAPASGGGEPGKYTAEAGFMSYYEVCDFLKKDNTTLVWDNEQQVPFAYKDDQWVGFDD 693
DIG+P+SGGG+ GK+T EAGF+SYYEVC FL DNTTLVWD+EQQVPFAY+ +QWVGFDD
Sbjct: 812 DIGSPSSGGGKAGKFTNEAGFLSYYEVCSFLAADNTTLVWDSEQQVPFAYRGNQWVGFDD 871
Query: 694 ERSLKMKMDWLKEDGYGGIMIWSVDMDDLS 723
ERSLK K +WLKE G+GGIM+WS+DMDD S
Sbjct: 872 ERSLKTKTEWLKEQGFGGIMVWSIDMDDFS 901
|
|
| FB|FBgn0250907 Cht3 "Chitinase 3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3H3K7 I79_004795 "Chitinase-3-like protein 1" [Cricetulus griseus (taxid:10029)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MH27 CHIA "Acidic mammalian chitinase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q95M17 CHIA "Acidic mammalian chitinase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R8B1 CHIA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9BZP6 CHIA "Acidic mammalian chitinase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BZP3 CHIA "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BZP6 CHIA "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NM31 CHIA "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 996 | |||
| cd02872 | 362 | cd02872, GH18_chitolectin_chitotriosidase, This co | 0.0 | |
| smart00636 | 334 | smart00636, Glyco_18, Glyco_18 domain | 1e-123 | |
| pfam00704 | 325 | pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam | 1e-104 | |
| cd06548 | 322 | cd06548, GH18_chitinase, The GH18 (glycosyl hydrol | 1e-77 | |
| COG3325 | 441 | COG3325, ChiA, Chitinase [Carbohydrate transport a | 3e-59 | |
| cd02879 | 299 | cd02879, GH18_plant_chitinase_class_V, The class V | 7e-56 | |
| cd02872 | 362 | cd02872, GH18_chitolectin_chitotriosidase, This co | 8e-54 | |
| cd00598 | 210 | cd00598, GH18_chitinase-like, The GH18 (glycosyl h | 3e-43 | |
| cd02873 | 413 | cd02873, GH18_IDGF, The IDGF's (imaginal disc grow | 8e-43 | |
| smart00636 | 334 | smart00636, Glyco_18, Glyco_18 domain | 4e-40 | |
| cd02872 | 362 | cd02872, GH18_chitolectin_chitotriosidase, This co | 4e-39 | |
| cd02878 | 345 | cd02878, GH18_zymocin_alpha, Zymocin, alpha subuni | 9e-37 | |
| pfam00704 | 325 | pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam | 4e-35 | |
| cd06548 | 322 | cd06548, GH18_chitinase, The GH18 (glycosyl hydrol | 1e-33 | |
| cd02874 | 313 | cd02874, GH18_CFLE_spore_hydrolase, Cortical fragm | 1e-31 | |
| cd02872 | 362 | cd02872, GH18_chitolectin_chitotriosidase, This co | 1e-30 | |
| cd02872 | 362 | cd02872, GH18_chitolectin_chitotriosidase, This co | 1e-26 | |
| cd02879 | 299 | cd02879, GH18_plant_chitinase_class_V, The class V | 9e-25 | |
| COG3325 | 441 | COG3325, ChiA, Chitinase [Carbohydrate transport a | 2e-24 | |
| cd00598 | 210 | cd00598, GH18_chitinase-like, The GH18 (glycosyl h | 3e-24 | |
| COG3858 | 423 | COG3858, COG3858, Predicted glycosyl hydrolase [Ge | 4e-22 | |
| smart00636 | 334 | smart00636, Glyco_18, Glyco_18 domain | 2e-18 | |
| pfam00704 | 325 | pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam | 2e-18 | |
| smart00636 | 334 | smart00636, Glyco_18, Glyco_18 domain | 1e-17 | |
| smart00636 | 334 | smart00636, Glyco_18, Glyco_18 domain | 4e-17 | |
| pfam00704 | 325 | pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam | 1e-16 | |
| cd06548 | 322 | cd06548, GH18_chitinase, The GH18 (glycosyl hydrol | 8e-16 | |
| cd02878 | 345 | cd02878, GH18_zymocin_alpha, Zymocin, alpha subuni | 8e-16 | |
| pfam01607 | 53 | pfam01607, CBM_14, Chitin binding Peritrophin-A do | 3e-15 | |
| pfam00704 | 325 | pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam | 4e-15 | |
| cd02872 | 362 | cd02872, GH18_chitolectin_chitotriosidase, This co | 5e-15 | |
| cd02874 | 313 | cd02874, GH18_CFLE_spore_hydrolase, Cortical fragm | 5e-14 | |
| cd02875 | 358 | cd02875, GH18_chitobiase, Chitobiase (also known a | 8e-14 | |
| cd06545 | 253 | cd06545, GH18_3CO4_chitinase, The Bacteroides thet | 8e-14 | |
| cd06548 | 322 | cd06548, GH18_chitinase, The GH18 (glycosyl hydrol | 1e-12 | |
| smart00494 | 49 | smart00494, ChtBD2, Chitin-binding domain type 2 | 2e-12 | |
| COG3325 | 441 | COG3325, ChiA, Chitinase [Carbohydrate transport a | 7e-10 | |
| COG3325 | 441 | COG3325, ChiA, Chitinase [Carbohydrate transport a | 1e-09 | |
| cd02873 | 413 | cd02873, GH18_IDGF, The IDGF's (imaginal disc grow | 4e-09 | |
| cd00598 | 210 | cd00598, GH18_chitinase-like, The GH18 (glycosyl h | 7e-09 | |
| cd06548 | 322 | cd06548, GH18_chitinase, The GH18 (glycosyl hydrol | 2e-08 | |
| cd02879 | 299 | cd02879, GH18_plant_chitinase_class_V, The class V | 4e-08 | |
| COG3858 | 423 | COG3858, COG3858, Predicted glycosyl hydrolase [Ge | 5e-08 | |
| cd00598 | 210 | cd00598, GH18_chitinase-like, The GH18 (glycosyl h | 1e-07 | |
| cd06545 | 253 | cd06545, GH18_3CO4_chitinase, The Bacteroides thet | 1e-07 | |
| COG3325 | 441 | COG3325, ChiA, Chitinase [Carbohydrate transport a | 8e-07 | |
| cd02873 | 413 | cd02873, GH18_IDGF, The IDGF's (imaginal disc grow | 2e-06 | |
| cd02879 | 299 | cd02879, GH18_plant_chitinase_class_V, The class V | 5e-06 | |
| cd02878 | 345 | cd02878, GH18_zymocin_alpha, Zymocin, alpha subuni | 2e-05 | |
| cd02871 | 312 | cd02871, GH18_chitinase_D-like, GH18 domain of Chi | 1e-04 | |
| cd02874 | 313 | cd02874, GH18_CFLE_spore_hydrolase, Cortical fragm | 2e-04 | |
| cd02876 | 318 | cd02876, GH18_SI-CLP, Stabilin-1 interacting chiti | 2e-04 | |
| cd02873 | 413 | cd02873, GH18_IDGF, The IDGF's (imaginal disc grow | 4e-04 | |
| cd06546 | 256 | cd06546, GH18_CTS3_chitinase, GH18 domain of CTS3 | 4e-04 | |
| smart00636 | 334 | smart00636, Glyco_18, Glyco_18 domain | 5e-04 | |
| pfam00704 | 325 | pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam | 7e-04 | |
| cd02875 | 358 | cd02875, GH18_chitobiase, Chitobiase (also known a | 8e-04 | |
| cd06544 | 253 | cd06544, GH18_narbonin, Narbonin is a plant 2S pro | 0.003 |
| >gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
Score = 537 bits (1387), Expect = 0.0
Identities = 193/349 (55%), Positives = 244/349 (69%), Gaps = 13/349 (3%)
Query: 379 IFCYMTSWSQARPGAGKFGPENIDPKLCTHVIYAFGTLKDHKLTLNEDKEKDEAGK--FE 436
+ CY T+W+Q RPG GKF PENIDP LCTH+IYAF L + + E ++ +E
Sbjct: 1 VVCYFTNWAQYRPGNGKFVPENIDPFLCTHIIYAFAGL-NPDGNIIILDEWNDIDLGLYE 59
Query: 437 ALMQLREKNPDIKILLAIGGWAFGSTPFKELTGNVFRMNQFVYESIEFLREHKFNGLDVD 496
L+EKNP++K LLAIGGW FGS F + + F+ +I FLR++ F+GLD+D
Sbjct: 60 RFNALKEKNPNLKTLLAIGGWNFGSAKFSAMAASPENRKTFIKSAIAFLRKYGFDGLDLD 119
Query: 497 WEYP--RG--ADDRASYVNLLKELRLAFEGEAKTSGEPRLLLTAAVPASFEAIAAGYDVP 552
WEYP RG +D+ ++V LLKELR AFE EA PRLLLTAAV A E I A YD+P
Sbjct: 120 WEYPGQRGGPPEDKENFVTLLKELREAFEPEA-----PRLLLTAAVSAGKETIDAAYDIP 174
Query: 553 EISKYLDFINVMTYDFHGQWERQVGHNSPLKPLEGATSYQKKLTVEYSAKEWVKQGAPKE 612
EISKYLDFINVMTYDFHG WE GHNSPL T QK L V+Y+ K W+ +GAP E
Sbjct: 175 EISKYLDFINVMTYDFHGSWEGVTGHNSPLYAGSADTGDQKYLNVDYAIKYWLSKGAPPE 234
Query: 613 KLMIGMPTYGRSFTLVDPTKFDIGAPASGGGEPGKYTAEAGFMSYYEVCDFLKKDNTTLV 672
KL++G+PTYGRSFTL P+ +GAPASG G G YT EAGF++YYE+C+FLK T+V
Sbjct: 235 KLVLGIPTYGRSFTLASPSNTGVGAPASGPGTAGPYTREAGFLAYYEICEFLKS-GWTVV 293
Query: 673 WDNEQQVPFAYKDDQWVGFDDERSLKMKMDWLKEDGYGGIMIWSVDMDD 721
WD+EQ+VP+AYK +QWVG+DDE S+ +K+ +LK G GG M+WS+D+DD
Sbjct: 294 WDDEQKVPYAYKGNQWVGYDDEESIALKVQYLKSKGLGGAMVWSIDLDD 342
|
The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens. Length = 362 |
| >gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain | Back alignment and domain information |
|---|
| >gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 | Back alignment and domain information |
|---|
| >gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >gnl|CDD|225862 COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|119358 cd02879, GH18_plant_chitinase_class_V, The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
| >gnl|CDD|119349 cd00598, GH18_chitinase-like, The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods | Back alignment and domain information |
|---|
| >gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster | Back alignment and domain information |
|---|
| >gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain | Back alignment and domain information |
|---|
| >gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
| >gnl|CDD|119357 cd02878, GH18_zymocin_alpha, Zymocin, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 | Back alignment and domain information |
|---|
| >gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >gnl|CDD|119353 cd02874, GH18_CFLE_spore_hydrolase, Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination | Back alignment and domain information |
|---|
| >gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
| >gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
| >gnl|CDD|119358 cd02879, GH18_plant_chitinase_class_V, The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|225862 COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|119349 cd00598, GH18_chitinase-like, The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods | Back alignment and domain information |
|---|
| >gnl|CDD|226376 COG3858, COG3858, Predicted glycosyl hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain | Back alignment and domain information |
|---|
| >gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 | Back alignment and domain information |
|---|
| >gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain | Back alignment and domain information |
|---|
| >gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain | Back alignment and domain information |
|---|
| >gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 | Back alignment and domain information |
|---|
| >gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >gnl|CDD|119357 cd02878, GH18_zymocin_alpha, Zymocin, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|216601 pfam01607, CBM_14, Chitin binding Peritrophin-A domain | Back alignment and domain information |
|---|
| >gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 | Back alignment and domain information |
|---|
| >gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
| >gnl|CDD|119353 cd02874, GH18_CFLE_spore_hydrolase, Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination | Back alignment and domain information |
|---|
| >gnl|CDD|119354 cd02875, GH18_chitobiase, Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes | Back alignment and domain information |
|---|
| >gnl|CDD|119362 cd06545, GH18_3CO4_chitinase, The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas | Back alignment and domain information |
|---|
| >gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >gnl|CDD|214696 smart00494, ChtBD2, Chitin-binding domain type 2 | Back alignment and domain information |
|---|
| >gnl|CDD|225862 COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|225862 COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster | Back alignment and domain information |
|---|
| >gnl|CDD|119349 cd00598, GH18_chitinase-like, The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods | Back alignment and domain information |
|---|
| >gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >gnl|CDD|119358 cd02879, GH18_plant_chitinase_class_V, The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|226376 COG3858, COG3858, Predicted glycosyl hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|119349 cd00598, GH18_chitinase-like, The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods | Back alignment and domain information |
|---|
| >gnl|CDD|119362 cd06545, GH18_3CO4_chitinase, The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas | Back alignment and domain information |
|---|
| >gnl|CDD|225862 COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster | Back alignment and domain information |
|---|
| >gnl|CDD|119358 cd02879, GH18_plant_chitinase_class_V, The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|119357 cd02878, GH18_zymocin_alpha, Zymocin, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|119350 cd02871, GH18_chitinase_D-like, GH18 domain of Chitinase D (ChiD) | Back alignment and domain information |
|---|
| >gnl|CDD|119353 cd02874, GH18_CFLE_spore_hydrolase, Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination | Back alignment and domain information |
|---|
| >gnl|CDD|119355 cd02876, GH18_SI-CLP, Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome | Back alignment and domain information |
|---|
| >gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster | Back alignment and domain information |
|---|
| >gnl|CDD|119363 cd06546, GH18_CTS3_chitinase, GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii | Back alignment and domain information |
|---|
| >gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain | Back alignment and domain information |
|---|
| >gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 | Back alignment and domain information |
|---|
| >gnl|CDD|119354 cd02875, GH18_chitobiase, Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes | Back alignment and domain information |
|---|
| >gnl|CDD|119361 cd06544, GH18_narbonin, Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 996 | |||
| cd02872 | 362 | GH18_chitolectin_chitotriosidase This conserved do | 100.0 | |
| cd02873 | 413 | GH18_IDGF The IDGF's (imaginal disc growth factors | 100.0 | |
| cd02878 | 345 | GH18_zymocin_alpha Zymocin, alpha subunit. Zymocin | 100.0 | |
| cd02879 | 299 | GH18_plant_chitinase_class_V The class V plant chi | 100.0 | |
| KOG2806|consensus | 432 | 100.0 | ||
| COG3325 | 441 | ChiA Chitinase [Carbohydrate transport and metabol | 100.0 | |
| smart00636 | 334 | Glyco_18 Glycosyl hydrolase family 18. | 100.0 | |
| cd06548 | 322 | GH18_chitinase The GH18 (glycosyl hydrolases, fami | 100.0 | |
| PF00704 | 343 | Glyco_hydro_18: Glycosyl hydrolases family 18; Int | 100.0 | |
| cd02876 | 318 | GH18_SI-CLP Stabilin-1 interacting chitinase-like | 100.0 | |
| cd02873 | 413 | GH18_IDGF The IDGF's (imaginal disc growth factors | 100.0 | |
| cd02875 | 358 | GH18_chitobiase Chitobiase (also known as di-N-ace | 100.0 | |
| cd02874 | 313 | GH18_CFLE_spore_hydrolase Cortical fragment-lytic | 100.0 | |
| cd02872 | 362 | GH18_chitolectin_chitotriosidase This conserved do | 100.0 | |
| cd06549 | 298 | GH18_trifunctional GH18 domain of an uncharacteriz | 100.0 | |
| cd06545 | 253 | GH18_3CO4_chitinase The Bacteroides thetaiotaomicr | 100.0 | |
| KOG2806|consensus | 432 | 100.0 | ||
| cd06548 | 322 | GH18_chitinase The GH18 (glycosyl hydrolases, fami | 100.0 | |
| COG3325 | 441 | ChiA Chitinase [Carbohydrate transport and metabol | 100.0 | |
| cd02878 | 345 | GH18_zymocin_alpha Zymocin, alpha subunit. Zymocin | 100.0 | |
| cd02879 | 299 | GH18_plant_chitinase_class_V The class V plant chi | 100.0 | |
| cd00598 | 210 | GH18_chitinase-like The GH18 (glycosyl hydrolase, | 100.0 | |
| smart00636 | 334 | Glyco_18 Glycosyl hydrolase family 18. | 100.0 | |
| cd06546 | 256 | GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase | 99.97 | |
| PF00704 | 343 | Glyco_hydro_18: Glycosyl hydrolases family 18; Int | 99.96 | |
| cd06544 | 253 | GH18_narbonin Narbonin is a plant 2S protein from | 99.96 | |
| cd02871 | 312 | GH18_chitinase_D-like GH18 domain of Chitinase D ( | 99.96 | |
| COG3858 | 423 | Predicted glycosyl hydrolase [General function pre | 99.95 | |
| cd02875 | 358 | GH18_chitobiase Chitobiase (also known as di-N-ace | 99.93 | |
| cd02876 | 318 | GH18_SI-CLP Stabilin-1 interacting chitinase-like | 99.93 | |
| cd06549 | 298 | GH18_trifunctional GH18 domain of an uncharacteriz | 99.9 | |
| cd02874 | 313 | GH18_CFLE_spore_hydrolase Cortical fragment-lytic | 99.9 | |
| cd06545 | 253 | GH18_3CO4_chitinase The Bacteroides thetaiotaomicr | 99.9 | |
| KOG2091|consensus | 392 | 99.87 | ||
| cd06542 | 255 | GH18_EndoS-like Endo-beta-N-acetylglucosaminidases | 99.85 | |
| cd02877 | 280 | GH18_hevamine_XipI_class_III This conserved domain | 99.79 | |
| COG3858 | 423 | Predicted glycosyl hydrolase [General function pre | 99.79 | |
| cd06543 | 294 | GH18_PF-ChiA-like PF-ChiA is an uncharacterized ch | 99.73 | |
| COG3469 | 332 | Chitinase [Carbohydrate transport and metabolism] | 99.69 | |
| cd06546 | 256 | GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase | 99.68 | |
| cd06544 | 253 | GH18_narbonin Narbonin is a plant 2S protein from | 99.64 | |
| cd00598 | 210 | GH18_chitinase-like The GH18 (glycosyl hydrolase, | 99.63 | |
| cd02871 | 312 | GH18_chitinase_D-like GH18 domain of Chitinase D ( | 99.55 | |
| cd06542 | 255 | GH18_EndoS-like Endo-beta-N-acetylglucosaminidases | 99.49 | |
| cd06543 | 294 | GH18_PF-ChiA-like PF-ChiA is an uncharacterized ch | 99.26 | |
| cd02877 | 280 | GH18_hevamine_XipI_class_III This conserved domain | 99.21 | |
| PF01607 | 53 | CBM_14: Chitin binding Peritrophin-A domain; Inter | 98.87 | |
| KOG2091|consensus | 392 | 98.84 | ||
| KOG4701|consensus | 568 | 98.77 | ||
| smart00494 | 56 | ChtBD2 Chitin-binding domain type 2. | 98.69 | |
| COG3469 | 332 | Chitinase [Carbohydrate transport and metabolism] | 97.99 | |
| cd06547 | 339 | GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENG | 97.89 | |
| cd06547 | 339 | GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENG | 97.6 | |
| PF03644 | 311 | Glyco_hydro_85: Glycosyl hydrolase family 85 ; Int | 97.29 | |
| PF02638 | 311 | DUF187: Glycosyl hydrolase like GH101; InterPro: I | 97.17 | |
| PF11340 | 181 | DUF3142: Protein of unknown function (DUF3142); In | 96.37 | |
| PF11340 | 181 | DUF3142: Protein of unknown function (DUF3142); In | 95.55 | |
| PF02638 | 311 | DUF187: Glycosyl hydrolase like GH101; InterPro: I | 95.34 | |
| PF13200 | 316 | DUF4015: Putative glycosyl hydrolase domain | 95.34 | |
| PF03644 | 311 | Glyco_hydro_85: Glycosyl hydrolase family 85 ; Int | 94.62 | |
| PF13200 | 316 | DUF4015: Putative glycosyl hydrolase domain | 93.72 | |
| KOG2331|consensus | 526 | 91.87 | ||
| PF14883 | 294 | GHL13: Hypothetical glycosyl hydrolase family 13 | 88.5 | |
| cd02810 | 289 | DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) | 82.16 |
| >cd02872 GH18_chitolectin_chitotriosidase This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-64 Score=580.16 Aligned_cols=344 Identities=56% Similarity=1.043 Sum_probs=314.8
Q ss_pred EEEEecccCCcCCCCCCCCCCCCCCCCCcEEEEEEEEeeCC-eeEeCCCcchhhhhHHHHHHHHHHhCCCceEEEEEcCC
Q psy13135 379 IFCYMTSWSQARPGAGKFGPENIDPKLCTHVIYAFGTLKDH-KLTLNEDKEKDEAGKFEALMQLREKNPDIKILLAIGGW 457 (996)
Q Consensus 379 vvcYy~~W~~~r~~~~~~~~~~i~~~~cTHIiyafa~v~~~-~~~~~~~~~~~~~~~~~~~~~lk~~np~lKvllSIGG~ 457 (996)
|||||++|+.+|++.+.|.+++|+.++||||+|+|+.++.+ ++...+...+...+.++++.+||++||++|||||||||
T Consensus 1 v~~y~~~w~~~~~~~~~~~~~~i~~~~~Thv~y~f~~i~~~g~~~~~~~~~d~~~~~~~~~~~lk~~~p~lkvlisiGG~ 80 (362)
T cd02872 1 VVCYFTNWAQYRPGNGKFVPENIDPFLCTHIIYAFAGLNPDGNIIILDEWNDIDLGLYERFNALKEKNPNLKTLLAIGGW 80 (362)
T ss_pred CEEEECcchhcCCCCCCcChhHCCcccCCEEEEeeEEECCCCCEEecCchhhhhhhHHHHHHHHHhhCCCceEEEEEcCC
Confidence 68999999999999899999999999999999999999864 45544443334677899999999999999999999999
Q ss_pred CCCCcchhhccCCHHHHHHHHHHHHHHHHhCCcceEEEeeeCCCC----ccCHHHHHHHHHHHHHHHHhhhcccCCCceE
Q psy13135 458 AFGSTPFKELTGNVFRMNQFVYESIEFLREHKFNGLDVDWEYPRG----ADDRASYVNLLKELRLAFEGEAKTSGEPRLL 533 (996)
Q Consensus 458 ~~~s~~fs~~~s~~~~r~~fi~siv~~l~~ygfDGIDIDwE~P~~----~~d~~~f~~llkeLr~~l~~~~~~~~~~~~~ 533 (996)
+.++..|+.++++++.|++||+++++++++|+|||||||||+|.. ++|+++|+.||++||++|++.+ ++++
T Consensus 81 ~~~~~~f~~~~~~~~~r~~fi~~iv~~l~~~~~DGidiDwE~p~~~~~~~~d~~~~~~ll~~lr~~l~~~~-----~~~~ 155 (362)
T cd02872 81 NFGSAKFSAMAASPENRKTFIKSAIAFLRKYGFDGLDLDWEYPGQRGGPPEDKENFVTLLKELREAFEPEA-----PRLL 155 (362)
T ss_pred CCCcchhHHHhCCHHHHHHHHHHHHHHHHHcCCCCeeeeeeccccCCCCHHHHHHHHHHHHHHHHHHHhhC-----cCeE
Confidence 977778999999999999999999999999999999999999974 4789999999999999998763 2589
Q ss_pred EEEeecCchhhhhcCCChhhhhccccEEEEeeccCCCCCCCCcCCCCCCCCCCCCccccccccHHHHHHHHHHcCCCCCC
Q psy13135 534 LTAAVPASFEAIAAGYDVPEISKYLDFINVMTYDFHGQWERQVGHNSPLKPLEGATSYQKKLTVEYSAKEWVKQGAPKEK 613 (996)
Q Consensus 534 Lsvavp~~~~~~~~~yd~~~l~~~vD~vnvMtYD~~g~w~~~~g~~sPL~~~~~~~~~~~~~~v~~~v~~~l~~Gvp~~K 613 (996)
||+++|+....+...||+++|.+++|+|+||+||+|++|...+||++||++...........+++.+|++|++.|+|++|
T Consensus 156 ls~av~~~~~~~~~~~d~~~l~~~vD~v~vmtYD~~~~~~~~~g~~spl~~~~~~~~~~~~~~v~~~v~~~~~~gvp~~K 235 (362)
T cd02872 156 LTAAVSAGKETIDAAYDIPEISKYLDFINVMTYDFHGSWEGVTGHNSPLYAGSADTGDQKYLNVDYAIKYWLSKGAPPEK 235 (362)
T ss_pred EEEEecCChHHHhhcCCHHHHhhhcceEEEecccCCCCCCCCCCCCCCCCCCCCCccccccccHHHHHHHHHHcCCCHHH
Confidence 99999998766666899999999999999999999999999999999999866544444567899999999999999999
Q ss_pred eeeccccceeeeEecCCCCCCCCCCCCCCCCCCcccccCcceeehhhhccccCCCceEEEcCCCCcceEeeCCeEEeecc
Q psy13135 614 LMIGMPTYGRSFTLVDPTKFDIGAPASGGGEPGKYTAEAGFMSYYEVCDFLKKDNTTLVWDNEQQVPFAYKDDQWVGFDD 693 (996)
Q Consensus 614 LvLGlp~YG~~~~l~~~~~~~~g~p~~g~g~~g~~t~~~G~lsy~ei~~~l~~~~~~~~wD~~~~~py~~~~~~wv~ydd 693 (996)
|+||||+|||.|++.++.+..+|+|+.|++.+|.++.+.|.++|.|||+.+ ..+++..||+.+++||+|++++||+|||
T Consensus 236 lvlGlp~YG~~~~~~~~~~~~~g~~~~g~~~~g~~~~~~g~~~y~ei~~~~-~~~~~~~~D~~~~~~y~~~~~~~v~ydd 314 (362)
T cd02872 236 LVLGIPTYGRSFTLASPSNTGVGAPASGPGTAGPYTREAGFLAYYEICEFL-KSGWTVVWDDEQKVPYAYKGNQWVGYDD 314 (362)
T ss_pred eEeccccccceeeecCCccCCCCCccCCCCCCCCCcCCCccchHHHHHHhh-cCCcEEEEeCCcceeEEEECCEEEEeCC
Confidence 999999999999999888888999999999999999999999999999988 7789999999999999999999999999
Q ss_pred cchhhhhchhhhhcCCcceeeeeccCCCCCCcccccccc
Q psy13135 694 ERSLKMKMDWLKEDGYGGIMIWSVDMDDLSTPFKELTGN 732 (996)
Q Consensus 694 ~~Sl~~K~~~~k~~~lgGi~vW~l~~Dd~sg~f~~lc~~ 732 (996)
++|++.|+++++++++||+++|++++||+.|. |+.
T Consensus 315 ~~Si~~K~~~~~~~~lgGv~iW~l~~DD~~g~----cg~ 349 (362)
T cd02872 315 EESIALKVQYLKSKGLGGAMVWSIDLDDFRGT----CGQ 349 (362)
T ss_pred HHHHHHHHHHHHhCCCceEEEEeeecCcCCCc----cCC
Confidence 99999999999999999999999999999998 986
|
The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the la |
| >cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster | Back alignment and domain information |
|---|
| >cd02878 GH18_zymocin_alpha Zymocin, alpha subunit | Back alignment and domain information |
|---|
| >cd02879 GH18_plant_chitinase_class_V The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes | Back alignment and domain information |
|---|
| >KOG2806|consensus | Back alignment and domain information |
|---|
| >COG3325 ChiA Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >smart00636 Glyco_18 Glycosyl hydrolase family 18 | Back alignment and domain information |
|---|
| >cd06548 GH18_chitinase The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >PF00704 Glyco_hydro_18: Glycosyl hydrolases family 18; InterPro: IPR001223 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >cd02876 GH18_SI-CLP Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome | Back alignment and domain information |
|---|
| >cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster | Back alignment and domain information |
|---|
| >cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes | Back alignment and domain information |
|---|
| >cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination | Back alignment and domain information |
|---|
| >cd02872 GH18_chitolectin_chitotriosidase This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
| >cd06549 GH18_trifunctional GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain | Back alignment and domain information |
|---|
| >cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas | Back alignment and domain information |
|---|
| >KOG2806|consensus | Back alignment and domain information |
|---|
| >cd06548 GH18_chitinase The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >COG3325 ChiA Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd02878 GH18_zymocin_alpha Zymocin, alpha subunit | Back alignment and domain information |
|---|
| >cd02879 GH18_plant_chitinase_class_V The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes | Back alignment and domain information |
|---|
| >cd00598 GH18_chitinase-like The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods | Back alignment and domain information |
|---|
| >smart00636 Glyco_18 Glycosyl hydrolase family 18 | Back alignment and domain information |
|---|
| >cd06546 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii | Back alignment and domain information |
|---|
| >PF00704 Glyco_hydro_18: Glycosyl hydrolases family 18; InterPro: IPR001223 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L | Back alignment and domain information |
|---|
| >cd02871 GH18_chitinase_D-like GH18 domain of Chitinase D (ChiD) | Back alignment and domain information |
|---|
| >COG3858 Predicted glycosyl hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes | Back alignment and domain information |
|---|
| >cd02876 GH18_SI-CLP Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome | Back alignment and domain information |
|---|
| >cd06549 GH18_trifunctional GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain | Back alignment and domain information |
|---|
| >cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination | Back alignment and domain information |
|---|
| >cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas | Back alignment and domain information |
|---|
| >KOG2091|consensus | Back alignment and domain information |
|---|
| >cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins | Back alignment and domain information |
|---|
| >cd02877 GH18_hevamine_XipI_class_III This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain | Back alignment and domain information |
|---|
| >COG3858 Predicted glycosyl hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >cd06543 GH18_PF-ChiA-like PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain | Back alignment and domain information |
|---|
| >COG3469 Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd06546 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii | Back alignment and domain information |
|---|
| >cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L | Back alignment and domain information |
|---|
| >cd00598 GH18_chitinase-like The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods | Back alignment and domain information |
|---|
| >cd02871 GH18_chitinase_D-like GH18 domain of Chitinase D (ChiD) | Back alignment and domain information |
|---|
| >cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins | Back alignment and domain information |
|---|
| >cd06543 GH18_PF-ChiA-like PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain | Back alignment and domain information |
|---|
| >cd02877 GH18_hevamine_XipI_class_III This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain | Back alignment and domain information |
|---|
| >PF01607 CBM_14: Chitin binding Peritrophin-A domain; InterPro: IPR002557 This entry represents a chitin binding domain [] | Back alignment and domain information |
|---|
| >KOG2091|consensus | Back alignment and domain information |
|---|
| >KOG4701|consensus | Back alignment and domain information |
|---|
| >smart00494 ChtBD2 Chitin-binding domain type 2 | Back alignment and domain information |
|---|
| >COG3469 Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd06547 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins | Back alignment and domain information |
|---|
| >cd06547 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins | Back alignment and domain information |
|---|
| >PF03644 Glyco_hydro_85: Glycosyl hydrolase family 85 ; InterPro: IPR005201 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >PF11340 DUF3142: Protein of unknown function (DUF3142); InterPro: IPR021488 This bacterial family of proteins has no known function | Back alignment and domain information |
|---|
| >PF11340 DUF3142: Protein of unknown function (DUF3142); InterPro: IPR021488 This bacterial family of proteins has no known function | Back alignment and domain information |
|---|
| >PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >PF13200 DUF4015: Putative glycosyl hydrolase domain | Back alignment and domain information |
|---|
| >PF03644 Glyco_hydro_85: Glycosyl hydrolase family 85 ; InterPro: IPR005201 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF13200 DUF4015: Putative glycosyl hydrolase domain | Back alignment and domain information |
|---|
| >KOG2331|consensus | Back alignment and domain information |
|---|
| >PF14883 GHL13: Hypothetical glycosyl hydrolase family 13 | Back alignment and domain information |
|---|
| >cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 996 | ||||
| 1hki_A | 365 | Crystal Structure Of Human Chitinase In Complex Wit | 1e-92 | ||
| 1hki_A | 365 | Crystal Structure Of Human Chitinase In Complex Wit | 1e-28 | ||
| 1hki_A | 365 | Crystal Structure Of Human Chitinase In Complex Wit | 2e-13 | ||
| 1hkk_A | 364 | High Resoultion Crystal Structure Of Human Chitinas | 1e-92 | ||
| 1hkk_A | 364 | High Resoultion Crystal Structure Of Human Chitinas | 1e-28 | ||
| 1hkk_A | 364 | High Resoultion Crystal Structure Of Human Chitinas | 2e-13 | ||
| 1lg1_A | 365 | Crystal Structure Of Human Chitotriosidase In Compl | 1e-92 | ||
| 1lg1_A | 365 | Crystal Structure Of Human Chitotriosidase In Compl | 1e-28 | ||
| 1lg1_A | 365 | Crystal Structure Of Human Chitotriosidase In Compl | 2e-13 | ||
| 1guv_A | 366 | Structure Of Human Chitotriosidase Length = 366 | 2e-92 | ||
| 1guv_A | 366 | Structure Of Human Chitotriosidase Length = 366 | 1e-28 | ||
| 1guv_A | 366 | Structure Of Human Chitotriosidase Length = 366 | 2e-13 | ||
| 3fxy_A | 395 | Acidic Mammalian Chinase, Catalytic Domain Length = | 2e-92 | ||
| 3fxy_A | 395 | Acidic Mammalian Chinase, Catalytic Domain Length = | 3e-28 | ||
| 3fxy_A | 395 | Acidic Mammalian Chinase, Catalytic Domain Length = | 9e-12 | ||
| 2ybt_A | 381 | Crystal Structure Of Human Acidic Chitinase In Comp | 3e-92 | ||
| 2ybt_A | 381 | Crystal Structure Of Human Acidic Chitinase In Comp | 3e-28 | ||
| 2ybt_A | 381 | Crystal Structure Of Human Acidic Chitinase In Comp | 8e-12 | ||
| 1waw_A | 445 | Specificity And Affinity Of Natural Product Cyclope | 4e-92 | ||
| 1waw_A | 445 | Specificity And Affinity Of Natural Product Cyclope | 2e-28 | ||
| 1waw_A | 445 | Specificity And Affinity Of Natural Product Cyclope | 3e-13 | ||
| 1e9l_A | 377 | The Crystal Structure Of Novel Mammalian Lectin Ym1 | 6e-85 | ||
| 1e9l_A | 377 | The Crystal Structure Of Novel Mammalian Lectin Ym1 | 6e-21 | ||
| 1e9l_A | 377 | The Crystal Structure Of Novel Mammalian Lectin Ym1 | 2e-06 | ||
| 4ay1_A | 365 | Human Ykl-39 Is A Pseudo-Chitinase With Retained Ch | 4e-82 | ||
| 4ay1_A | 365 | Human Ykl-39 Is A Pseudo-Chitinase With Retained Ch | 3e-20 | ||
| 4ay1_A | 365 | Human Ykl-39 Is A Pseudo-Chitinase With Retained Ch | 4e-09 | ||
| 1zbv_A | 361 | Crystal Structure Of The Goat Signalling Protein (S | 8e-80 | ||
| 1zbv_A | 361 | Crystal Structure Of The Goat Signalling Protein (S | 5e-23 | ||
| 1zbv_A | 361 | Crystal Structure Of The Goat Signalling Protein (S | 3e-12 | ||
| 1xhg_A | 361 | Crystal Structure Of A 40 Kda Signalling Protein Fr | 3e-79 | ||
| 1xhg_A | 361 | Crystal Structure Of A 40 Kda Signalling Protein Fr | 2e-22 | ||
| 1xhg_A | 361 | Crystal Structure Of A 40 Kda Signalling Protein Fr | 2e-12 | ||
| 1owq_A | 361 | Crystal Structure Of A 40 Kda Signalling Protein (S | 3e-79 | ||
| 1owq_A | 361 | Crystal Structure Of A 40 Kda Signalling Protein (S | 1e-22 | ||
| 1owq_A | 361 | Crystal Structure Of A 40 Kda Signalling Protein (S | 9e-13 | ||
| 1syt_A | 361 | Crystal Structure Of Signalling Protein From Goat S | 5e-79 | ||
| 1syt_A | 361 | Crystal Structure Of Signalling Protein From Goat S | 5e-23 | ||
| 1syt_A | 361 | Crystal Structure Of Signalling Protein From Goat S | 3e-12 | ||
| 2pi6_A | 361 | Crystal Structure Of The Sheep Signalling Glycoprot | 6e-79 | ||
| 2pi6_A | 361 | Crystal Structure Of The Sheep Signalling Glycoprot | 3e-22 | ||
| 2pi6_A | 361 | Crystal Structure Of The Sheep Signalling Glycoprot | 2e-12 | ||
| 1sr0_A | 361 | Crystal Structure Of Signalling Protein From Sheep( | 1e-78 | ||
| 1sr0_A | 361 | Crystal Structure Of Signalling Protein From Sheep( | 4e-22 | ||
| 1sr0_A | 361 | Crystal Structure Of Signalling Protein From Sheep( | 2e-12 | ||
| 1ljy_A | 361 | Crystal Structure Of A Novel Regulatory 40 Kda Mamm | 1e-78 | ||
| 1ljy_A | 361 | Crystal Structure Of A Novel Regulatory 40 Kda Mamm | 8e-23 | ||
| 1ljy_A | 361 | Crystal Structure Of A Novel Regulatory 40 Kda Mamm | 3e-12 | ||
| 2esc_A | 361 | Crystal Structure Of A 40 Kda Protective Signalling | 2e-77 | ||
| 2esc_A | 361 | Crystal Structure Of A 40 Kda Protective Signalling | 9e-22 | ||
| 2esc_A | 361 | Crystal Structure Of A 40 Kda Protective Signalling | 7e-12 | ||
| 1tfv_A | 361 | Crystal Structure Of A Buffalo Signaling Glycoprote | 2e-77 | ||
| 1tfv_A | 361 | Crystal Structure Of A Buffalo Signaling Glycoprote | 8e-22 | ||
| 1tfv_A | 361 | Crystal Structure Of A Buffalo Signaling Glycoprote | 2e-12 | ||
| 1hjv_A | 362 | Crystal Structure Of Hcgp-39 In Complex With Chitin | 4e-77 | ||
| 1hjv_A | 362 | Crystal Structure Of Hcgp-39 In Complex With Chitin | 4e-22 | ||
| 1hjv_A | 362 | Crystal Structure Of Hcgp-39 In Complex With Chitin | 2e-10 | ||
| 3aqu_A | 356 | Crystal Structure Of A Class V Chitinase From Arabi | 2e-42 | ||
| 3aqu_A | 356 | Crystal Structure Of A Class V Chitinase From Arabi | 8e-19 | ||
| 3alf_A | 353 | Crystal Structure Of Class V Chitinase From Nicotia | 7e-40 | ||
| 3alf_A | 353 | Crystal Structure Of Class V Chitinase From Nicotia | 2e-16 | ||
| 3alg_A | 353 | Crystal Structure Of Class V Chitinase (E115q Mutan | 1e-39 | ||
| 3alg_A | 353 | Crystal Structure Of Class V Chitinase (E115q Mutan | 5e-16 | ||
| 1itx_A | 419 | Catalytic Domain Of Chitinase A1 From Bacillus Circ | 8e-38 | ||
| 1itx_A | 419 | Catalytic Domain Of Chitinase A1 From Bacillus Circ | 2e-17 | ||
| 3g6l_A | 406 | The Crystal Structure Of A Chitinase Crchi1 From Th | 2e-29 | ||
| 3g6l_A | 406 | The Crystal Structure Of A Chitinase Crchi1 From Th | 9e-16 | ||
| 1rd6_A | 563 | Crystal Structure Of S. Marcescens Chitinase A Muta | 3e-28 | ||
| 1rd6_A | 563 | Crystal Structure Of S. Marcescens Chitinase A Muta | 9e-10 | ||
| 1d2k_A | 392 | C. Immitis Chitinase 1 At 2.2 Angstroms Resolution | 4e-28 | ||
| 1d2k_A | 392 | C. Immitis Chitinase 1 At 2.2 Angstroms Resolution | 3e-15 | ||
| 2wly_A | 548 | Chitinase A From Serratia Marcescens Atcc990 In Com | 4e-28 | ||
| 2wly_A | 548 | Chitinase A From Serratia Marcescens Atcc990 In Com | 7e-10 | ||
| 2wk2_A | 540 | Chitinase A From Serratia Marcescens Atcc990 In Com | 4e-28 | ||
| 2wk2_A | 540 | Chitinase A From Serratia Marcescens Atcc990 In Com | 7e-10 | ||
| 1ctn_A | 540 | Crystal Structure Of A Bacterial Chitinase At 2.3 A | 6e-28 | ||
| 1ctn_A | 540 | Crystal Structure Of A Bacterial Chitinase At 2.3 A | 1e-09 | ||
| 3b8s_A | 584 | Crystal Structure Of Wild-Type Chitinase A From Vib | 8e-28 | ||
| 3b8s_A | 584 | Crystal Structure Of Wild-Type Chitinase A From Vib | 2e-10 | ||
| 1ll7_A | 392 | Structure Of The E171q Mutant Of C. Immitis Chitina | 8e-28 | ||
| 1ll7_A | 392 | Structure Of The E171q Mutant Of C. Immitis Chitina | 7e-15 | ||
| 1edq_A | 540 | Crystal Structure Of Chitinase A From S. Marcescens | 9e-28 | ||
| 1edq_A | 540 | Crystal Structure Of Chitinase A From S. Marcescens | 2e-09 | ||
| 1ll6_A | 392 | Structure Of The D169n Mutant Of C. Immitis Chitina | 1e-27 | ||
| 1ll6_A | 392 | Structure Of The D169n Mutant Of C. Immitis Chitina | 1e-14 | ||
| 1ehn_A | 540 | Crystal Structure Of Chitinase A Mutant E315q Compl | 2e-27 | ||
| 1ehn_A | 540 | Crystal Structure Of Chitinase A Mutant E315q Compl | 3e-09 | ||
| 1ffr_A | 540 | Crystal Structure Of Chitinase A Mutant Y390f Compl | 2e-27 | ||
| 1ffr_A | 540 | Crystal Structure Of Chitinase A Mutant Y390f Compl | 4e-09 | ||
| 3b9a_A | 584 | Crystal Structure Of Vibrio Harveyi Chitinase A Com | 4e-27 | ||
| 3b9a_A | 584 | Crystal Structure Of Vibrio Harveyi Chitinase A Com | 9e-10 | ||
| 1nh6_A | 540 | Structure Of S. Marcescens Chitinase A, E315l, Comp | 5e-27 | ||
| 1nh6_A | 540 | Structure Of S. Marcescens Chitinase A, E315l, Comp | 1e-08 | ||
| 1eib_A | 540 | Crystal Structure Of Chitinase A Mutant D313a Compl | 6e-27 | ||
| 1eib_A | 540 | Crystal Structure Of Chitinase A Mutant D313a Compl | 1e-08 | ||
| 1k9t_A | 540 | Chitinase A Complexed With Tetra-N-Acetylchitotrios | 6e-27 | ||
| 1k9t_A | 540 | Chitinase A Complexed With Tetra-N-Acetylchitotrios | 1e-08 | ||
| 3ars_A | 584 | Crystal Structure Analysis Of Chitinase A From Vibr | 2e-26 | ||
| 3ars_A | 584 | Crystal Structure Analysis Of Chitinase A From Vibr | 7e-11 | ||
| 1w9p_A | 433 | Specificity And Affinity Of Natural Product Cyclope | 3e-26 | ||
| 1w9p_A | 433 | Specificity And Affinity Of Natural Product Cyclope | 2e-13 | ||
| 1wno_A | 395 | Crystal Structure Of A Native Chitinase From Asperg | 8e-26 | ||
| 1wno_A | 395 | Crystal Structure Of A Native Chitinase From Asperg | 3e-13 | ||
| 1h0g_A | 499 | Complex Of A Chitinase With The Natural Product Cyc | 2e-24 | ||
| 1h0g_A | 499 | Complex Of A Chitinase With The Natural Product Cyc | 3e-10 | ||
| 1kfw_A | 435 | Structure Of Catalytic Domain Of Psychrophilic Chit | 2e-24 | ||
| 1kfw_A | 435 | Structure Of Catalytic Domain Of Psychrophilic Chit | 2e-08 | ||
| 1e15_A | 499 | Chitinase B From Serratia Marcescens Length = 499 | 3e-24 | ||
| 1e15_A | 499 | Chitinase B From Serratia Marcescens Length = 499 | 3e-10 | ||
| 1e6z_A | 498 | Chitinase B From Serratia Marcescens Wildtype In Co | 3e-24 | ||
| 1e6z_A | 498 | Chitinase B From Serratia Marcescens Wildtype In Co | 3e-10 | ||
| 1e6n_B | 499 | Chitinase B From Serratia Marcescens Inactive Mutan | 5e-24 | ||
| 1e6n_B | 499 | Chitinase B From Serratia Marcescens Inactive Mutan | 5e-10 | ||
| 1ur9_A | 499 | Interactions Of A Family 18 Chitinase With The Desi | 8e-24 | ||
| 1ur9_A | 499 | Interactions Of A Family 18 Chitinase With The Desi | 9e-10 | ||
| 1ogb_A | 499 | Chitinase B From Serratia Marcescens Mutant D142n L | 8e-24 | ||
| 1ogb_A | 499 | Chitinase B From Serratia Marcescens Mutant D142n L | 8e-10 | ||
| 1goi_A | 499 | Crystal Structure Of The D140n Mutant Of Chitinase | 8e-24 | ||
| 1goi_A | 499 | Crystal Structure Of The D140n Mutant Of Chitinase | 8e-10 | ||
| 1jnd_A | 420 | Crystal Structure Of Imaginal Disc Growth Factor-2 | 2e-22 | ||
| 3qok_A | 420 | Crystal Structure Of Putative Chitinase Ii From Kle | 6e-20 | ||
| 3qok_A | 420 | Crystal Structure Of Putative Chitinase Ii From Kle | 5e-06 | ||
| 4dws_C | 546 | Crystal Structure Of A Chitinase From The Yersinia | 2e-16 | ||
| 4dws_C | 546 | Crystal Structure Of A Chitinase From The Yersinia | 2e-06 | ||
| 4dws_A | 546 | Crystal Structure Of A Chitinase From The Yersinia | 2e-16 | ||
| 4dws_A | 546 | Crystal Structure Of A Chitinase From The Yersinia | 1e-06 | ||
| 4dws_D | 546 | Crystal Structure Of A Chitinase From The Yersinia | 2e-16 | ||
| 4dws_D | 546 | Crystal Structure Of A Chitinase From The Yersinia | 1e-06 | ||
| 4dws_B | 546 | Crystal Structure Of A Chitinase From The Yersinia | 6e-16 | ||
| 4dws_B | 546 | Crystal Structure Of A Chitinase From The Yersinia | 5e-06 | ||
| 4a5q_A | 546 | Crystal Structure Of The Chitinase Chi1 Fitted Into | 1e-12 | ||
| 4a5q_A | 546 | Crystal Structure Of The Chitinase Chi1 Fitted Into | 6e-04 | ||
| 3oa5_A | 574 | The Structure Of Chi1, A Chitinase From Yersinia En | 1e-12 | ||
| 3oa5_A | 574 | The Structure Of Chi1, A Chitinase From Yersinia En | 8e-04 | ||
| 3cz8_A | 319 | Crystal Structure Of Putative Sporulation-Specific | 7e-05 | ||
| 3co4_A | 312 | Crystal Structure Of A Chitinase From Bacteroides T | 7e-04 |
| >pdb|1HKI|A Chain A, Crystal Structure Of Human Chitinase In Complex With Glucoallosamidin B Length = 365 | Back alignment and structure |
|
| >pdb|1HKI|A Chain A, Crystal Structure Of Human Chitinase In Complex With Glucoallosamidin B Length = 365 | Back alignment and structure |
| >pdb|1HKI|A Chain A, Crystal Structure Of Human Chitinase In Complex With Glucoallosamidin B Length = 365 | Back alignment and structure |
| >pdb|1HKK|A Chain A, High Resoultion Crystal Structure Of Human Chitinase In Complex With Allosamidin Length = 364 | Back alignment and structure |
| >pdb|1HKK|A Chain A, High Resoultion Crystal Structure Of Human Chitinase In Complex With Allosamidin Length = 364 | Back alignment and structure |
| >pdb|1HKK|A Chain A, High Resoultion Crystal Structure Of Human Chitinase In Complex With Allosamidin Length = 364 | Back alignment and structure |
| >pdb|1LG1|A Chain A, Crystal Structure Of Human Chitotriosidase In Complex With Chitobiose Length = 365 | Back alignment and structure |
| >pdb|1LG1|A Chain A, Crystal Structure Of Human Chitotriosidase In Complex With Chitobiose Length = 365 | Back alignment and structure |
| >pdb|1LG1|A Chain A, Crystal Structure Of Human Chitotriosidase In Complex With Chitobiose Length = 365 | Back alignment and structure |
| >pdb|1GUV|A Chain A, Structure Of Human Chitotriosidase Length = 366 | Back alignment and structure |
| >pdb|1GUV|A Chain A, Structure Of Human Chitotriosidase Length = 366 | Back alignment and structure |
| >pdb|1GUV|A Chain A, Structure Of Human Chitotriosidase Length = 366 | Back alignment and structure |
| >pdb|3FXY|A Chain A, Acidic Mammalian Chinase, Catalytic Domain Length = 395 | Back alignment and structure |
| >pdb|3FXY|A Chain A, Acidic Mammalian Chinase, Catalytic Domain Length = 395 | Back alignment and structure |
| >pdb|3FXY|A Chain A, Acidic Mammalian Chinase, Catalytic Domain Length = 395 | Back alignment and structure |
| >pdb|2YBT|A Chain A, Crystal Structure Of Human Acidic Chitinase In Complex With Bisdionin C Length = 381 | Back alignment and structure |
| >pdb|2YBT|A Chain A, Crystal Structure Of Human Acidic Chitinase In Complex With Bisdionin C Length = 381 | Back alignment and structure |
| >pdb|2YBT|A Chain A, Crystal Structure Of Human Acidic Chitinase In Complex With Bisdionin C Length = 381 | Back alignment and structure |
| >pdb|1WAW|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitor Argadin Against Human Chitinase Length = 445 | Back alignment and structure |
| >pdb|1WAW|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitor Argadin Against Human Chitinase Length = 445 | Back alignment and structure |
| >pdb|1WAW|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitor Argadin Against Human Chitinase Length = 445 | Back alignment and structure |
| >pdb|1E9L|A Chain A, The Crystal Structure Of Novel Mammalian Lectin Ym1 Suggests A Saccharide Binding Site Length = 377 | Back alignment and structure |
| >pdb|1E9L|A Chain A, The Crystal Structure Of Novel Mammalian Lectin Ym1 Suggests A Saccharide Binding Site Length = 377 | Back alignment and structure |
| >pdb|1E9L|A Chain A, The Crystal Structure Of Novel Mammalian Lectin Ym1 Suggests A Saccharide Binding Site Length = 377 | Back alignment and structure |
| >pdb|4AY1|A Chain A, Human Ykl-39 Is A Pseudo-Chitinase With Retained Chitooligosaccharide Binding Properties Length = 365 | Back alignment and structure |
| >pdb|4AY1|A Chain A, Human Ykl-39 Is A Pseudo-Chitinase With Retained Chitooligosaccharide Binding Properties Length = 365 | Back alignment and structure |
| >pdb|4AY1|A Chain A, Human Ykl-39 Is A Pseudo-Chitinase With Retained Chitooligosaccharide Binding Properties Length = 365 | Back alignment and structure |
| >pdb|1ZBV|A Chain A, Crystal Structure Of The Goat Signalling Protein (Spg-40) Complexed With A Designed Peptide Trp-Pro-Trp At 3.2a Resolution Length = 361 | Back alignment and structure |
| >pdb|1ZBV|A Chain A, Crystal Structure Of The Goat Signalling Protein (Spg-40) Complexed With A Designed Peptide Trp-Pro-Trp At 3.2a Resolution Length = 361 | Back alignment and structure |
| >pdb|1ZBV|A Chain A, Crystal Structure Of The Goat Signalling Protein (Spg-40) Complexed With A Designed Peptide Trp-Pro-Trp At 3.2a Resolution Length = 361 | Back alignment and structure |
| >pdb|1XHG|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein From Porcine (spp-40) At 2.89a Resolution Length = 361 | Back alignment and structure |
| >pdb|1XHG|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein From Porcine (spp-40) At 2.89a Resolution Length = 361 | Back alignment and structure |
| >pdb|1XHG|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein From Porcine (spp-40) At 2.89a Resolution Length = 361 | Back alignment and structure |
| >pdb|1OWQ|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein (Spc-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1OWQ|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein (Spc-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1OWQ|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein (Spc-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1SYT|A Chain A, Crystal Structure Of Signalling Protein From Goat Spg-40 In The Presense Of N,n',n''-triacetyl-chitotriose At 2.6a Resolution Length = 361 | Back alignment and structure |
| >pdb|1SYT|A Chain A, Crystal Structure Of Signalling Protein From Goat Spg-40 In The Presense Of N,n',n''-triacetyl-chitotriose At 2.6a Resolution Length = 361 | Back alignment and structure |
| >pdb|1SYT|A Chain A, Crystal Structure Of Signalling Protein From Goat Spg-40 In The Presense Of N,n',n''-triacetyl-chitotriose At 2.6a Resolution Length = 361 | Back alignment and structure |
| >pdb|2PI6|A Chain A, Crystal Structure Of The Sheep Signalling Glycoprotein (Sps-40) Complex With 2-Methyl-2-4-Pentanediol At 1.65a Resolution Reveals Specific Binding Characteristics Of Sps-40 Length = 361 | Back alignment and structure |
| >pdb|2PI6|A Chain A, Crystal Structure Of The Sheep Signalling Glycoprotein (Sps-40) Complex With 2-Methyl-2-4-Pentanediol At 1.65a Resolution Reveals Specific Binding Characteristics Of Sps-40 Length = 361 | Back alignment and structure |
| >pdb|2PI6|A Chain A, Crystal Structure Of The Sheep Signalling Glycoprotein (Sps-40) Complex With 2-Methyl-2-4-Pentanediol At 1.65a Resolution Reveals Specific Binding Characteristics Of Sps-40 Length = 361 | Back alignment and structure |
| >pdb|1SR0|A Chain A, Crystal Structure Of Signalling Protein From Sheep(Sps-40) At 3.0a Resolution Using Crystal Grown In The Presence Of Polysaccharides Length = 361 | Back alignment and structure |
| >pdb|1SR0|A Chain A, Crystal Structure Of Signalling Protein From Sheep(Sps-40) At 3.0a Resolution Using Crystal Grown In The Presence Of Polysaccharides Length = 361 | Back alignment and structure |
| >pdb|1SR0|A Chain A, Crystal Structure Of Signalling Protein From Sheep(Sps-40) At 3.0a Resolution Using Crystal Grown In The Presence Of Polysaccharides Length = 361 | Back alignment and structure |
| >pdb|1LJY|A Chain A, Crystal Structure Of A Novel Regulatory 40 Kda Mammary Gland Protein (Mgp-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1LJY|A Chain A, Crystal Structure Of A Novel Regulatory 40 Kda Mammary Gland Protein (Mgp-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1LJY|A Chain A, Crystal Structure Of A Novel Regulatory 40 Kda Mammary Gland Protein (Mgp-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|2ESC|A Chain A, Crystal Structure Of A 40 Kda Protective Signalling Protein From Bovine (Spc-40) At 2.1 A Resolution Length = 361 | Back alignment and structure |
| >pdb|2ESC|A Chain A, Crystal Structure Of A 40 Kda Protective Signalling Protein From Bovine (Spc-40) At 2.1 A Resolution Length = 361 | Back alignment and structure |
| >pdb|2ESC|A Chain A, Crystal Structure Of A 40 Kda Protective Signalling Protein From Bovine (Spc-40) At 2.1 A Resolution Length = 361 | Back alignment and structure |
| >pdb|1TFV|A Chain A, Crystal Structure Of A Buffalo Signaling Glycoprotein (Spb-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1TFV|A Chain A, Crystal Structure Of A Buffalo Signaling Glycoprotein (Spb-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1TFV|A Chain A, Crystal Structure Of A Buffalo Signaling Glycoprotein (Spb-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1HJV|A Chain A, Crystal Structure Of Hcgp-39 In Complex With Chitin Tetramer Length = 362 | Back alignment and structure |
| >pdb|1HJV|A Chain A, Crystal Structure Of Hcgp-39 In Complex With Chitin Tetramer Length = 362 | Back alignment and structure |
| >pdb|1HJV|A Chain A, Crystal Structure Of Hcgp-39 In Complex With Chitin Tetramer Length = 362 | Back alignment and structure |
| >pdb|3AQU|A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana Length = 356 | Back alignment and structure |
| >pdb|3AQU|A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana Length = 356 | Back alignment and structure |
| >pdb|3ALF|A Chain A, Crystal Structure Of Class V Chitinase From Nicotiana Tobaccum Length = 353 | Back alignment and structure |
| >pdb|3ALF|A Chain A, Crystal Structure Of Class V Chitinase From Nicotiana Tobaccum Length = 353 | Back alignment and structure |
| >pdb|3ALG|A Chain A, Crystal Structure Of Class V Chitinase (E115q Mutant) From Nicotiana Tobaccum In Complex With Nag4 Length = 353 | Back alignment and structure |
| >pdb|3ALG|A Chain A, Crystal Structure Of Class V Chitinase (E115q Mutant) From Nicotiana Tobaccum In Complex With Nag4 Length = 353 | Back alignment and structure |
| >pdb|1ITX|A Chain A, Catalytic Domain Of Chitinase A1 From Bacillus Circulans Wl-12 Length = 419 | Back alignment and structure |
| >pdb|1ITX|A Chain A, Catalytic Domain Of Chitinase A1 From Bacillus Circulans Wl-12 Length = 419 | Back alignment and structure |
| >pdb|3G6L|A Chain A, The Crystal Structure Of A Chitinase Crchi1 From The Nematophagous Fungus Clonostachys Rosea Length = 406 | Back alignment and structure |
| >pdb|3G6L|A Chain A, The Crystal Structure Of A Chitinase Crchi1 From The Nematophagous Fungus Clonostachys Rosea Length = 406 | Back alignment and structure |
| >pdb|1RD6|A Chain A, Crystal Structure Of S. Marcescens Chitinase A Mutant W167a Length = 563 | Back alignment and structure |
| >pdb|1RD6|A Chain A, Crystal Structure Of S. Marcescens Chitinase A Mutant W167a Length = 563 | Back alignment and structure |
| >pdb|1D2K|A Chain A, C. Immitis Chitinase 1 At 2.2 Angstroms Resolution Length = 392 | Back alignment and structure |
| >pdb|1D2K|A Chain A, C. Immitis Chitinase 1 At 2.2 Angstroms Resolution Length = 392 | Back alignment and structure |
| >pdb|2WLY|A Chain A, Chitinase A From Serratia Marcescens Atcc990 In Complex With Chitotrio-Thiazoline. Length = 548 | Back alignment and structure |
| >pdb|2WLY|A Chain A, Chitinase A From Serratia Marcescens Atcc990 In Complex With Chitotrio-Thiazoline. Length = 548 | Back alignment and structure |
| >pdb|2WK2|A Chain A, Chitinase A From Serratia Marcescens Atcc990 In Complex With Chitotrio-Thiazoline Dithioamide Length = 540 | Back alignment and structure |
| >pdb|2WK2|A Chain A, Chitinase A From Serratia Marcescens Atcc990 In Complex With Chitotrio-Thiazoline Dithioamide Length = 540 | Back alignment and structure |
| >pdb|1CTN|A Chain A, Crystal Structure Of A Bacterial Chitinase At 2.3 Angstroms Resolution Length = 540 | Back alignment and structure |
| >pdb|1CTN|A Chain A, Crystal Structure Of A Bacterial Chitinase At 2.3 Angstroms Resolution Length = 540 | Back alignment and structure |
| >pdb|3B8S|A Chain A, Crystal Structure Of Wild-Type Chitinase A From Vibrio Harveyi Length = 584 | Back alignment and structure |
| >pdb|3B8S|A Chain A, Crystal Structure Of Wild-Type Chitinase A From Vibrio Harveyi Length = 584 | Back alignment and structure |
| >pdb|1LL7|A Chain A, Structure Of The E171q Mutant Of C. Immitis Chitinase 1 Length = 392 | Back alignment and structure |
| >pdb|1LL7|A Chain A, Structure Of The E171q Mutant Of C. Immitis Chitinase 1 Length = 392 | Back alignment and structure |
| >pdb|1EDQ|A Chain A, Crystal Structure Of Chitinase A From S. Marcescens At 1.55 Angstroms Length = 540 | Back alignment and structure |
| >pdb|1EDQ|A Chain A, Crystal Structure Of Chitinase A From S. Marcescens At 1.55 Angstroms Length = 540 | Back alignment and structure |
| >pdb|1LL6|A Chain A, Structure Of The D169n Mutant Of C. Immitis Chitinase 1 Length = 392 | Back alignment and structure |
| >pdb|1LL6|A Chain A, Structure Of The D169n Mutant Of C. Immitis Chitinase 1 Length = 392 | Back alignment and structure |
| >pdb|1EHN|A Chain A, Crystal Structure Of Chitinase A Mutant E315q Complexed With Octa-N- Acetylchitooctaose (Nag)8 Length = 540 | Back alignment and structure |
| >pdb|1EHN|A Chain A, Crystal Structure Of Chitinase A Mutant E315q Complexed With Octa-N- Acetylchitooctaose (Nag)8 Length = 540 | Back alignment and structure |
| >pdb|1FFR|A Chain A, Crystal Structure Of Chitinase A Mutant Y390f Complexed With Hexa-n- Acetylchitohexaose (nag)6 Length = 540 | Back alignment and structure |
| >pdb|1FFR|A Chain A, Crystal Structure Of Chitinase A Mutant Y390f Complexed With Hexa-n- Acetylchitohexaose (nag)6 Length = 540 | Back alignment and structure |
| >pdb|3B9A|A Chain A, Crystal Structure Of Vibrio Harveyi Chitinase A Complexed With Hexasaccharide Length = 584 | Back alignment and structure |
| >pdb|3B9A|A Chain A, Crystal Structure Of Vibrio Harveyi Chitinase A Complexed With Hexasaccharide Length = 584 | Back alignment and structure |
| >pdb|1NH6|A Chain A, Structure Of S. Marcescens Chitinase A, E315l, Complex With Hexasaccharide Length = 540 | Back alignment and structure |
| >pdb|1NH6|A Chain A, Structure Of S. Marcescens Chitinase A, E315l, Complex With Hexasaccharide Length = 540 | Back alignment and structure |
| >pdb|1EIB|A Chain A, Crystal Structure Of Chitinase A Mutant D313a Complexed With Octa-N- Acetylchitooctaose (Nag)8 Length = 540 | Back alignment and structure |
| >pdb|1EIB|A Chain A, Crystal Structure Of Chitinase A Mutant D313a Complexed With Octa-N- Acetylchitooctaose (Nag)8 Length = 540 | Back alignment and structure |
| >pdb|1K9T|A Chain A, Chitinase A Complexed With Tetra-N-Acetylchitotriose Length = 540 | Back alignment and structure |
| >pdb|1K9T|A Chain A, Chitinase A Complexed With Tetra-N-Acetylchitotriose Length = 540 | Back alignment and structure |
| >pdb|3ARS|A Chain A, Crystal Structure Analysis Of Chitinase A From Vibrio Harveyi With Novel Inhibitors - Apo Structure Of Mutant W275g Length = 584 | Back alignment and structure |
| >pdb|3ARS|A Chain A, Crystal Structure Analysis Of Chitinase A From Vibrio Harveyi With Novel Inhibitors - Apo Structure Of Mutant W275g Length = 584 | Back alignment and structure |
| >pdb|1W9P|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitors Against Aspergillus Fumigatus, Human And Bacterial Chitinasefra Length = 433 | Back alignment and structure |
| >pdb|1W9P|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitors Against Aspergillus Fumigatus, Human And Bacterial Chitinasefra Length = 433 | Back alignment and structure |
| >pdb|1WNO|A Chain A, Crystal Structure Of A Native Chitinase From Aspergillus Fumigatus Yj- 407 Length = 395 | Back alignment and structure |
| >pdb|1WNO|A Chain A, Crystal Structure Of A Native Chitinase From Aspergillus Fumigatus Yj- 407 Length = 395 | Back alignment and structure |
| >pdb|1H0G|A Chain A, Complex Of A Chitinase With The Natural Product Cyclopentapeptide Argadin From Clonostachys Length = 499 | Back alignment and structure |
| >pdb|1H0G|A Chain A, Complex Of A Chitinase With The Natural Product Cyclopentapeptide Argadin From Clonostachys Length = 499 | Back alignment and structure |
| >pdb|1KFW|A Chain A, Structure Of Catalytic Domain Of Psychrophilic Chitinase B From Arthrobacter Tad20 Length = 435 | Back alignment and structure |
| >pdb|1KFW|A Chain A, Structure Of Catalytic Domain Of Psychrophilic Chitinase B From Arthrobacter Tad20 Length = 435 | Back alignment and structure |
| >pdb|1E15|A Chain A, Chitinase B From Serratia Marcescens Length = 499 | Back alignment and structure |
| >pdb|1E15|A Chain A, Chitinase B From Serratia Marcescens Length = 499 | Back alignment and structure |
| >pdb|1E6Z|A Chain A, Chitinase B From Serratia Marcescens Wildtype In Complex With Catalytic Intermediate Length = 498 | Back alignment and structure |
| >pdb|1E6Z|A Chain A, Chitinase B From Serratia Marcescens Wildtype In Complex With Catalytic Intermediate Length = 498 | Back alignment and structure |
| >pdb|1E6N|B Chain B, Chitinase B From Serratia Marcescens Inactive Mutant E144q In Complex With N-Acetylglucosamine-Pentamer Length = 499 | Back alignment and structure |
| >pdb|1E6N|B Chain B, Chitinase B From Serratia Marcescens Inactive Mutant E144q In Complex With N-Acetylglucosamine-Pentamer Length = 499 | Back alignment and structure |
| >pdb|1UR9|A Chain A, Interactions Of A Family 18 Chitinase With The Designed Inhibitor Hm508, And Its Degradation Product, Chitobiono-Delta-Lactone Length = 499 | Back alignment and structure |
| >pdb|1UR9|A Chain A, Interactions Of A Family 18 Chitinase With The Designed Inhibitor Hm508, And Its Degradation Product, Chitobiono-Delta-Lactone Length = 499 | Back alignment and structure |
| >pdb|1OGB|A Chain A, Chitinase B From Serratia Marcescens Mutant D142n Length = 499 | Back alignment and structure |
| >pdb|1OGB|A Chain A, Chitinase B From Serratia Marcescens Mutant D142n Length = 499 | Back alignment and structure |
| >pdb|1GOI|A Chain A, Crystal Structure Of The D140n Mutant Of Chitinase B From Serratia Marcescens At 1.45 A Resolution Length = 499 | Back alignment and structure |
| >pdb|1GOI|A Chain A, Crystal Structure Of The D140n Mutant Of Chitinase B From Serratia Marcescens At 1.45 A Resolution Length = 499 | Back alignment and structure |
| >pdb|1JND|A Chain A, Crystal Structure Of Imaginal Disc Growth Factor-2 Length = 420 | Back alignment and structure |
| >pdb|3QOK|A Chain A, Crystal Structure Of Putative Chitinase Ii From Klebsiella Pneumoniae Length = 420 | Back alignment and structure |
| >pdb|3QOK|A Chain A, Crystal Structure Of Putative Chitinase Ii From Klebsiella Pneumoniae Length = 420 | Back alignment and structure |
| >pdb|4DWS|C Chain C, Crystal Structure Of A Chitinase From The Yersinia Entomophaga Toxin Complex Length = 546 | Back alignment and structure |
| >pdb|4DWS|C Chain C, Crystal Structure Of A Chitinase From The Yersinia Entomophaga Toxin Complex Length = 546 | Back alignment and structure |
| >pdb|4DWS|A Chain A, Crystal Structure Of A Chitinase From The Yersinia Entomophaga Toxin Complex Length = 546 | Back alignment and structure |
| >pdb|4DWS|A Chain A, Crystal Structure Of A Chitinase From The Yersinia Entomophaga Toxin Complex Length = 546 | Back alignment and structure |
| >pdb|4DWS|D Chain D, Crystal Structure Of A Chitinase From The Yersinia Entomophaga Toxin Complex Length = 546 | Back alignment and structure |
| >pdb|4DWS|D Chain D, Crystal Structure Of A Chitinase From The Yersinia Entomophaga Toxin Complex Length = 546 | Back alignment and structure |
| >pdb|4DWS|B Chain B, Crystal Structure Of A Chitinase From The Yersinia Entomophaga Toxin Complex Length = 546 | Back alignment and structure |
| >pdb|4DWS|B Chain B, Crystal Structure Of A Chitinase From The Yersinia Entomophaga Toxin Complex Length = 546 | Back alignment and structure |
| >pdb|4A5Q|A Chain A, Crystal Structure Of The Chitinase Chi1 Fitted Into The 3d Structure Of The Yersinia Entomophaga Toxin Complex Length = 546 | Back alignment and structure |
| >pdb|4A5Q|A Chain A, Crystal Structure Of The Chitinase Chi1 Fitted Into The 3d Structure Of The Yersinia Entomophaga Toxin Complex Length = 546 | Back alignment and structure |
| >pdb|3OA5|A Chain A, The Structure Of Chi1, A Chitinase From Yersinia Entomophaga Length = 574 | Back alignment and structure |
| >pdb|3OA5|A Chain A, The Structure Of Chi1, A Chitinase From Yersinia Entomophaga Length = 574 | Back alignment and structure |
| >pdb|3CZ8|A Chain A, Crystal Structure Of Putative Sporulation-Specific Glycosylase Ydhd From Bacillus Subtilis Length = 319 | Back alignment and structure |
| >pdb|3CO4|A Chain A, Crystal Structure Of A Chitinase From Bacteroides Thetaiotaomicron Length = 312 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 996 | |||
| 1wb0_A | 445 | Chitinase 1, chitotriosidase 1; cyclopentapeptide | 1e-161 | |
| 1wb0_A | 445 | Chitinase 1, chitotriosidase 1; cyclopentapeptide | 2e-49 | |
| 1wb0_A | 445 | Chitinase 1, chitotriosidase 1; cyclopentapeptide | 1e-31 | |
| 1wb0_A | 445 | Chitinase 1, chitotriosidase 1; cyclopentapeptide | 3e-27 | |
| 1wb0_A | 445 | Chitinase 1, chitotriosidase 1; cyclopentapeptide | 2e-22 | |
| 1wb0_A | 445 | Chitinase 1, chitotriosidase 1; cyclopentapeptide | 6e-12 | |
| 1wb0_A | 445 | Chitinase 1, chitotriosidase 1; cyclopentapeptide | 2e-11 | |
| 1vf8_A | 377 | YM1, secretory protein; chitinase, CHI-lectin, str | 1e-160 | |
| 1vf8_A | 377 | YM1, secretory protein; chitinase, CHI-lectin, str | 9e-47 | |
| 1vf8_A | 377 | YM1, secretory protein; chitinase, CHI-lectin, str | 7e-35 | |
| 1vf8_A | 377 | YM1, secretory protein; chitinase, CHI-lectin, str | 1e-28 | |
| 1vf8_A | 377 | YM1, secretory protein; chitinase, CHI-lectin, str | 2e-20 | |
| 1vf8_A | 377 | YM1, secretory protein; chitinase, CHI-lectin, str | 5e-12 | |
| 3fy1_A | 395 | Amcase, TSA1902, acidic mammalian chitinase; struc | 1e-157 | |
| 3fy1_A | 395 | Amcase, TSA1902, acidic mammalian chitinase; struc | 9e-46 | |
| 3fy1_A | 395 | Amcase, TSA1902, acidic mammalian chitinase; struc | 7e-35 | |
| 3fy1_A | 395 | Amcase, TSA1902, acidic mammalian chitinase; struc | 5e-29 | |
| 3fy1_A | 395 | Amcase, TSA1902, acidic mammalian chitinase; struc | 1e-21 | |
| 3fy1_A | 395 | Amcase, TSA1902, acidic mammalian chitinase; struc | 8e-12 | |
| 4ay1_A | 365 | Chitinase-3-like protein 2; chilectin, lectin, chi | 1e-156 | |
| 4ay1_A | 365 | Chitinase-3-like protein 2; chilectin, lectin, chi | 3e-46 | |
| 4ay1_A | 365 | Chitinase-3-like protein 2; chilectin, lectin, chi | 2e-33 | |
| 4ay1_A | 365 | Chitinase-3-like protein 2; chilectin, lectin, chi | 5e-29 | |
| 4ay1_A | 365 | Chitinase-3-like protein 2; chilectin, lectin, chi | 3e-20 | |
| 4ay1_A | 365 | Chitinase-3-like protein 2; chilectin, lectin, chi | 7e-12 | |
| 2pi6_A | 361 | Chitinase-3-like protein 1; complex, signaling pro | 1e-155 | |
| 2pi6_A | 361 | Chitinase-3-like protein 1; complex, signaling pro | 4e-47 | |
| 2pi6_A | 361 | Chitinase-3-like protein 1; complex, signaling pro | 1e-33 | |
| 2pi6_A | 361 | Chitinase-3-like protein 1; complex, signaling pro | 7e-30 | |
| 2pi6_A | 361 | Chitinase-3-like protein 1; complex, signaling pro | 3e-22 | |
| 2pi6_A | 361 | Chitinase-3-like protein 1; complex, signaling pro | 7e-12 | |
| 3alf_A | 353 | Chitinase, class V; hydrolase; 1.20A {Nicotiana ta | 1e-145 | |
| 3alf_A | 353 | Chitinase, class V; hydrolase; 1.20A {Nicotiana ta | 2e-46 | |
| 3alf_A | 353 | Chitinase, class V; hydrolase; 1.20A {Nicotiana ta | 3e-27 | |
| 3alf_A | 353 | Chitinase, class V; hydrolase; 1.20A {Nicotiana ta | 4e-20 | |
| 3alf_A | 353 | Chitinase, class V; hydrolase; 1.20A {Nicotiana ta | 9e-18 | |
| 3alf_A | 353 | Chitinase, class V; hydrolase; 1.20A {Nicotiana ta | 3e-06 | |
| 3aqu_A | 356 | AT4G19810; stress response, TIM barrel, hydrolase, | 1e-145 | |
| 3aqu_A | 356 | AT4G19810; stress response, TIM barrel, hydrolase, | 6e-48 | |
| 3aqu_A | 356 | AT4G19810; stress response, TIM barrel, hydrolase, | 4e-30 | |
| 3aqu_A | 356 | AT4G19810; stress response, TIM barrel, hydrolase, | 5e-21 | |
| 3aqu_A | 356 | AT4G19810; stress response, TIM barrel, hydrolase, | 8e-18 | |
| 3aqu_A | 356 | AT4G19810; stress response, TIM barrel, hydrolase, | 3e-07 | |
| 1jnd_A | 420 | Imaginal DISC growth factor-2; IDGF, chitinase, in | 1e-128 | |
| 1jnd_A | 420 | Imaginal DISC growth factor-2; IDGF, chitinase, in | 1e-36 | |
| 1jnd_A | 420 | Imaginal DISC growth factor-2; IDGF, chitinase, in | 2e-26 | |
| 1jnd_A | 420 | Imaginal DISC growth factor-2; IDGF, chitinase, in | 4e-23 | |
| 1jnd_A | 420 | Imaginal DISC growth factor-2; IDGF, chitinase, in | 5e-19 | |
| 1jnd_A | 420 | Imaginal DISC growth factor-2; IDGF, chitinase, in | 8e-10 | |
| 1w9p_A | 433 | Chitinase; peptide inhibitors, argifin, argadin, g | 1e-128 | |
| 1w9p_A | 433 | Chitinase; peptide inhibitors, argifin, argadin, g | 8e-47 | |
| 1w9p_A | 433 | Chitinase; peptide inhibitors, argifin, argadin, g | 1e-23 | |
| 1w9p_A | 433 | Chitinase; peptide inhibitors, argifin, argadin, g | 2e-22 | |
| 1w9p_A | 433 | Chitinase; peptide inhibitors, argifin, argadin, g | 2e-20 | |
| 1w9p_A | 433 | Chitinase; peptide inhibitors, argifin, argadin, g | 2e-06 | |
| 3qok_A | 420 | Putative chitinase II; structural genomics, PSI-bi | 1e-128 | |
| 3qok_A | 420 | Putative chitinase II; structural genomics, PSI-bi | 3e-40 | |
| 3qok_A | 420 | Putative chitinase II; structural genomics, PSI-bi | 4e-25 | |
| 3qok_A | 420 | Putative chitinase II; structural genomics, PSI-bi | 1e-21 | |
| 3qok_A | 420 | Putative chitinase II; structural genomics, PSI-bi | 6e-20 | |
| 3qok_A | 420 | Putative chitinase II; structural genomics, PSI-bi | 2e-08 | |
| 1ll7_A | 392 | Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { | 1e-126 | |
| 1ll7_A | 392 | Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { | 1e-46 | |
| 1ll7_A | 392 | Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { | 5e-23 | |
| 1ll7_A | 392 | Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { | 5e-22 | |
| 1ll7_A | 392 | Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { | 1e-20 | |
| 1ll7_A | 392 | Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { | 8e-06 | |
| 1goi_A | 499 | Chitinase B; chitin degradation, hydrolase, glycos | 1e-126 | |
| 1goi_A | 499 | Chitinase B; chitin degradation, hydrolase, glycos | 8e-43 | |
| 1goi_A | 499 | Chitinase B; chitin degradation, hydrolase, glycos | 3e-24 | |
| 1goi_A | 499 | Chitinase B; chitin degradation, hydrolase, glycos | 2e-21 | |
| 1goi_A | 499 | Chitinase B; chitin degradation, hydrolase, glycos | 4e-20 | |
| 1goi_A | 499 | Chitinase B; chitin degradation, hydrolase, glycos | 3e-06 | |
| 3g6m_A | 406 | Chitinase, crchi1; inhibitor, caffeine, glycosidas | 1e-125 | |
| 3g6m_A | 406 | Chitinase, crchi1; inhibitor, caffeine, glycosidas | 3e-46 | |
| 3g6m_A | 406 | Chitinase, crchi1; inhibitor, caffeine, glycosidas | 8e-24 | |
| 3g6m_A | 406 | Chitinase, crchi1; inhibitor, caffeine, glycosidas | 3e-22 | |
| 3g6m_A | 406 | Chitinase, crchi1; inhibitor, caffeine, glycosidas | 3e-20 | |
| 3g6m_A | 406 | Chitinase, crchi1; inhibitor, caffeine, glycosidas | 3e-06 | |
| 1itx_A | 419 | Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) | 1e-124 | |
| 1itx_A | 419 | Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) | 5e-45 | |
| 1itx_A | 419 | Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) | 3e-21 | |
| 1itx_A | 419 | Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) | 3e-20 | |
| 1itx_A | 419 | Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) | 1e-19 | |
| 1itx_A | 419 | Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) | 6e-07 | |
| 3oa5_A | 574 | CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers | 1e-117 | |
| 3oa5_A | 574 | CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers | 2e-39 | |
| 3oa5_A | 574 | CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers | 2e-21 | |
| 3oa5_A | 574 | CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers | 1e-19 | |
| 3oa5_A | 574 | CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers | 3e-17 | |
| 1kfw_A | 435 | Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob | 1e-116 | |
| 1kfw_A | 435 | Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob | 1e-37 | |
| 1kfw_A | 435 | Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob | 2e-23 | |
| 1kfw_A | 435 | Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob | 5e-20 | |
| 1kfw_A | 435 | Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob | 1e-17 | |
| 1kfw_A | 435 | Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob | 1e-06 | |
| 1edq_A | 540 | Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 | 1e-115 | |
| 1edq_A | 540 | Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 | 5e-36 | |
| 1edq_A | 540 | Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 | 5e-22 | |
| 1edq_A | 540 | Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 | 2e-20 | |
| 1edq_A | 540 | Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 | 2e-17 | |
| 1edq_A | 540 | Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 | 4e-06 | |
| 3arx_A | 584 | Chitinase A; TIM barrel, inhibitor complex, glycos | 1e-108 | |
| 3arx_A | 584 | Chitinase A; TIM barrel, inhibitor complex, glycos | 9e-39 | |
| 3arx_A | 584 | Chitinase A; TIM barrel, inhibitor complex, glycos | 6e-20 | |
| 3arx_A | 584 | Chitinase A; TIM barrel, inhibitor complex, glycos | 1e-19 | |
| 3arx_A | 584 | Chitinase A; TIM barrel, inhibitor complex, glycos | 2e-19 | |
| 3arx_A | 584 | Chitinase A; TIM barrel, inhibitor complex, glycos | 3e-05 | |
| 3fnd_A | 312 | Chitinase; TIM-barrel, structural genomics, PSI-2, | 9e-95 | |
| 3fnd_A | 312 | Chitinase; TIM-barrel, structural genomics, PSI-2, | 6e-33 | |
| 3fnd_A | 312 | Chitinase; TIM-barrel, structural genomics, PSI-2, | 1e-18 | |
| 3fnd_A | 312 | Chitinase; TIM-barrel, structural genomics, PSI-2, | 2e-16 | |
| 3fnd_A | 312 | Chitinase; TIM-barrel, structural genomics, PSI-2, | 6e-14 | |
| 3fnd_A | 312 | Chitinase; TIM-barrel, structural genomics, PSI-2, | 6e-05 | |
| 3cz8_A | 319 | Putative sporulation-specific glycosylase YDHD; st | 3e-91 | |
| 3cz8_A | 319 | Putative sporulation-specific glycosylase YDHD; st | 3e-34 | |
| 3cz8_A | 319 | Putative sporulation-specific glycosylase YDHD; st | 5e-19 | |
| 3cz8_A | 319 | Putative sporulation-specific glycosylase YDHD; st | 9e-16 | |
| 3cz8_A | 319 | Putative sporulation-specific glycosylase YDHD; st | 2e-05 | |
| 3sim_A | 275 | Protein, family 18 chitinase; family 18 plant chit | 3e-74 | |
| 3sim_A | 275 | Protein, family 18 chitinase; family 18 plant chit | 2e-29 | |
| 3sim_A | 275 | Protein, family 18 chitinase; family 18 plant chit | 2e-17 | |
| 3sim_A | 275 | Protein, family 18 chitinase; family 18 plant chit | 2e-11 | |
| 3sim_A | 275 | Protein, family 18 chitinase; family 18 plant chit | 2e-07 | |
| 3bxw_B | 393 | Chitinase domain-containing protein 1; TIM barrel, | 2e-62 | |
| 3bxw_B | 393 | Chitinase domain-containing protein 1; TIM barrel, | 1e-21 | |
| 3bxw_B | 393 | Chitinase domain-containing protein 1; TIM barrel, | 5e-10 | |
| 3bxw_B | 393 | Chitinase domain-containing protein 1; TIM barrel, | 4e-09 | |
| 1edt_A | 271 | Endo-beta-N-acetylglucosaminidase H, endo H; hydro | 2e-46 | |
| 1edt_A | 271 | Endo-beta-N-acetylglucosaminidase H, endo H; hydro | 9e-23 | |
| 1edt_A | 271 | Endo-beta-N-acetylglucosaminidase H, endo H; hydro | 5e-13 | |
| 1edt_A | 271 | Endo-beta-N-acetylglucosaminidase H, endo H; hydro | 1e-06 | |
| 1edt_A | 271 | Endo-beta-N-acetylglucosaminidase H, endo H; hydro | 8e-04 | |
| 3n12_A | 333 | Chitinase A, chinctu2; zinc atoms, complex, hydrol | 2e-43 | |
| 3n12_A | 333 | Chitinase A, chinctu2; zinc atoms, complex, hydrol | 2e-14 | |
| 3n12_A | 333 | Chitinase A, chinctu2; zinc atoms, complex, hydrol | 4e-07 | |
| 3n12_A | 333 | Chitinase A, chinctu2; zinc atoms, complex, hydrol | 4e-06 | |
| 2y8v_A | 290 | CHIC, class III chitinase, putative; afchic, hydro | 9e-35 | |
| 2y8v_A | 290 | CHIC, class III chitinase, putative; afchic, hydro | 2e-15 | |
| 2y8v_A | 290 | CHIC, class III chitinase, putative; afchic, hydro | 5e-10 | |
| 2y8v_A | 290 | CHIC, class III chitinase, putative; afchic, hydro | 3e-05 | |
| 1nar_A | 290 | Narbonin; plant SEED protein; 1.80A {Vicia narbone | 1e-34 | |
| 1nar_A | 290 | Narbonin; plant SEED protein; 1.80A {Vicia narbone | 6e-17 | |
| 1nar_A | 290 | Narbonin; plant SEED protein; 1.80A {Vicia narbone | 4e-07 | |
| 1nar_A | 290 | Narbonin; plant SEED protein; 1.80A {Vicia narbone | 7e-06 | |
| 2ebn_A | 289 | Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl | 3e-32 | |
| 2ebn_A | 289 | Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl | 3e-18 | |
| 2ebn_A | 289 | Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl | 3e-06 | |
| 2ebn_A | 289 | Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl | 2e-05 | |
| 3ian_A | 321 | Chitinase; structural genomics, hydrolase, glycosi | 1e-26 | |
| 3ian_A | 321 | Chitinase; structural genomics, hydrolase, glycosi | 1e-16 | |
| 3ian_A | 321 | Chitinase; structural genomics, hydrolase, glycosi | 1e-05 | |
| 2dsk_A | 311 | Chitinase; catalytic domain, active domain, crysta | 2e-19 | |
| 2dsk_A | 311 | Chitinase; catalytic domain, active domain, crysta | 9e-10 | |
| 1dqc_A | 74 | Tachycitin; disulfide-rich, antimicrobial protein; | 5e-18 | |
| 3ebv_A | 302 | Chinitase A; chitinase A, CHIA, glycosidase, struc | 2e-16 | |
| 3ebv_A | 302 | Chinitase A; chitinase A, CHIA, glycosidase, struc | 8e-06 | |
| 3poh_A | 451 | Endo-beta-N-acetylglucosaminidase F1; TIM barrel, | 3e-16 | |
| 3poh_A | 451 | Endo-beta-N-acetylglucosaminidase F1; TIM barrel, | 9e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-06 | |
| 2xtk_A | 310 | CHIA1, class III chitinase CHIA1; hydrolase, GH18; | 3e-04 |
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 | Back alignment and structure |
|---|
Score = 479 bits (1235), Expect = e-161
Identities = 154/347 (44%), Positives = 229/347 (65%), Gaps = 10/347 (2%)
Query: 379 IFCYMTSWSQARPGAGKFGPENIDPKLCTHVIYAFGTLKDHKLTLNEDKEKDEAGKFEAL 438
+ CY T+W+Q R G +F P+++DP LCTH+IYAF + +H+L+ E ++ ++
Sbjct: 3 LVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEW---NDETLYQEF 59
Query: 439 MQLREKNPDIKILLAIGGWAFGSTPFKELTGNVFRMNQFVYESIEFLREHKFNGLDVDWE 498
L++ NP +K LLAIGGW FG+ F ++ FV +I FLR++ F+GLD+DWE
Sbjct: 60 NGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWE 119
Query: 499 YP--RG--ADDRASYVNLLKELRLAFEGEAKTSGEPRLLLTAAVPASFEAIAAGYDVPEI 554
YP +G A D+ + L+++L AF+ EA+TSG+ RLLL+AAVPA + AGY+V +I
Sbjct: 120 YPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKI 179
Query: 555 SKYLDFINVMTYDFHGQWERQVGHNSPLKPLEGATSYQKKLTVEYSAKEWVKQGAPKEKL 614
++ LDF+N+M YDFHG WE+ GHNSPL + + L V+ + ++W+++G P KL
Sbjct: 180 AQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKL 239
Query: 615 MIGMPTYGRSFTLVDPTKFDIGAPASGGGEPGKYTAEAGFMSYYEVCDFLKKDNTTLVWD 674
++GMPTYGRSFTL + +GAPA+G G PG +T E G ++YYEVC T
Sbjct: 240 ILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVC---SWKGATKQRI 296
Query: 675 NEQQVPFAYKDDQWVGFDDERSLKMKMDWLKEDGYGGIMIWSVDMDD 721
+Q+VP+ ++D+QWVGFDD S K K+ +LK+ G GG M+W++D+DD
Sbjct: 297 QDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDD 343
|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 | Back alignment and structure |
|---|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 | Back alignment and structure |
|---|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 | Back alignment and structure |
|---|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 | Back alignment and structure |
|---|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 | Back alignment and structure |
|---|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 | Back alignment and structure |
|---|
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 | Back alignment and structure |
|---|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 | Back alignment and structure |
|---|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 | Back alignment and structure |
|---|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 | Back alignment and structure |
|---|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 | Back alignment and structure |
|---|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 | Back alignment and structure |
|---|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 | Back alignment and structure |
|---|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 | Back alignment and structure |
|---|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 | Back alignment and structure |
|---|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 | Back alignment and structure |
|---|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 | Back alignment and structure |
|---|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 | Back alignment and structure |
|---|
| >1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 | Back alignment and structure |
|---|
| >1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 | Back alignment and structure |
|---|
| >1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 | Back alignment and structure |
|---|
| >1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 | Back alignment and structure |
|---|
| >1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 | Back alignment and structure |
|---|
| >1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 | Back alignment and structure |
|---|
| >1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 | Back alignment and structure |
|---|
| >1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 | Back alignment and structure |
|---|
| >1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 | Back alignment and structure |
|---|
| >1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 | Back alignment and structure |
|---|
| >1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 | Back alignment and structure |
|---|
| >1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 | Back alignment and structure |
|---|
| >1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 | Back alignment and structure |
|---|
| >1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 | Back alignment and structure |
|---|
| >1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 | Back alignment and structure |
|---|
| >1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 | Back alignment and structure |
|---|
| >1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 | Back alignment and structure |
|---|
| >1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 | Back alignment and structure |
|---|
| >1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 | Back alignment and structure |
|---|
| >1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 | Back alignment and structure |
|---|
| >1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 | Back alignment and structure |
|---|
| >1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 | Back alignment and structure |
|---|
| >1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 | Back alignment and structure |
|---|
| >1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 | Back alignment and structure |
|---|
| >3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 | Back alignment and structure |
|---|
| >3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 | Back alignment and structure |
|---|
| >3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 | Back alignment and structure |
|---|
| >3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 | Back alignment and structure |
|---|
| >3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 | Back alignment and structure |
|---|
| >3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 | Back alignment and structure |
|---|
| >1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 | Back alignment and structure |
|---|
| >1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 | Back alignment and structure |
|---|
| >1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 | Back alignment and structure |
|---|
| >1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 | Back alignment and structure |
|---|
| >1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 | Back alignment and structure |
|---|
| >1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 | Back alignment and structure |
|---|
| >3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 | Back alignment and structure |
|---|
| >3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 | Back alignment and structure |
|---|
| >3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 | Back alignment and structure |
|---|
| >3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 | Back alignment and structure |
|---|
| >3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 | Back alignment and structure |
|---|
| >1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Length = 435 | Back alignment and structure |
|---|
| >1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Length = 435 | Back alignment and structure |
|---|
| >1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Length = 435 | Back alignment and structure |
|---|
| >1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Length = 435 | Back alignment and structure |
|---|
| >1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Length = 435 | Back alignment and structure |
|---|
| >1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Length = 435 | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 | Back alignment and structure |
|---|
| >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 | Back alignment and structure |
|---|
| >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 | Back alignment and structure |
|---|
| >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 | Back alignment and structure |
|---|
| >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 | Back alignment and structure |
|---|
| >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 | Back alignment and structure |
|---|
| >3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Length = 275 | Back alignment and structure |
|---|
| >3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Length = 275 | Back alignment and structure |
|---|
| >3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Length = 275 | Back alignment and structure |
|---|
| >3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Length = 275 | Back alignment and structure |
|---|
| >3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Length = 275 | Back alignment and structure |
|---|
| >3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Length = 393 | Back alignment and structure |
|---|
| >3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Length = 393 | Back alignment and structure |
|---|
| >3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Length = 393 | Back alignment and structure |
|---|
| >3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Length = 393 | Back alignment and structure |
|---|
| >1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Length = 271 | Back alignment and structure |
|---|
| >1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Length = 271 | Back alignment and structure |
|---|
| >1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Length = 271 | Back alignment and structure |
|---|
| >1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Length = 271 | Back alignment and structure |
|---|
| >1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Length = 271 | Back alignment and structure |
|---|
| >3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Length = 333 | Back alignment and structure |
|---|
| >3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Length = 333 | Back alignment and structure |
|---|
| >3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Length = 333 | Back alignment and structure |
|---|
| >3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Length = 333 | Back alignment and structure |
|---|
| >2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Length = 290 | Back alignment and structure |
|---|
| >2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Length = 290 | Back alignment and structure |
|---|
| >2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Length = 290 | Back alignment and structure |
|---|
| >2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Length = 290 | Back alignment and structure |
|---|
| >1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Length = 290 | Back alignment and structure |
|---|
| >1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Length = 290 | Back alignment and structure |
|---|
| >1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Length = 290 | Back alignment and structure |
|---|
| >1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Length = 290 | Back alignment and structure |
|---|
| >2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Length = 289 | Back alignment and structure |
|---|
| >2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Length = 289 | Back alignment and structure |
|---|
| >2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Length = 289 | Back alignment and structure |
|---|
| >2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Length = 289 | Back alignment and structure |
|---|
| >3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Length = 321 | Back alignment and structure |
|---|
| >3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Length = 321 | Back alignment and structure |
|---|
| >3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Length = 321 | Back alignment and structure |
|---|
| >2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A Length = 311 | Back alignment and structure |
|---|
| >2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A Length = 311 | Back alignment and structure |
|---|
| >1dqc_A Tachycitin; disulfide-rich, antimicrobial protein; NMR {Tachypleus tridentatus} SCOP: g.31.1.1 Length = 74 | Back alignment and structure |
|---|
| >3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Length = 302 | Back alignment and structure |
|---|
| >3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Length = 302 | Back alignment and structure |
|---|
| >3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} Length = 451 | Back alignment and structure |
|---|
| >3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} Length = 451 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2xtk_A CHIA1, class III chitinase CHIA1; hydrolase, GH18; HET: AZM; 2.00A {Aspergillus fumigatus} PDB: 2xuc_A 2xvp_A 2xvn_A* Length = 310 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 996 | |||
| 1wb0_A | 445 | Chitinase 1, chitotriosidase 1; cyclopentapeptide | 100.0 | |
| 4ay1_A | 365 | Chitinase-3-like protein 2; chilectin, lectin, chi | 100.0 | |
| 3fy1_A | 395 | Amcase, TSA1902, acidic mammalian chitinase; struc | 100.0 | |
| 1vf8_A | 377 | YM1, secretory protein; chitinase, CHI-lectin, str | 100.0 | |
| 2pi6_A | 361 | Chitinase-3-like protein 1; complex, signaling pro | 100.0 | |
| 1jnd_A | 420 | Imaginal DISC growth factor-2; IDGF, chitinase, in | 100.0 | |
| 1itx_A | 419 | Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) | 100.0 | |
| 3alf_A | 353 | Chitinase, class V; hydrolase; 1.20A {Nicotiana ta | 100.0 | |
| 3aqu_A | 356 | AT4G19810; stress response, TIM barrel, hydrolase, | 100.0 | |
| 3g6m_A | 406 | Chitinase, crchi1; inhibitor, caffeine, glycosidas | 100.0 | |
| 1kfw_A | 435 | Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob | 100.0 | |
| 1goi_A | 499 | Chitinase B; chitin degradation, hydrolase, glycos | 100.0 | |
| 1edq_A | 540 | Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 | 100.0 | |
| 3arx_A | 584 | Chitinase A; TIM barrel, inhibitor complex, glycos | 100.0 | |
| 1ll7_A | 392 | Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { | 100.0 | |
| 3qok_A | 420 | Putative chitinase II; structural genomics, PSI-bi | 100.0 | |
| 1w9p_A | 433 | Chitinase; peptide inhibitors, argifin, argadin, g | 100.0 | |
| 3oa5_A | 574 | CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers | 100.0 | |
| 3cz8_A | 319 | Putative sporulation-specific glycosylase YDHD; st | 100.0 | |
| 4ay1_A | 365 | Chitinase-3-like protein 2; chilectin, lectin, chi | 100.0 | |
| 3fy1_A | 395 | Amcase, TSA1902, acidic mammalian chitinase; struc | 100.0 | |
| 3bxw_B | 393 | Chitinase domain-containing protein 1; TIM barrel, | 100.0 | |
| 3fnd_A | 312 | Chitinase; TIM-barrel, structural genomics, PSI-2, | 100.0 | |
| 1wb0_A | 445 | Chitinase 1, chitotriosidase 1; cyclopentapeptide | 100.0 | |
| 1vf8_A | 377 | YM1, secretory protein; chitinase, CHI-lectin, str | 100.0 | |
| 2pi6_A | 361 | Chitinase-3-like protein 1; complex, signaling pro | 100.0 | |
| 1jnd_A | 420 | Imaginal DISC growth factor-2; IDGF, chitinase, in | 100.0 | |
| 1itx_A | 419 | Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) | 100.0 | |
| 3g6m_A | 406 | Chitinase, crchi1; inhibitor, caffeine, glycosidas | 100.0 | |
| 1kfw_A | 435 | Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob | 100.0 | |
| 1edq_A | 540 | Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 | 100.0 | |
| 3arx_A | 584 | Chitinase A; TIM barrel, inhibitor complex, glycos | 100.0 | |
| 1ll7_A | 392 | Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { | 100.0 | |
| 3qok_A | 420 | Putative chitinase II; structural genomics, PSI-bi | 100.0 | |
| 1w9p_A | 433 | Chitinase; peptide inhibitors, argifin, argadin, g | 100.0 | |
| 1goi_A | 499 | Chitinase B; chitin degradation, hydrolase, glycos | 100.0 | |
| 3aqu_A | 356 | AT4G19810; stress response, TIM barrel, hydrolase, | 100.0 | |
| 3oa5_A | 574 | CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers | 100.0 | |
| 3alf_A | 353 | Chitinase, class V; hydrolase; 1.20A {Nicotiana ta | 100.0 | |
| 1nar_A | 290 | Narbonin; plant SEED protein; 1.80A {Vicia narbone | 100.0 | |
| 4axn_A | 328 | Chitinase C1; hydrolase; 1.68A {Serratia marcescen | 100.0 | |
| 3n12_A | 333 | Chitinase A, chinctu2; zinc atoms, complex, hydrol | 100.0 | |
| 3sim_A | 275 | Protein, family 18 chitinase; family 18 plant chit | 100.0 | |
| 2y8v_A | 290 | CHIC, class III chitinase, putative; afchic, hydro | 100.0 | |
| 3ian_A | 321 | Chitinase; structural genomics, hydrolase, glycosi | 100.0 | |
| 3ebv_A | 302 | Chinitase A; chitinase A, CHIA, glycosidase, struc | 100.0 | |
| 4ac1_X | 283 | Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, g | 99.97 | |
| 3fnd_A | 312 | Chitinase; TIM-barrel, structural genomics, PSI-2, | 99.97 | |
| 3bxw_B | 393 | Chitinase domain-containing protein 1; TIM barrel, | 99.96 | |
| 3cz8_A | 319 | Putative sporulation-specific glycosylase YDHD; st | 99.96 | |
| 1edt_A | 271 | Endo-beta-N-acetylglucosaminidase H, endo H; hydro | 99.95 | |
| 2hvm_A | 273 | Hevamine; hydrolase, chitinase/lysozyme; 1.80A {He | 99.95 | |
| 2uy2_A | 294 | Endochitinase; carbohydrate metabolism, polysaccha | 99.94 | |
| 2ebn_A | 289 | Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl | 99.93 | |
| 1eok_A | 290 | Endo-beta-N-acetylglucosaminidase F3; alpha/beta-b | 99.93 | |
| 2gsj_A | 271 | Protein PPL-2; mimosoideae, chimerolectin, endochi | 99.93 | |
| 1cnv_A | 299 | Concanavalin B; plant chitinase, chitin binding pr | 99.91 | |
| 2xtk_A | 310 | CHIA1, class III chitinase CHIA1; hydrolase, GH18; | 99.9 | |
| 1edt_A | 271 | Endo-beta-N-acetylglucosaminidase H, endo H; hydro | 99.87 | |
| 1nar_A | 290 | Narbonin; plant SEED protein; 1.80A {Vicia narbone | 99.87 | |
| 1ta3_A | 274 | XIP-1, xylanase inhibitor protein I; beta alpha ba | 99.84 | |
| 3sim_A | 275 | Protein, family 18 chitinase; family 18 plant chit | 99.82 | |
| 3n12_A | 333 | Chitinase A, chinctu2; zinc atoms, complex, hydrol | 99.81 | |
| 3poh_A | 451 | Endo-beta-N-acetylglucosaminidase F1; TIM barrel, | 99.77 | |
| 4ac1_X | 283 | Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, g | 99.77 | |
| 4axn_A | 328 | Chitinase C1; hydrolase; 1.68A {Serratia marcescen | 99.77 | |
| 2y8v_A | 290 | CHIC, class III chitinase, putative; afchic, hydro | 99.76 | |
| 3ian_A | 321 | Chitinase; structural genomics, hydrolase, glycosi | 99.73 | |
| 3mu7_A | 273 | XAIP-II, xylanase and alpha-amylase inhibitor prot | 99.73 | |
| 3ebv_A | 302 | Chinitase A; chitinase A, CHIA, glycosidase, struc | 99.71 | |
| 2dsk_A | 311 | Chitinase; catalytic domain, active domain, crysta | 99.69 | |
| 2ebn_A | 289 | Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl | 99.68 | |
| 1eok_A | 290 | Endo-beta-N-acetylglucosaminidase F3; alpha/beta-b | 99.66 | |
| 2hvm_A | 273 | Hevamine; hydrolase, chitinase/lysozyme; 1.80A {He | 99.63 | |
| 2gsj_A | 271 | Protein PPL-2; mimosoideae, chimerolectin, endochi | 99.59 | |
| 2xtk_A | 310 | CHIA1, class III chitinase CHIA1; hydrolase, GH18; | 99.58 | |
| 2uy2_A | 294 | Endochitinase; carbohydrate metabolism, polysaccha | 99.53 | |
| 1cnv_A | 299 | Concanavalin B; plant chitinase, chitin binding pr | 99.44 | |
| 3poh_A | 451 | Endo-beta-N-acetylglucosaminidase F1; TIM barrel, | 99.4 | |
| 1dqc_A | 74 | Tachycitin; disulfide-rich, antimicrobial protein; | 99.3 | |
| 1ta3_A | 274 | XIP-1, xylanase inhibitor protein I; beta alpha ba | 99.07 | |
| 2dsk_A | 311 | Chitinase; catalytic domain, active domain, crysta | 98.81 | |
| 3mu7_A | 273 | XAIP-II, xylanase and alpha-amylase inhibitor prot | 98.52 | |
| 2vtf_A | 626 | Endo-beta-N-acetylglucosaminidase; hydrolase, fami | 96.95 | |
| 2w91_A | 653 | Endo-beta-N-acetylglucosaminidase D; hydrolase, N- | 96.8 | |
| 2vtf_A | 626 | Endo-beta-N-acetylglucosaminidase; hydrolase, fami | 95.3 | |
| 2w91_A | 653 | Endo-beta-N-acetylglucosaminidase D; hydrolase, N- | 95.24 |
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=5.4e-80 Score=721.69 Aligned_cols=440 Identities=39% Similarity=0.816 Sum_probs=328.9
Q ss_pred eEEEEecccCCcCCCCCCCCCCCCCCCCCcEEEEEEEEeeCCeeEeCCCcchhhhhHHHHHHHHHHhCCCceEEEEEcCC
Q psy13135 378 DIFCYMTSWSQARPGAGKFGPENIDPKLCTHVIYAFGTLKDHKLTLNEDKEKDEAGKFEALMQLREKNPDIKILLAIGGW 457 (996)
Q Consensus 378 ~vvcYy~~W~~~r~~~~~~~~~~i~~~~cTHIiyafa~v~~~~~~~~~~~~~~~~~~~~~~~~lk~~np~lKvllSIGG~ 457 (996)
+|||||++|+.+|++.+.|.+++|++++||||+|+|+.++++++...+ ..+...+++|.+||++||++|||||||||
T Consensus 2 kvv~Y~~~w~~~r~~~~~~~~~~i~~~~~THi~yaF~~i~~~~~~~~d---~~d~~~~~~~~~lk~~~p~lKvllsiGGw 78 (445)
T 1wb0_A 2 KLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTE---WNDETLYQEFNGLKKMNPKLKTLLAIGGW 78 (445)
T ss_dssp EEEEEEETTGGGSCGGGCCCGGGCCTTTCSEEEEEEEEEETTEEECSS---TTHHHHHHHHHHGGGTCTTCEEEEEEECT
T ss_pred eEEEEECcccccCCCCCCCCHHHCCcccCCEEEEEEEeeccCceeecC---hhHHHHHHHHHHHHHhCCCCeEEEEECCC
Confidence 699999999999998889999999999999999999999987665544 22445789999999999999999999999
Q ss_pred CCCCcchhhccCCHHHHHHHHHHHHHHHHhCCcceEEEeeeCCCC----ccCHHHHHHHHHHHHHHHHhhhcccCCCceE
Q psy13135 458 AFGSTPFKELTGNVFRMNQFVYESIEFLREHKFNGLDVDWEYPRG----ADDRASYVNLLKELRLAFEGEAKTSGEPRLL 533 (996)
Q Consensus 458 ~~~s~~fs~~~s~~~~r~~fi~siv~~l~~ygfDGIDIDwE~P~~----~~d~~~f~~llkeLr~~l~~~~~~~~~~~~~ 533 (996)
++++..|+.++++++.|++||+++++||++|+|||||||||||.. ++|+++|+.||++||++|+++++..++++++
T Consensus 79 ~~~s~~fs~~~~~~~~R~~fi~siv~~l~~~gfDGiDiDwEyP~~~g~~~~d~~nf~~ll~eLr~~l~~~~~~~~~~~~~ 158 (445)
T 1wb0_A 79 NFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLL 158 (445)
T ss_dssp TTCSHHHHHHHTSHHHHHHHHHHHHHHHHHTTCCEEEEECSCTTSTTCCTTHHHHHHHHHHHHHHHHHHHHHHHCSCCCE
T ss_pred CCCCchHHHHHcCHHHHHHHHHHHHHHHHHcCCCeEEEeCccCCCCCCCHHHHHHHHHHHHHHHHHHHHhhhccCCCceE
Confidence 987889999999999999999999999999999999999999964 4689999999999999999877766777899
Q ss_pred EEEeecCchhhhhcCCChhhhhccccEEEEeeccCCCCCCCCcCCCCCCCCCCCCccccccccHHHHHHHHHHcCCCCCC
Q psy13135 534 LTAAVPASFEAIAAGYDVPEISKYLDFINVMTYDFHGQWERQVGHNSPLKPLEGATSYQKKLTVEYSAKEWVKQGAPKEK 613 (996)
Q Consensus 534 Lsvavp~~~~~~~~~yd~~~l~~~vD~vnvMtYD~~g~w~~~~g~~sPL~~~~~~~~~~~~~~v~~~v~~~l~~Gvp~~K 613 (996)
||+++|+....+..+||+++|.+++||||||+|||||+|+..+||+|||++..........++++.+|++|++.|+|++|
T Consensus 159 Ls~av~~~~~~~~~~~d~~~l~~~vD~inlMtYD~~g~w~~~~g~~apL~~~~~~~~~~~~~~v~~av~~~~~~gvp~~K 238 (445)
T 1wb0_A 159 LSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASK 238 (445)
T ss_dssp EEEEECCCHHHHHHHCCHHHHHHHCSEEEECCCCSSCTTSSBCCCSSCSSCCTTCCGGGGGCSHHHHHHHHHHTTCCGGG
T ss_pred EEEEecCCHHHHHccCCHHHHHHhcceeeeeeeeccCCCcCCCCCCCCCCCCCCCccccccccHHHHHHHHHHcCCChhH
Confidence 99999998877766799999999999999999999999999999999999766554444567999999999999999999
Q ss_pred eeeccccceeeeEecCCCCCCCCCCCCCCCCCCcccccCcceeehhhhccccCCCceEEEcCCCCcceEeeCCeEEeecc
Q psy13135 614 LMIGMPTYGRSFTLVDPTKFDIGAPASGGGEPGKYTAEAGFMSYYEVCDFLKKDNTTLVWDNEQQVPFAYKDDQWVGFDD 693 (996)
Q Consensus 614 LvLGlp~YG~~~~l~~~~~~~~g~p~~g~g~~g~~t~~~G~lsy~ei~~~l~~~~~~~~wD~~~~~py~~~~~~wv~ydd 693 (996)
||||||+|||+|++.++.+..+|+|+.|++.+|+++.+.|+++|.|||+. .+++..||+.+++||+|++++||+|||
T Consensus 239 lvlGip~YGr~~~~~~~~~~~~g~p~~g~~~~g~~t~~~G~~~y~ei~~~---~g~~~~~D~~~~~~y~y~~~~~v~ydd 315 (445)
T 1wb0_A 239 LILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSW---KGATKQRIQDQKVPYIFRDNQWVGFDD 315 (445)
T ss_dssp EEEEEESEEEEEEESCTTCCSTTCBEEEECCCCTTTCCTTEEEHHHHTTC---TTCEEEEETTTTEEEEEETTEEEECCC
T ss_pred EEEEecccceeeEccCCCCCCCCCcccCCCCCCCccCcCCcccHHHHhhc---CCcEEEeccccceeEEEeCCEEEEeCC
Confidence 99999999999999998888899999999999999999999999999986 489999999999999999999999999
Q ss_pred cchhhhhchhhhhcCCcceeeeeccCCCCCCccccccccccccchhhhhhHHHhhhccccccccccCCCCCccChHHHHH
Q psy13135 694 ERSLKMKMDWLKEDGYGGIMIWSVDMDDLSTPFKELTGNVFRMNQFVYESIEFLREHKFNGLDVDWEYPRGADDRASYVN 773 (996)
Q Consensus 694 ~~Sl~~K~~~~k~~~lgGi~vW~l~~Dd~sg~f~~lc~~~~~r~~~i~siv~~l~~~~~DGvdiDwE~p~~~~d~~~~~~ 773 (996)
++|++.|++|++++||||+|+|++++||+.|. .|+. -++|
T Consensus 316 ~~Si~~K~~~~~~~gLgGv~~W~l~~Dd~~g~---~c~~--------------------------~~~~----------- 355 (445)
T 1wb0_A 316 VESFKTKVSYLKQKGLGGAMVWALDLDDFAGF---SCNQ--------------------------GRYP----------- 355 (445)
T ss_dssp HHHHHHHHHHHHHTTCCEEEEECGGGSCTTCS---SSSS--------------------------CSSH-----------
T ss_pred HHHHHHHHHHHHHCCCceEEEecccccccCCC---cCCC--------------------------CCch-----------
Confidence 99999999999999999999999999999883 2875 3567
Q ss_pred HHHHHHHHHhhcccccCCCceeEEEecCCCHHHHhcCCChhhhhccccEEEccccccCCCCCCCcCCCCCCCcccccccc
Q psy13135 774 LLKELRLAFEGEAKTSGEPRLLLTAAVPASFEAIAAGYDVPEISKYLDFINVMTYDFHGQWERQVGHNSPLKPLEVLLIT 853 (996)
Q Consensus 774 fl~elr~~l~~~~~~~~~~~~~lt~avp~~~~~~~~~~d~~~l~~~vD~inlMtYD~~g~w~~~~g~~spl~~~~~~~~~ 853 (996)
||+.+++.|...+. + .+.+..+.
T Consensus 356 Ll~ai~~~l~~~~~-------------~-----------------------------------~~~~~~~~--------- 378 (445)
T 1wb0_A 356 LIQTLRQELSLPYL-------------P-----------------------------------SGTPELEV--------- 378 (445)
T ss_dssp HHHHHHHHC-----------------------------------------------------------------------
T ss_pred HHHHHHHHhcCCCC-------------C-----------------------------------CCCCCCCC---------
Confidence 99999999852110 0 00000000
Q ss_pred ccCCCCCcccchHHHHHHHHHcCCCCcceeeccCCCCCccccccccccceeccccCcccccccCCCCCCCCCCCccCCCC
Q psy13135 854 TLSIPGATSYQKKLTVDLLLTAAVPASFEAIAAGYDVPEISKYLDFINVMTYDFHGQWERQVGHNSPLKPLEANVVSCEE 933 (996)
Q Consensus 854 ~~~~p~~~~~~~~~~v~~~~~~gvP~~Ki~lgigy~~p~ygr~~~~~~~~~~d~~g~~~~~~~~~~~~~t~~~~~~~C~~ 933 (996)
|..+ + ++.+..++..+..+.|+.
T Consensus 379 ----~~~~-----------------------------~------------------------~~~~~~~~~~~~~~~C~~ 401 (445)
T 1wb0_A 379 ----PKPG-----------------------------Q------------------------PSEPEHGPSPGQDTFCQG 401 (445)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred ----CCCC-----------------------------C------------------------CCCCCCCCCCCCCCcCCC
Confidence 0000 0 000001112234567987
Q ss_pred CCCCcccCCCCCCCcceeEcCCCeeeeccCCCCccccCCCCccCCC
Q psy13135 934 EDGHISYHPDKADCTHYYMCEGERKHHMPCPSNLVFNPKENVCDWP 979 (996)
Q Consensus 934 ~~~~~~~~p~~~~C~~fy~C~~g~~~~~~Cp~gl~fn~~~~~Cd~p 979 (996)
... +++||+.+|++||+|.+|.++++.||+||+||++.++||||
T Consensus 402 ~~~--G~~~~p~~C~~fy~C~~g~~~~~~Cp~Gl~f~~~~~~Cd~p 445 (445)
T 1wb0_A 402 KAD--GLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTWN 445 (445)
T ss_dssp ----------------------------------------------
T ss_pred CCC--cccCCCCCCCcccCCCCCCEEeCCCcCCCEECcccCCCCCC
Confidence 532 58999999999999999999999999999999999999997
|
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A | Back alignment and structure |
|---|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... | Back alignment and structure |
|---|
| >1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* | Back alignment and structure |
|---|
| >1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* | Back alignment and structure |
|---|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* | Back alignment and structure |
|---|
| >1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 | Back alignment and structure |
|---|
| >1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* | Back alignment and structure |
|---|
| >1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* | Back alignment and structure |
|---|
| >3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A | Back alignment and structure |
|---|
| >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* | Back alignment and structure |
|---|
| >3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A | Back alignment and structure |
|---|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A | Back alignment and structure |
|---|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... | Back alignment and structure |
|---|
| >1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* | Back alignment and structure |
|---|
| >1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 | Back alignment and structure |
|---|
| >3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* | Back alignment and structure |
|---|
| >1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* | Back alignment and structure |
|---|
| >1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* | Back alignment and structure |
|---|
| >1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* | Back alignment and structure |
|---|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* | Back alignment and structure |
|---|
| >1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 | Back alignment and structure |
|---|
| >4axn_A Chitinase C1; hydrolase; 1.68A {Serratia marcescens} | Back alignment and structure |
|---|
| >3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* | Back alignment and structure |
|---|
| >3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} | Back alignment and structure |
|---|
| >2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >4ac1_X Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, glycoside hydrolase family 18, deglycosylation; HET: NAG; 1.30A {Hypocrea jecorina} | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A | Back alignment and structure |
|---|
| >3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A | Back alignment and structure |
|---|
| >2hvm_A Hevamine; hydrolase, chitinase/lysozyme; 1.80A {Hevea brasiliensis} SCOP: c.1.8.5 PDB: 1hvq_A* 1llo_A 1kr0_A* 1kr1_A* 1kqy_A* 1kqz_A* | Back alignment and structure |
|---|
| >2uy2_A Endochitinase; carbohydrate metabolism, polysaccharide degradation, glycopr chitin-binding, chitin degradation, CAZY, hydrolase; 1.60A {Saccharomyces cerevisiae} PDB: 2uy3_A* 2uy4_A* 2uy5_A* | Back alignment and structure |
|---|
| >2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 | Back alignment and structure |
|---|
| >1eok_A Endo-beta-N-acetylglucosaminidase F3; alpha/beta-barrel, hydrolase; 1.80A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 PDB: 1eom_A* | Back alignment and structure |
|---|
| >2gsj_A Protein PPL-2; mimosoideae, chimerolectin, endochitinase, glycosyl hydrolase family 18, equilibrium sedimentation, X-RAY; 1.73A {Parkia platycephala} | Back alignment and structure |
|---|
| >1cnv_A Concanavalin B; plant chitinase, chitin binding protein, SEED protein; 1.65A {Canavalia ensiformis} SCOP: c.1.8.5 | Back alignment and structure |
|---|
| >2xtk_A CHIA1, class III chitinase CHIA1; hydrolase, GH18; HET: AZM; 2.00A {Aspergillus fumigatus} PDB: 2xuc_A 2xvp_A 2xvn_A* | Back alignment and structure |
|---|
| >1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A | Back alignment and structure |
|---|
| >1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 | Back alignment and structure |
|---|
| >1ta3_A XIP-1, xylanase inhibitor protein I; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Triticum aestivum} SCOP: c.1.8.5 PDB: 1om0_A* 1te1_A* | Back alignment and structure |
|---|
| >3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} | Back alignment and structure |
|---|
| >3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* | Back alignment and structure |
|---|
| >3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4ac1_X Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, glycoside hydrolase family 18, deglycosylation; HET: NAG; 1.30A {Hypocrea jecorina} | Back alignment and structure |
|---|
| >4axn_A Chitinase C1; hydrolase; 1.68A {Serratia marcescens} | Back alignment and structure |
|---|
| >2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3mu7_A XAIP-II, xylanase and alpha-amylase inhibitor protein; TIM barell, amylase/xylanase inhibitory protein, hydrolase I; 1.29A {Scadoxus multiflorus} SCOP: c.1.8.0 PDB: 3o9n_A 3oih_A* 3hu7_A 3m7s_A* 3d5h_A* | Back alignment and structure |
|---|
| >3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A | Back alignment and structure |
|---|
| >2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 | Back alignment and structure |
|---|
| >1eok_A Endo-beta-N-acetylglucosaminidase F3; alpha/beta-barrel, hydrolase; 1.80A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 PDB: 1eom_A* | Back alignment and structure |
|---|
| >2hvm_A Hevamine; hydrolase, chitinase/lysozyme; 1.80A {Hevea brasiliensis} SCOP: c.1.8.5 PDB: 1hvq_A* 1llo_A 1kr0_A* 1kr1_A* 1kqy_A* 1kqz_A* | Back alignment and structure |
|---|
| >2gsj_A Protein PPL-2; mimosoideae, chimerolectin, endochitinase, glycosyl hydrolase family 18, equilibrium sedimentation, X-RAY; 1.73A {Parkia platycephala} | Back alignment and structure |
|---|
| >2xtk_A CHIA1, class III chitinase CHIA1; hydrolase, GH18; HET: AZM; 2.00A {Aspergillus fumigatus} PDB: 2xuc_A 2xvp_A 2xvn_A* | Back alignment and structure |
|---|
| >2uy2_A Endochitinase; carbohydrate metabolism, polysaccharide degradation, glycopr chitin-binding, chitin degradation, CAZY, hydrolase; 1.60A {Saccharomyces cerevisiae} PDB: 2uy3_A* 2uy4_A* 2uy5_A* | Back alignment and structure |
|---|
| >1cnv_A Concanavalin B; plant chitinase, chitin binding protein, SEED protein; 1.65A {Canavalia ensiformis} SCOP: c.1.8.5 | Back alignment and structure |
|---|
| >3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1dqc_A Tachycitin; disulfide-rich, antimicrobial protein; NMR {Tachypleus tridentatus} SCOP: g.31.1.1 | Back alignment and structure |
|---|
| >1ta3_A XIP-1, xylanase inhibitor protein I; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Triticum aestivum} SCOP: c.1.8.5 PDB: 1om0_A* 1te1_A* | Back alignment and structure |
|---|
| >2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A | Back alignment and structure |
|---|
| >3mu7_A XAIP-II, xylanase and alpha-amylase inhibitor protein; TIM barell, amylase/xylanase inhibitory protein, hydrolase I; 1.29A {Scadoxus multiflorus} SCOP: c.1.8.0 PDB: 3o9n_A 3oih_A* 3hu7_A 3m7s_A* 3d5h_A* | Back alignment and structure |
|---|
| >2vtf_A Endo-beta-N-acetylglucosaminidase; hydrolase, family 85, glycosidase, carbohydrat binding; HET: B3P PGE; 1.79A {Arthrobacter protophormiae} PDB: 3fhq_A* 3fha_A* | Back alignment and structure |
|---|
| >2w91_A Endo-beta-N-acetylglucosaminidase D; hydrolase, N-glycan, secreted, oxazoline, NAG-thiazoline, substrate-participation; 1.40A {Streptococcus pneumoniae} PDB: 2w92_A* | Back alignment and structure |
|---|
| >2vtf_A Endo-beta-N-acetylglucosaminidase; hydrolase, family 85, glycosidase, carbohydrat binding; HET: B3P PGE; 1.79A {Arthrobacter protophormiae} PDB: 3fhq_A* 3fha_A* | Back alignment and structure |
|---|
| >2w91_A Endo-beta-N-acetylglucosaminidase D; hydrolase, N-glycan, secreted, oxazoline, NAG-thiazoline, substrate-participation; 1.40A {Streptococcus pneumoniae} PDB: 2w92_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 996 | ||||
| d1vf8a1 | 302 | c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin | 4e-67 | |
| d1vf8a1 | 302 | c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin | 3e-27 | |
| d1vf8a1 | 302 | c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin | 3e-22 | |
| d1vf8a1 | 302 | c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin | 1e-18 | |
| d1vf8a1 | 302 | c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin | 2e-10 | |
| d1vf8a1 | 302 | c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin | 4e-10 | |
| d1vf8a1 | 302 | c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin | 6e-10 | |
| d1goia2 | 356 | c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic | 1e-65 | |
| d1goia2 | 356 | c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic | 1e-18 | |
| d1goia2 | 356 | c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic | 9e-18 | |
| d1goia2 | 356 | c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic | 8e-17 | |
| d1goia2 | 356 | c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic | 3e-07 | |
| d1goia2 | 356 | c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic | 3e-04 | |
| d1wb0a1 | 297 | c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma | 7e-65 | |
| d1wb0a1 | 297 | c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma | 6e-31 | |
| d1wb0a1 | 297 | c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma | 6e-23 | |
| d1wb0a1 | 297 | c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma | 1e-18 | |
| d1wb0a1 | 297 | c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma | 4e-13 | |
| d1wb0a1 | 297 | c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma | 2e-10 | |
| d1wb0a1 | 297 | c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma | 7e-10 | |
| d1ll7a1 | 330 | c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus ( | 2e-62 | |
| d1ll7a1 | 330 | c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus ( | 5e-23 | |
| d1ll7a1 | 330 | c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus ( | 1e-18 | |
| d1ll7a1 | 330 | c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus ( | 1e-10 | |
| d1ll7a1 | 330 | c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus ( | 4e-07 | |
| d1jnda1 | 327 | c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f | 1e-57 | |
| d1jnda1 | 327 | c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f | 4e-23 | |
| d1jnda1 | 327 | c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f | 4e-22 | |
| d1jnda1 | 327 | c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f | 4e-18 | |
| d1jnda1 | 327 | c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f | 1e-09 | |
| d1jnda1 | 327 | c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f | 2e-06 | |
| d1w9pa1 | 333 | c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil | 2e-56 | |
| d1w9pa1 | 333 | c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil | 2e-25 | |
| d1w9pa1 | 333 | c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil | 1e-18 | |
| d1w9pa1 | 333 | c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil | 5e-11 | |
| d1w9pa1 | 333 | c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil | 9e-08 | |
| d1w9pa1 | 333 | c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil | 1e-05 | |
| d1w9pa1 | 333 | c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil | 0.001 | |
| d2pi6a1 | 292 | c.1.8.5 (A:1-239,A:308-361) Signal processing prot | 4e-55 | |
| d2pi6a1 | 292 | c.1.8.5 (A:1-239,A:308-361) Signal processing prot | 4e-44 | |
| d2pi6a1 | 292 | c.1.8.5 (A:1-239,A:308-361) Signal processing prot | 1e-21 | |
| d2pi6a1 | 292 | c.1.8.5 (A:1-239,A:308-361) Signal processing prot | 1e-10 | |
| d2pi6a1 | 292 | c.1.8.5 (A:1-239,A:308-361) Signal processing prot | 6e-08 | |
| d1itxa1 | 347 | c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu | 6e-50 | |
| d1itxa1 | 347 | c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu | 2e-24 | |
| d1itxa1 | 347 | c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu | 2e-16 | |
| d1itxa1 | 347 | c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu | 1e-10 | |
| d1itxa1 | 347 | c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu | 6e-07 | |
| d1itxa1 | 347 | c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu | 4e-06 | |
| d1edqa2 | 358 | c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt | 2e-49 | |
| d1edqa2 | 358 | c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt | 1e-20 | |
| d1edqa2 | 358 | c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt | 6e-16 | |
| d1edqa2 | 358 | c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt | 5e-06 | |
| d1edqa2 | 358 | c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt | 8e-06 | |
| d1edqa2 | 358 | c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt | 3e-04 | |
| d1edqa2 | 358 | c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt | 5e-04 | |
| d1kfwa1 | 374 | c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina | 1e-46 | |
| d1kfwa1 | 374 | c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina | 9e-20 | |
| d1kfwa1 | 374 | c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina | 4e-15 | |
| d1kfwa1 | 374 | c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina | 1e-09 | |
| d1kfwa1 | 374 | c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina | 1e-07 | |
| d1kfwa1 | 374 | c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina | 2e-05 | |
| d2ebna_ | 285 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 6e-45 | |
| d2ebna_ | 285 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 1e-19 | |
| d2ebna_ | 285 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 1e-07 | |
| d2ebna_ | 285 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 5e-07 | |
| d2ebna_ | 285 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 3e-04 | |
| d1nara_ | 289 | c.1.8.5 (A:) Seed storage protein {Vicia narbonens | 3e-44 | |
| d1nara_ | 289 | c.1.8.5 (A:) Seed storage protein {Vicia narbonens | 2e-25 | |
| d1nara_ | 289 | c.1.8.5 (A:) Seed storage protein {Vicia narbonens | 2e-06 | |
| d1edta_ | 265 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {St | 1e-40 | |
| d1edta_ | 265 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {St | 5e-21 | |
| d1edta_ | 265 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {St | 6e-13 | |
| d1wb0a2 | 68 | d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo | 1e-29 | |
| d1wb0a2 | 68 | d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo | 1e-05 | |
| d1vf8a2 | 70 | d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mo | 2e-29 | |
| d1vf8a2 | 70 | d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mo | 4e-09 | |
| d2pi6a2 | 68 | d.26.3.1 (A:240-307) Signal processing protein (SP | 8e-28 | |
| d2pi6a2 | 68 | d.26.3.1 (A:240-307) Signal processing protein (SP | 7e-06 | |
| d2hvma_ | 273 | c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para | 1e-27 | |
| d2hvma_ | 273 | c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para | 8e-14 | |
| d2hvma_ | 273 | c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para | 0.003 | |
| d1jnda2 | 92 | d.26.3.1 (A:279-370) Imaginal disc growth factor-2 | 8e-20 | |
| d1itxa2 | 72 | d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circul | 3e-18 | |
| d1ta3a_ | 274 | c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I { | 4e-15 | |
| d1ta3a_ | 274 | c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I { | 5e-07 | |
| d1dqca_ | 73 | g.31.1.1 (A:) Tachycitin {Horseshoe crab (Tachyple | 4e-14 | |
| d1edqa3 | 73 | d.26.3.1 (A:444-516) Chitinase A {Serratia marcesc | 5e-14 | |
| d1eoka_ | 282 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 5e-14 | |
| d1eoka_ | 282 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 2e-05 | |
| d1kfwa2 | 61 | d.26.3.1 (A:328-388) Psychrophilic chitinase B {Ar | 2e-13 | |
| d1kfwa2 | 61 | d.26.3.1 (A:328-388) Psychrophilic chitinase B {Ar | 8e-06 | |
| d1cnva_ | 283 | c.1.8.5 (A:) Seed storage protein {Jack bean (Cana | 8e-12 | |
| d1cnva_ | 283 | c.1.8.5 (A:) Seed storage protein {Jack bean (Cana | 3e-06 |
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: Type II chitinase domain: Chitinase-like lectin ym1, saccharide binding domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 225 bits (573), Expect = 4e-67
Identities = 102/254 (40%), Positives = 143/254 (56%), Gaps = 8/254 (3%)
Query: 379 IFCYMTSWSQARPGAGKFGPENIDPKLCTHVIYAFGTLKDHKLTLNEDKEKDEAGKFEAL 438
+ CY TSW++ RP G F P NIDP LCTH+IYAF ++++++T + + +EAL
Sbjct: 3 LMCYYTSWAKDRPIEGSFKPGNIDPCLCTHLIYAFAGMQNNEITYTHE---QDLRDYEAL 59
Query: 439 MQLREKNPDIKILLAIGGWAFGSTPFKELTGNVFRMNQFVYESIEFLREHKFNGLDVDWE 498
L++KN ++K LLAIGGW FG PF + F+ I FLR++ F+GL++DW+
Sbjct: 60 NGLKDKNTELKTLLAIGGWKFGPAPFSAMVSTPQNRQIFIQSVIRFLRQYNFDGLNLDWQ 119
Query: 499 YPRG----ADDRASYVNLLKELRLAFEGEAKTSGEPRLLLTAAVPASFEAIAAGYDVPEI 554
YP D+ + L+KE+R AFE E+ PRLLLT+ + I +GY +PE+
Sbjct: 120 YPGSRGSPPKDKHLFSVLVKEMRKAFEEESVEKDIPRLLLTSTGAGIIDVIKSGYKIPEL 179
Query: 555 SKYLDFINVMTYDFHGQWERQVGHNSPLKPLEGATSYQKKLTVEYSAKEWVKQGAPKEKL 614
S+ LD+I VMTYD H + G NSPL L V+ W GA EKL
Sbjct: 180 SQSLDYIQVMTYDLHDPKDGYTGENSPLYKSPYDIGKSADLNVDSIISYWKDHGAASEKL 239
Query: 615 MIGMPTYG-RSFTL 627
++G P RSF L
Sbjct: 240 IVGFPADNVRSFKL 253
|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Length = 330 | Back information, alignment and structure |
|---|
| >d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Length = 330 | Back information, alignment and structure |
|---|
| >d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Length = 330 | Back information, alignment and structure |
|---|
| >d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Length = 330 | Back information, alignment and structure |
|---|
| >d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Length = 330 | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 | Back information, alignment and structure |
|---|
| >d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Length = 285 | Back information, alignment and structure |
|---|
| >d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Length = 285 | Back information, alignment and structure |
|---|
| >d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Length = 285 | Back information, alignment and structure |
|---|
| >d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Length = 285 | Back information, alignment and structure |
|---|
| >d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Length = 285 | Back information, alignment and structure |
|---|
| >d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Length = 289 | Back information, alignment and structure |
|---|
| >d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Length = 289 | Back information, alignment and structure |
|---|
| >d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Length = 289 | Back information, alignment and structure |
|---|
| >d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Length = 265 | Back information, alignment and structure |
|---|
| >d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Length = 265 | Back information, alignment and structure |
|---|
| >d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Length = 265 | Back information, alignment and structure |
|---|
| >d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 | Back information, alignment and structure |
|---|
| >d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 | Back information, alignment and structure |
|---|
| >d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 68 | Back information, alignment and structure |
|---|
| >d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 68 | Back information, alignment and structure |
|---|
| >d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 273 | Back information, alignment and structure |
|---|
| >d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 273 | Back information, alignment and structure |
|---|
| >d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 273 | Back information, alignment and structure |
|---|
| >d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 92 | Back information, alignment and structure |
|---|
| >d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 72 | Back information, alignment and structure |
|---|
| >d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 274 | Back information, alignment and structure |
|---|
| >d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 274 | Back information, alignment and structure |
|---|
| >d1dqca_ g.31.1.1 (A:) Tachycitin {Horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} Length = 73 | Back information, alignment and structure |
|---|
| >d1edqa3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]} Length = 73 | Back information, alignment and structure |
|---|
| >d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Length = 282 | Back information, alignment and structure |
|---|
| >d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Length = 282 | Back information, alignment and structure |
|---|
| >d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 61 | Back information, alignment and structure |
|---|
| >d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 61 | Back information, alignment and structure |
|---|
| >d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} Length = 283 | Back information, alignment and structure |
|---|
| >d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} Length = 283 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 996 | |||
| d1wb0a1 | 297 | Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 | 100.0 | |
| d1vf8a1 | 302 | Chitinase-like lectin ym1, saccharide binding doma | 100.0 | |
| d2pi6a1 | 292 | Signal processing protein (SPC-40, MGP-40) {Sheep | 100.0 | |
| d1jnda1 | 327 | Imaginal disc growth factor-2 {Fruit fly (Drosophi | 100.0 | |
| d1itxa1 | 347 | Chitinase A1 {Bacillus circulans [TaxId: 1397]} | 100.0 | |
| d1kfwa1 | 374 | Psychrophilic chitinase B {Arthrobacter sp., tad20 | 100.0 | |
| d1w9pa1 | 333 | Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | 100.0 | |
| d1edqa2 | 358 | Chitinase A, catalytic domain {Serratia marcescens | 100.0 | |
| d1ll7a1 | 330 | Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: | 100.0 | |
| d1goia2 | 356 | Chitinase B, catalytic domain {Serratia marcescens | 100.0 | |
| d2pi6a1 | 292 | Signal processing protein (SPC-40, MGP-40) {Sheep | 100.0 | |
| d1jnda1 | 327 | Imaginal disc growth factor-2 {Fruit fly (Drosophi | 100.0 | |
| d1vf8a1 | 302 | Chitinase-like lectin ym1, saccharide binding doma | 100.0 | |
| d1wb0a1 | 297 | Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 | 100.0 | |
| d1itxa1 | 347 | Chitinase A1 {Bacillus circulans [TaxId: 1397]} | 100.0 | |
| d1goia2 | 356 | Chitinase B, catalytic domain {Serratia marcescens | 100.0 | |
| d1kfwa1 | 374 | Psychrophilic chitinase B {Arthrobacter sp., tad20 | 100.0 | |
| d1w9pa1 | 333 | Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | 99.96 | |
| d1nara_ | 289 | Seed storage protein {Vicia narbonensis, Narbonin | 99.96 | |
| d1edqa2 | 358 | Chitinase A, catalytic domain {Serratia marcescens | 99.96 | |
| d1ll7a1 | 330 | Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: | 99.96 | |
| d1edta_ | 265 | Endo-beta-N-acetylglucosaminidase {Streptomyces pl | 99.94 | |
| d2ebna_ | 285 | Endo-beta-N-acetylglucosaminidase {Flavobacterium | 99.94 | |
| d2hvma_ | 273 | Hevamine A (chitinase/lysozyme) {Para rubber tree | 99.91 | |
| d1ta3a_ | 274 | Xylanase inhibitor protein I, XIP-I {Wheat (Tritic | 99.86 | |
| d1cnva_ | 283 | Seed storage protein {Jack bean (Canavalia ensifor | 99.85 | |
| d1edta_ | 265 | Endo-beta-N-acetylglucosaminidase {Streptomyces pl | 99.81 | |
| d1nara_ | 289 | Seed storage protein {Vicia narbonensis, Narbonin | 99.72 | |
| d1eoka_ | 282 | Endo-beta-N-acetylglucosaminidase {Flavobacterium | 99.68 | |
| d2ebna_ | 285 | Endo-beta-N-acetylglucosaminidase {Flavobacterium | 99.63 | |
| d1vf8a2 | 70 | Chitinase-like lectin ym1 {Mouse (Mus musculus) [T | 99.48 | |
| d2hvma_ | 273 | Hevamine A (chitinase/lysozyme) {Para rubber tree | 99.44 | |
| d1wb0a2 | 68 | Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 | 99.42 | |
| d2pi6a2 | 68 | Signal processing protein (SPC-40, MGP-40) {Sheep | 99.38 | |
| d1dqca_ | 73 | Tachycitin {Horseshoe crab (Tachypleus tridentatus | 99.22 | |
| d1ta3a_ | 274 | Xylanase inhibitor protein I, XIP-I {Wheat (Tritic | 99.21 | |
| d1cnva_ | 283 | Seed storage protein {Jack bean (Canavalia ensifor | 99.15 | |
| d1jnda2 | 92 | Imaginal disc growth factor-2 {Fruit fly (Drosophi | 99.01 | |
| d1itxa2 | 72 | Chitinase A1 {Bacillus circulans [TaxId: 1397]} | 98.87 | |
| d1vf8a2 | 70 | Chitinase-like lectin ym1 {Mouse (Mus musculus) [T | 98.71 | |
| d1edqa3 | 73 | Chitinase A {Serratia marcescens [TaxId: 615]} | 98.65 | |
| d1kfwa2 | 61 | Psychrophilic chitinase B {Arthrobacter sp., tad20 | 98.56 | |
| d1eoka_ | 282 | Endo-beta-N-acetylglucosaminidase {Flavobacterium | 98.51 | |
| d2pi6a2 | 68 | Signal processing protein (SPC-40, MGP-40) {Sheep | 98.39 | |
| d1wb0a2 | 68 | Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 | 98.35 | |
| d1kfwa2 | 61 | Psychrophilic chitinase B {Arthrobacter sp., tad20 | 97.29 | |
| d1ll7a2 | 62 | Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: | 97.12 | |
| d1w9pa2 | 62 | Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | 97.1 | |
| d1jnda2 | 92 | Imaginal disc growth factor-2 {Fruit fly (Drosophi | 97.09 | |
| d1goia3 | 88 | Chitinase B {Serratia marcescens [TaxId: 615]} | 97.08 | |
| d1edqa3 | 73 | Chitinase A {Serratia marcescens [TaxId: 615]} | 97.04 | |
| d1itxa2 | 72 | Chitinase A1 {Bacillus circulans [TaxId: 1397]} | 96.99 |
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: Type II chitinase domain: Chitotriosidase species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=1.6e-56 Score=495.21 Aligned_cols=278 Identities=43% Similarity=0.869 Sum_probs=256.5
Q ss_pred eEEEEecccCCcCCCCCCCCCCCCCCCCCcEEEEEEEEeeCCeeEeCCCcchhhhhHHHHHHHHHHhCCCceEEEEEcCC
Q psy13135 378 DIFCYMTSWSQARPGAGKFGPENIDPKLCTHVIYAFGTLKDHKLTLNEDKEKDEAGKFEALMQLREKNPDIKILLAIGGW 457 (996)
Q Consensus 378 ~vvcYy~~W~~~r~~~~~~~~~~i~~~~cTHIiyafa~v~~~~~~~~~~~~~~~~~~~~~~~~lk~~np~lKvllSIGG~ 457 (996)
||||||++|+.||++..+|.|++||+++||||+|+|+.++++........ +...++++..||+++|++|||||||||
T Consensus 2 kvvcYy~~w~~~~~~~~~~~~~~i~~~~~THi~yaf~~~~~~~~~~~~~~---~~~~~~~~~~lk~~~p~lKvllSiGG~ 78 (297)
T d1wb0a1 2 KLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWN---DETLYQEFNGLKKMNPKLKTLLAIGGW 78 (297)
T ss_dssp EEEEEEETTGGGSCGGGCCCGGGCCTTTCSEEEEEEEEEETTEEECSSTT---HHHHHHHHHHGGGTCTTCEEEEEEECT
T ss_pred eEEEEECcCcccCCCCCCCChhHCCcccCCEEEEEEEEccCCccccCCcc---cHHHHHHHHHHHHhCCCCeEEEEEecc
Confidence 79999999999999988999999999999999999999998876655433 567889999999999999999999999
Q ss_pred CCCCcchhhccCCHHHHHHHHHHHHHHHHhCCcceEEEeeeCCCC----ccCHHHHHHHHHHHHHHHHhhhcccCCCceE
Q psy13135 458 AFGSTPFKELTGNVFRMNQFVYESIEFLREHKFNGLDVDWEYPRG----ADDRASYVNLLKELRLAFEGEAKTSGEPRLL 533 (996)
Q Consensus 458 ~~~s~~fs~~~s~~~~r~~fi~siv~~l~~ygfDGIDIDwE~P~~----~~d~~~f~~llkeLr~~l~~~~~~~~~~~~~ 533 (996)
+.++..|+.+++++++|++||+++++||++|+|||||||||||.. +.|+.+|+.|+++||++|+..++..+++.+.
T Consensus 79 ~~~~~~fs~~~~~~~~R~~Fi~siv~~l~~y~fDGiDiDWE~p~~~~~~~~d~~n~~~l~~~Lr~~l~~~~~~~~~~~~~ 158 (297)
T d1wb0a1 79 NFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLL 158 (297)
T ss_dssp TTCSHHHHHHHTSHHHHHHHHHHHHHHHHHTTCCEEEEECSCTTSTTCCTTHHHHHHHHHHHHHHHHHHHHHHHCSCCCE
T ss_pred ccccchHHHHhhhhHHHHHHHHHHHHHHHHcCCCceeEEEEeccccCCChHHHHHHHHHHHHHHHHHhhhhhhcCCCcee
Confidence 988889999999999999999999999999999999999999964 4689999999999999999988777778899
Q ss_pred EEEeecCchhhhhcCCChhhhhccccEEEEeeccCCCCCCCCcCCCCCCCCCCCCccccccccHHHHHHHHHHcCCCCCC
Q psy13135 534 LTAAVPASFEAIAAGYDVPEISKYLDFINVMTYDFHGQWERQVGHNSPLKPLEGATSYQKKLTVEYSAKEWVKQGAPKEK 613 (996)
Q Consensus 534 Lsvavp~~~~~~~~~yd~~~l~~~vD~vnvMtYD~~g~w~~~~g~~sPL~~~~~~~~~~~~~~v~~~v~~~l~~Gvp~~K 613 (996)
+++++|+........|++.++.+++||||||+||+||+|+..+|+++||++..........++++.+|++|++.|+|++|
T Consensus 159 ~s~~~~~~~~~~~~~~~~~~i~~~vD~invmtYD~~g~~~~~tg~~aply~~~~~~~~~~~~~~d~~v~~~~~~G~p~~K 238 (297)
T d1wb0a1 159 LSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASK 238 (297)
T ss_dssp EEEEECCCHHHHHHHCCHHHHHHHCSEEEECCCCSSCTTSSBCCCSSCSSCCTTCCGGGGGCSHHHHHHHHHHTTCCGGG
T ss_pred EEEEccCchhHhhhccCHHHHHhhCCEEEEEecccCCCCCCCCCCCCcCCCCccccCCCCCCCHHHHHHHHHHcCCCHHH
Confidence 99999998877777899999999999999999999999999999999999877766666778999999999999999999
Q ss_pred eeeccccceeeeEecCCCCCCCCCCCCCCCCCCcccccCcceeehhhhccccCCCceEEEcCCCCcceEeeCCeEEeecc
Q psy13135 614 LMIGMPTYGRSFTLVDPTKFDIGAPASGGGEPGKYTAEAGFMSYYEVCDFLKKDNTTLVWDNEQQVPFAYKDDQWVGFDD 693 (996)
Q Consensus 614 LvLGlp~YG~~~~l~~~~~~~~g~p~~g~g~~g~~t~~~G~lsy~ei~~~l~~~~~~~~wD~~~~~py~~~~~~wv~ydd 693 (996)
|+|||| |||
T Consensus 239 lvlGip-----------------------------------------------------------------------yd~ 247 (297)
T d1wb0a1 239 LILGMP-----------------------------------------------------------------------TDD 247 (297)
T ss_dssp EEEEEE-----------------------------------------------------------------------SCC
T ss_pred eEEEec-----------------------------------------------------------------------cCC
Confidence 999987 589
Q ss_pred cchhhhhchhhhhcCCcceeeeeccCCCCCCcccccccc
Q psy13135 694 ERSLKMKMDWLKEDGYGGIMIWSVDMDDLSTPFKELTGN 732 (996)
Q Consensus 694 ~~Sl~~K~~~~k~~~lgGi~vW~l~~Dd~sg~f~~lc~~ 732 (996)
++|++.|++|++++||||+|+|++++|||+|. .|+.
T Consensus 248 ~~si~~K~~~~~~~glgGv~~W~l~~DD~~G~---~cg~ 283 (297)
T d1wb0a1 248 VESFKTKVSYLKQKGLGGAMVWALDLDDFAGF---SCNQ 283 (297)
T ss_dssp HHHHHHHHHHHHHTTCCEEEEECGGGSCTTCS---SSSS
T ss_pred HHHHHHHHHHHHhcCCceEEEEeCccccCCCC---cCCC
Confidence 99999999999999999999999999999984 1776
|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} | Back information, alignment and structure |
|---|
| >d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} | Back information, alignment and structure |
|---|
| >d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} | Back information, alignment and structure |
|---|
| >d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} | Back information, alignment and structure |
|---|
| >d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} | Back information, alignment and structure |
|---|
| >d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} | Back information, alignment and structure |
|---|
| >d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} | Back information, alignment and structure |
|---|
| >d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} | Back information, alignment and structure |
|---|
| >d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} | Back information, alignment and structure |
|---|
| >d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} | Back information, alignment and structure |
|---|
| >d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1dqca_ g.31.1.1 (A:) Tachycitin {Horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} | Back information, alignment and structure |
|---|
| >d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} | Back information, alignment and structure |
|---|
| >d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1edqa3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} | Back information, alignment and structure |
|---|
| >d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} | Back information, alignment and structure |
|---|
| >d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} | Back information, alignment and structure |
|---|
| >d1ll7a2 d.26.3.1 (A:293-354) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} | Back information, alignment and structure |
|---|
| >d1w9pa2 d.26.3.1 (A:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1goia3 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1edqa3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|