Psyllid ID: psy13148


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MFAKLLRVINHNPSCTCKAGFTGDPRVFCSRIPPPPPQESPPEYVNPCIPSPCGPYSQCRDINGSPSCSCLPNYIGAPPNCRPECVQNTECPYDKACINEKCRDPCPGSCGQGAQCRVINHSPVCYCPDGFIGDAFSSCYPKPIEPIQAPEQQADPCICAPNAVCRDNVCVCLPDYYGDGYTVCRPECIRNSDCANNKACIRNKCKNPCVPGTCGEGASSWTTGCTAEKKRNDTIYSLARLSK
ccccEEEEcccccEEEcccccccccccccccccccccccccccccccccccccccccEEEEcccccEEEcccccEEccccccccccccccccccccccccccccccccccccccEEEEccccEEEEcccccccccccccccccccccccccccccccccccccEEEccEEEcccccEEcccEEcccccccccccccccEEccccccccccccccccccEEccccccccccccccccccccccc
ccHHHEEEEccccEEEcccccccccccccccccccccccccccccccccccccccccEEEEccccEEEEccccccccccccccccccccccccccHHHccccccccccccccccEEEEEccccEEEccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccHHHcccccccccccccccccEEEEEEcccccccccccccHHHHcc
MFAKLLRVInhnpsctckagftgdprvfcsripppppqesppeyvnpcipspcgpysqcrdingspscsclpnyigappncrpecvqntecpydkacinekcrdpcpgscgqgaqcrvinhspvcycpdgfigdafsscypkpiepiqapeqqadpcicapnavcrdnvcvclpdyygdgytvcrpecirnsdcannkacirnkcknpcvpgtcgegasswttgctaekkrnDTIYSLARLSK
MFAKLLRVInhnpsctckagfTGDPRVFCSRIPPPPPQESPPEYVNPCIPSPCGPYSQCRDINGSPSCSCLPNYIGAPPNCRPECVQNTECPYDKACINEKCRDPCPGSCGQGAQCRVINHSPVCYCPDGFIGDAFSSCYPKPIEPIQAPEQQADPCICAPNAVCRDNVCVCLPDYYGDGYTVCRPECIRNSDCANNKACIrnkcknpcvpgtcgegasswttgctaekkrndtiyslarlsk
MFAKLLRVINHNPSCTCKAGFTGDPRVFCSRIpppppqesppeYVNPCIPSPCGPYSQCRDINGSPSCSCLPNYIGAPPNCRPECVQNTECPYDKACINEKCRDPCPGSCGQGAQCRVINHSPVCYCPDGFIGDAFSSCYPKPIEPIQAPEQQADPCICAPNAVCRDNVCVCLPDYYGDGYTVCRPECIRNSDCANNKACIRNKCKNPCVPGTCGEGASSWTTGCTAEKKRNDTIYSLARLSK
***********************************************CIPSPCGPYSQCRDINGSPSCSCLPNYIGAPPNCRPECVQNTECPYDKACINEKCRDPCPGSCGQGAQCRVINHSPVCYCPDGFIGDAFSSCYPKPIEPIQAPEQQADPCICAPNAVCRDNVCVCLPDYYGDGYTVCRPECIRNSDCANNKACIRNKCKNPCVPGTCGEGASSWTTGCTA****************
MFAKLLRVINHNPSCTCKAGFTGDPRVFCSRIPPPPPQESPPEYVNPCIPSPCGPYSQCRDINGSPSCSCLPNYIGAPPNCRPECVQNTECPYDKACINEKCRDPCPGSCGQGAQCRVINHSPVCYCPDGFIGDAFSSCYPKPIEPIQAPEQQADPCICAPNAVCRDNVCVCLPDYYGDGYTVCRPECIRNSDCANNKACIRNKCKNPCVPGTCGEGASSWTTGCTAEKKRNDTIYSLARLS*
MFAKLLRVINHNPSCTCKAGFTGDPRVFCSRIPPPPPQESPPEYVNPCIPSPCGPYSQCRDINGSPSCSCLPNYIGAPPNCRPECVQNTECPYDKACINEKCRDPCPGSCGQGAQCRVINHSPVCYCPDGFIGDAFSSCYPKPIEPIQAPEQQADPCICAPNAVCRDNVCVCLPDYYGDGYTVCRPECIRNSDCANNKACIRNKCKNPCVPGTCGEGASSWTTGCTAEKKRNDTIYSLARLSK
MFAKLLRVINHNPSCTCKAGFTGDPRVFCSRIPPPPPQESPPEYVNPCIPSPCGPYSQCRDINGSPSCSCLPNYIGAPPNCRPECVQNTECPYDKACINEKCRDPCPGSCGQGAQCRVINHSPVCYCPDGFIGDAFSSCYPKPIEPIQAPEQQADPCICAPNAVCRDNVCVCLPDYYGDGYTVCRPECIRNSDCANNKACIRNKCKNPCVPGTCGEGASSWTTGCTAEKKRNDTIYSLARLSK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFAKLLRVINHNPSCTCKAGFTGDPRVFCSRIPPPPPQESPPEYVNPCIPSPCGPYSQCRDINGSPSCSCLPNYIGAPPNCRPECVQNTECPYDKACINEKCRDPCPGSCGQGAQCRVINHSPVCYCPDGFIGDAFSSCYPKPIEPIQAPEQQADPCICAPNAVCRDNVCVCLPDYYGDGYTVCRPECIRNSDCANNKACIRNKCKNPCVPGTCGEGASSWTTGCTAEKKRNDTIYSLARLSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query243 2.2.26 [Sep-21-2011]
P33450 5147 Cadherin-related tumor su no N/A 0.432 0.020 0.304 1e-06
O88278 3313 Cadherin EGF LAG seven-pa yes N/A 0.679 0.049 0.265 4e-06
Q91ZI0 3301 Cadherin EGF LAG seven-pa yes N/A 0.613 0.045 0.271 1e-05
Q9NYQ7 3312 Cadherin EGF LAG seven-pa yes N/A 0.679 0.049 0.252 6e-05
Q8UWJ4 717 Delta-like protein D OS=D yes N/A 0.728 0.246 0.292 9e-05
P13508 1295 Protein glp-1 OS=Caenorha no N/A 0.670 0.125 0.257 0.0005
>sp|P33450|FAT_DROME Cadherin-related tumor suppressor OS=Drosophila melanogaster GN=ft PE=1 SV=3 Back     alignment and function desciption
 Score = 53.9 bits (128), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 43/141 (30%), Positives = 57/141 (40%), Gaps = 36/141 (25%)

Query: 7    RVINHNPSCTCKAGFTGDPRVFCSRIPPPPPQESPPEYVNPCIPSPCGPYSQCRDINGSP 66
            RV+ H+ SC C +GF+G+    CSR              +PC+P+PC    QCR +    
Sbjct: 3992 RVV-HDYSCQCTSGFSGEQ---CSR------------RQDPCLPNPCHSQVQCRRLGSDF 4035

Query: 67   SCSCLPNYIGAPPNCRPECVQNTECPYDKACINEKCRDPCPGSCGQGAQCRVINHSPVCY 126
             C C  N  G   +C  E    ++  Y K C N        GSC +         S  C 
Sbjct: 4036 QCMCPANRDGK--HCEKE---RSDVCYSKPCRNG-------GSCQRSPD----GSSYFCL 4079

Query: 127  CPDGFIGD----AFSSCYPKP 143
            C  GF G+       SC P P
Sbjct: 4080 CRPGFRGNQCESVSDSCRPNP 4100




Could function as a cell-adhesion protein. Acts as a tumor suppressor. Required for correct morphogenesis.
Drosophila melanogaster (taxid: 7227)
>sp|O88278|CELR3_RAT Cadherin EGF LAG seven-pass G-type receptor 3 OS=Rattus norvegicus GN=Celsr3 PE=2 SV=1 Back     alignment and function description
>sp|Q91ZI0|CELR3_MOUSE Cadherin EGF LAG seven-pass G-type receptor 3 OS=Mus musculus GN=Celsr3 PE=2 SV=2 Back     alignment and function description
>sp|Q9NYQ7|CELR3_HUMAN Cadherin EGF LAG seven-pass G-type receptor 3 OS=Homo sapiens GN=CELSR3 PE=1 SV=2 Back     alignment and function description
>sp|Q8UWJ4|DLLD_DANRE Delta-like protein D OS=Danio rerio GN=dld PE=1 SV=2 Back     alignment and function description
>sp|P13508|GLP1_CAEEL Protein glp-1 OS=Caenorhabditis elegans GN=glp-1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
328714521 16577 PREDICTED: hypothetical protein LOC10016 0.860 0.012 0.618 5e-63
270013391 21117 hypothetical protein TcasGA2_TC011986 [T 0.868 0.009 0.636 5e-62
195433142 3792 GK23922 [Drosophila willistoni] gi|19416 0.868 0.055 0.588 2e-61
158299052 3202 AGAP010024-PA [Anopheles gambiae str. PE 0.851 0.064 0.602 4e-60
198475573 17011 GA26108 [Drosophila pseudoobscura pseudo 0.868 0.012 0.572 1e-59
157133857 5429 hypothetical protein AaeL_AAEL012905 [Ae 0.860 0.038 0.592 5e-59
442625928 19560 dumpy, isoform AA [Drosophila melanogast 0.864 0.010 0.601 2e-58
442625920 18014 dumpy, isoform W [Drosophila melanogaste 0.864 0.011 0.601 2e-58
442625916 21657 dumpy, isoform U [Drosophila melanogaste 0.864 0.009 0.601 3e-58
442625914 22300 dumpy, isoform T [Drosophila melanogaste 0.864 0.009 0.601 3e-58
>gi|328714521|ref|XP_003245382.1| PREDICTED: hypothetical protein LOC100166039 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  246 bits (629), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 133/215 (61%), Positives = 155/215 (72%), Gaps = 6/215 (2%)

Query: 7     RVINHNPSCTCKAGFTGDPRVFCSRIPPPPPQESPPEYVNPCIPSPCGPYSQCRDINGSP 66
             +VINH+P CTC+  FTGDP   C  IP P PQ  P EYVNPCIPSPCGPYSQC D  G P
Sbjct: 11950 KVINHSPICTCRPKFTGDPFTHCFPIPLPLPQYVPTEYVNPCIPSPCGPYSQCYDNQGVP 12009

Query: 67    SCSCLPNYIGAPPNCRPECVQNTECPYDKACINEKCRDPCPGSCGQGAQCRVINHSPVCY 126
             SCSCL  Y G+PPNCRPECV N+ECP +KACI+E CRDPCPGSCG  A+C V+NH+P+C 
Sbjct: 12010 SCSCLSQYTGSPPNCRPECVMNSECPSNKACISEHCRDPCPGSCGYNAECNVLNHTPMCV 12069

Query: 127   CPDGFIGDAFSSCYPKPIEPIQAPEQQADPCI---CAPNAVCRDNVCVCLPDYYGDGYTV 183
             CP G IGD F+SCY KP E I  P   +DPC    C  NA C + VC CL +Y G+ Y  
Sbjct: 12070 CPYGMIGDPFTSCYSKPQENI--PVVHSDPCNPSPCGYNAECNNGVCTCLLEYQGNPYMG 12127

Query: 184   CRPECIRNSDCANNKACIRNKCKNPCVPGTCGEGA 218
             CRPEC+ N+DC   +ACI+NKCK+PC PG CG+ A
Sbjct: 12128 CRPECVINNDCPQKEACIKNKCKDPC-PGICGQNA 12161




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270013391|gb|EFA09839.1| hypothetical protein TcasGA2_TC011986 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195433142|ref|XP_002064574.1| GK23922 [Drosophila willistoni] gi|194160659|gb|EDW75560.1| GK23922 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|158299052|ref|XP_319172.4| AGAP010024-PA [Anopheles gambiae str. PEST] gi|157014183|gb|EAA13876.4| AGAP010024-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|198475573|ref|XP_002132955.1| GA26108 [Drosophila pseudoobscura pseudoobscura] gi|198138883|gb|EDY70357.1| GA26108 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|157133857|ref|XP_001663043.1| hypothetical protein AaeL_AAEL012905 [Aedes aegypti] gi|108870667|gb|EAT34892.1| AAEL012905-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|442625928|ref|NP_001260042.1| dumpy, isoform AA [Drosophila melanogaster] gi|440213327|gb|AGB92578.1| dumpy, isoform AA [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442625920|ref|NP_001260038.1| dumpy, isoform W [Drosophila melanogaster] gi|440213323|gb|AGB92574.1| dumpy, isoform W [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442625916|ref|NP_001260036.1| dumpy, isoform U [Drosophila melanogaster] gi|440213321|gb|AGB92572.1| dumpy, isoform U [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442625914|ref|NP_001260035.1| dumpy, isoform T [Drosophila melanogaster] gi|440213320|gb|AGB92571.1| dumpy, isoform T [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
FB|FBgn005319622 dp "dumpy" [Drosophila melanog 0.864 9.545 0.574 2.4e-68
WB|WBGene00022816 2687 fbn-1 [Caenorhabditis elegans 0.707 0.064 0.288 2.5e-14
UNIPROTKB|F1M294202 LOC680396 "Protein LOC680396" 0.617 0.742 0.312 6.4e-12
UNIPROTKB|Q9BYR0210 KRTAP4-7 "Keratin-associated p 0.646 0.747 0.3 6.4e-12
UNIPROTKB|I3LR68224 I3LR68 "Uncharacterized protei 0.666 0.723 0.276 1.3e-11
UNIPROTKB|E1BMY6199 LOC100141108 "Uncharacterized 0.654 0.798 0.308 2.2e-11
WB|WBGene00003738 1584 nid-1 [Caenorhabditis elegans 0.781 0.119 0.268 2.3e-11
UNIPROTKB|P60411292 KRTAP10-9 "Keratin-associated 0.637 0.530 0.296 9.2e-11
UNIPROTKB|E1BJ92199 LOC100848678 "Uncharacterized 0.617 0.753 0.304 9.4e-11
UNIPROTKB|F1LV66188 LOC680396 "Protein LOC680396" 0.600 0.776 0.272 1.2e-10
FB|FBgn0053196 dp "dumpy" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 720 (258.5 bits), Expect = 2.4e-68, Sum P(2) = 2.4e-68
 Identities = 124/216 (57%), Positives = 150/216 (69%)

Query:     7 RVINHNPSCTCKAGFTGDPRVFCSRIXXXXXXXXXXXYVNPCIPSPCGPYSQCRDINGSP 66
             RV NHNP CTC +GFTGDP   C R             ++PC+PSPCG  SQCR+I+G+P
Sbjct: 14244 RVRNHNPICTCLSGFTGDPFTRCYR-QPPPPPVVEREPLDPCVPSPCGANSQCREIHGTP 14302

Query:    67 SCSCLPNYIGAPPNCRPECVQNTECPYDKACINEKCRDPCPGSCGQGAQCRVINHSPVCY 126
             SCSCLP Y+G PPNCRPEC  N ECP  +ACIN+KCRDPCPGSCG   QC VINH+P+C 
Sbjct: 14303 SCSCLPQYLGTPPNCRPECSINAECPSHQACINQKCRDPCPGSCGLNTQCSVINHTPICS 14362

Query:   127 CPDGFIGDAFSSCYPKPI-EPIQAPEQQADPCI---CAPNAVCRDNVCVCLPDYYGDGYT 182
             C  G+IGD FS C P+PI E I+ P    DPC    C  N  C + VC CLP+Y+GD YT
Sbjct: 14363 CLAGYIGDPFSVCNPEPIPEKIRDPLPPEDPCNPSPCGSNTQCNNGVCSCLPEYHGDPYT 14422

Query:   183 VCRPECIRNSDCANNKACIRNKCKNPCVPGTCGEGA 218
              CRPEC+ ++DC  ++AC+R+KC +PC PGTCG  A
Sbjct: 14423 GCRPECVLHTDCDRSRACVRHKCVDPC-PGTCGTNA 14457


GO:0007475 "apposition of dorsal and ventral imaginal disc-derived wing surfaces" evidence=IMP
GO:0005578 "proteinaceous extracellular matrix" evidence=NAS
GO:0007424 "open tracheal system development" evidence=IMP
GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=IEA
GO:0004867 "serine-type endopeptidase inhibitor activity" evidence=IEA
GO:0004519 "endonuclease activity" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0008362 "chitin-based embryonic cuticle biosynthetic process" evidence=IMP
GO:0040005 "chitin-based cuticle attachment to epithelium" evidence=IMP
GO:0031012 "extracellular matrix" evidence=ISM
GO:0005201 "extracellular matrix structural constituent" evidence=ISM
GO:0046331 "lateral inhibition" evidence=IMP
WB|WBGene00022816 fbn-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1M294 LOC680396 "Protein LOC680396" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BYR0 KRTAP4-7 "Keratin-associated protein 4-7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LR68 I3LR68 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BMY6 LOC100141108 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
WB|WBGene00003738 nid-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|P60411 KRTAP10-9 "Keratin-associated protein 10-9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BJ92 LOC100848678 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1LV66 LOC680396 "Protein LOC680396" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 243
KOG1214|consensus 1289 99.59
KOG1214|consensus 1289 99.45
KOG1219|consensus 4289 99.25
KOG1219|consensus 4289 99.2
KOG1225|consensus 525 99.14
KOG4289|consensus 2531 99.03
KOG1225|consensus 525 98.97
KOG1217|consensus487 98.96
KOG1217|consensus487 98.86
KOG4289|consensus 2531 98.78
KOG4260|consensus350 98.19
KOG1226|consensus 783 97.98
KOG1226|consensus 783 97.96
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.93
KOG4260|consensus350 97.85
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.82
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.82
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.79
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.76
KOG0994|consensus 1758 97.63
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.5
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.44
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 97.43
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.23
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 97.18
smart0018135 EGF Epidermal growth factor-like domain. 96.69
cd0005336 EGF Epidermal growth factor domain, found in epide 96.67
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 96.66
PF1266224 cEGF: Complement Clr-like EGF-like 96.32
PF1266224 cEGF: Complement Clr-like EGF-like 96.21
KOG0994|consensus 1758 96.17
cd0005336 EGF Epidermal growth factor domain, found in epide 96.03
smart0018135 EGF Epidermal growth factor-like domain. 96.01
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 95.94
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 95.91
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 95.02
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 94.36
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 93.89
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 93.23
smart0005163 DSL delta serrate ligand. 92.34
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 91.77
smart0005163 DSL delta serrate ligand. 88.78
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 88.66
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 84.36
PF0168352 EB: EB module; InterPro: IPR006149 The EB domain h 83.61
KOG1836|consensus 1705 83.56
KOG1218|consensus316 82.72
>KOG1214|consensus Back     alignment and domain information
Probab=99.59  E-value=1.8e-14  Score=131.49  Aligned_cols=189  Identities=26%  Similarity=0.601  Sum_probs=127.9

Q ss_pred             CCeeeecC-CCceeecCCCCccCCCCCCcCCCCCCCCCCCCCCCCCCCC--CCCCCCCeeeeCCCCCeeecCCCcc--cC
Q psy13148          3 AKLLRVIN-HNPSCTCKAGFTGDPRVFCSRIPPPPPQESPPEYVNPCIP--SPCGPYSQCRDINGSPSCSCLPNYI--GA   77 (243)
Q Consensus         3 ~~~C~~~~-~~~~C~C~~G~~g~~~~~C~~~~~~~~~~~~~~~~~~C~~--~~C~~~~~C~~~~g~~~C~C~~G~~--g~   77 (243)
                      ++.|+... -.|+|.|..||.|++.. |             .|+++|+.  +.|+++++|++.+++|+|.|..||.  ++
T Consensus       705 ~a~C~pg~~~~~tcecs~g~~gdgr~-c-------------~d~~eca~~~~~CGp~s~Cin~pg~~rceC~~gy~F~dd  770 (1289)
T KOG1214|consen  705 TARCHPGTGVDYTCECSSGYQGDGRN-C-------------VDENECATGFHRCGPNSVCINLPGSYRCECRSGYEFADD  770 (1289)
T ss_pred             CccccCCCCcceEEEEeeccCCCCCC-C-------------CChhhhccCCCCCCCCceeecCCCceeEEEeecceeccC
Confidence            45677654 37899999999999874 5             78889985  5699999999999999999998875  44


Q ss_pred             CCCCccCCC--CCCCCCCCCcccCCcccCCCCCCCCCCC--eeeeCC-CCceeeCCCCCccCCCCCCccCCCCCCCCCCC
Q psy13148         78 PPNCRPECV--QNTECPYDKACINEKCRDPCPGSCGQGA--QCRVIN-HSPVCYCPDGFIGDAFSSCYPKPIEPIQAPEQ  152 (243)
Q Consensus        78 ~~~c~~~C~--~~~~C~~~~~C~~~~C~~~C~~~C~~~~--~C~~~~-g~~~C~C~~G~~g~~~~~C~~~~~~~~~~~~~  152 (243)
                      +.+|...-.  .++.|...            .+.|...+  .|+... +.|.|.|.|||.|++.. |.            
T Consensus       771 ~~tCV~i~~pap~n~Ce~g------------~h~C~i~g~a~c~~hGgs~y~C~CLPGfsGDG~~-c~------------  825 (1289)
T KOG1214|consen  771 RHTCVLITPPAPANPCEDG------------SHTCAIAGQARCVHHGGSTYSCACLPGFSGDGHQ-CT------------  825 (1289)
T ss_pred             CcceEEecCCCCCCccccC------------ccccCcCCceEEEecCCceEEEeecCCccCCccc-cc------------
Confidence            443332100  12233222            34565444  455544 44999999999999987 87            


Q ss_pred             CCcCC---CCCCCCeeeCC----ceecCCCcccCCCccCCCCCCCCCCCCCCCcccCCCccCCCCCCCCCCCC---eeec
Q psy13148        153 QADPC---ICAPNAVCRDN----VCVCLPDYYGDGYTVCRPECIRNSDCANNKACIRNKCKNPCVPGTCGEGA---SSWT  222 (243)
Q Consensus       153 ~~~~C---~C~~~~~C~~~----~C~C~~G~~G~~c~~~~~~C~~~~~C~~~~~C~~~~C~~~C~~~~C~~~~---~C~~  222 (243)
                      ++|+|   .|+..++|+++    .|+|.+||.||+.+ +++.=....+|...          .=-+-.|+.++   .|++
T Consensus       826 dvDeC~psrChp~A~CyntpgsfsC~C~pGy~GDGf~-CVP~~~~~T~C~~e----------r~hpl~chg~t~~~~~~D  894 (1289)
T KOG1214|consen  826 DVDECSPSRCHPAATCYNTPGSFSCRCQPGYYGDGFQ-CVPDTSSLTPCEQE----------RFHPLQCHGSTGFCWCVD  894 (1289)
T ss_pred             cccccCccccCCCceEecCCCcceeecccCccCCCce-ecCCCccCCccccc----------cccceeeccccceeEeeC
Confidence            78999   79999999987    89999999999987 55442222234321          00022344444   2334


Q ss_pred             CC---ccc-CcccCCCceeeecc
Q psy13148        223 TG---CTA-EKKRNDTIYSLARL  241 (243)
Q Consensus       223 ~~---C~c-~g~~g~~~~~c~~~  241 (243)
                      ..   +.+ ++..|++.-+|..+
T Consensus       895 p~~~e~p~~~~ppG~~~~~c~~~  917 (1289)
T KOG1214|consen  895 PDGHEVPGTQTPPGSTPPHCGPS  917 (1289)
T ss_pred             CCcccCCCCCCCCCCCCCCCCCc
Confidence            42   666 67777777666544



>KOG1214|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>PF01683 EB: EB module; InterPro: IPR006149 The EB domain has no known function Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 3e-06
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 2e-05
3v65_B 386 Low-density lipoprotein receptor-related protein; 3e-04
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
 Score = 46.5 bits (110), Expect = 3e-06
 Identities = 42/196 (21%), Positives = 63/196 (32%), Gaps = 38/196 (19%)

Query: 45  VNPCIPSPCGPYSQCRDI-NGSPSC-SCLPNYIGAPPNCRP--ECVQNTECPYDKACINE 100
            + C+ +PC P +QC    +GS SC  C   ++G   +C    EC               
Sbjct: 3   PDGCLSNPCFPGAQCSSFPDGSWSCGFCPVGFLGNGTHCEDLDECALVP----------- 51

Query: 101 KCRDPCPGSCGQGAQCRVINHSPVCY-CPDGFIGDAFSSCYPKPIEPIQAPEQQADPC-- 157
              D C  S  +  +C        C  CP  + G+       +  +  +   +  +PC  
Sbjct: 52  ---DIC-FSTSKVPRCVNTQPGFHCLPCPPRYRGNQPVGVGLEAAKTEKQVCEPENPCKD 107

Query: 158 ---ICAPNAVCRDN--------VCVCLPDYYGDGYTVCRPECI-----RNSDCANNKACI 201
               C  +A C            C C   Y GDG        +      N  CA N    
Sbjct: 108 KTHNCHKHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNATYH 167

Query: 202 RNKCKNPCVPGTCGEG 217
             K   P +P +  E 
Sbjct: 168 CIKDNCPHLPNSGQED 183


>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.82
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.82
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.8
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.74
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.7
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.68
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.68
2bou_A143 EGF-like module containing mucin-like hormone rece 99.67
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.67
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.63
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.61
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.59
2bou_A143 EGF-like module containing mucin-like hormone rece 99.53
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.52
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.47
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.44
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.4
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.36
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.35
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.33
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.33
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.33
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.32
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.3
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.29
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.28
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.25
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.25
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.21
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.18
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.14
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.13
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.09
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 99.08
2vh0_B134 Activated factor XA light chain; serine protease, 99.08
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 99.05
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.04
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.03
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 99.01
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 98.99
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.96
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 98.93
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 98.89
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 98.89
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.86
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.79
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.78
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 98.75
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.67
2vh0_B134 Activated factor XA light chain; serine protease, 98.64
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.51
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.5
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.45
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.4
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.36
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.33
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.29
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 98.28
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.26
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.18
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.1
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.05
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.03
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.99
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 97.97
3v65_B 386 Low-density lipoprotein receptor-related protein; 97.93
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.88
1a3p_A45 Epidermal growth factor; disulfide connectivities, 97.77
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 97.73
2k2s_B61 Micronemal protein 6; microneme protein complex, c 97.71
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.7
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 97.63
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.62
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.62
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.62
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 97.53
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.51
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.45
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.44
1ob1_C99 Major merozoite surface protein; immune system, im 97.44
1a3p_A45 Epidermal growth factor; disulfide connectivities, 97.42
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 97.36
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.3
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 97.26
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 97.25
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 97.22
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 97.19
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.14
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.14
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 97.09
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.05
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 97.03
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 96.99
1nql_B53 Epidermal growth factor; cell surface receptor, ty 96.84
1nql_B53 Epidermal growth factor; cell surface receptor, ty 96.79
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 96.77
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 96.74
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 96.7
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 96.64
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 96.64
1ob1_C99 Major merozoite surface protein; immune system, im 96.42
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 96.38
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 95.92
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 95.84
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 95.73
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 95.54
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 95.54
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 95.46
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 95.43
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 95.43
1oig_A26 Dumpy, CG33196-PB; structural protein; NMR {Drosop 95.07
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 95.05
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 95.05
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 94.53
1oig_A26 Dumpy, CG33196-PB; structural protein; NMR {Drosop 94.11
1szb_A170 Mannose binding lectin-associated serine protease- 93.8
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 93.52
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 93.16
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 93.01
2wph_E59 Coagulation factor IXA light chain; serine proteas 92.65
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 92.32
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 92.2
2wph_E59 Coagulation factor IXA light chain; serine proteas 91.84
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 91.71
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 91.7
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 91.6
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 91.55
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 91.34
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 91.31
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 90.9
1b9w_A95 Protein (merozoite surface protein 1); MSP-1, cand 90.64
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 90.25
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 90.25
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 90.11
2i9a_A145 Urokinase-type plasminogen activator; growth facto 89.74
2i9a_A145 Urokinase-type plasminogen activator; growth facto 89.12
1szb_A170 Mannose binding lectin-associated serine protease- 88.77
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 87.77
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 87.17
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 82.91
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 82.55
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 81.99
1nzi_A159 Complement C1S component; calcium, innate immunity 80.82
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
Probab=99.82  E-value=4.4e-22  Score=157.67  Aligned_cols=135  Identities=27%  Similarity=0.651  Sum_probs=111.8

Q ss_pred             CCeeeecCCCceeecCCCCccCCCCCCcCCCCCCCCCCCCCCCCCCC----CCCCCCCCeeeeCC-----CCCeeecCCC
Q psy13148          3 AKLLRVINHNPSCTCKAGFTGDPRVFCSRIPPPPPQESPPEYVNPCI----PSPCGPYSQCRDIN-----GSPSCSCLPN   73 (243)
Q Consensus         3 ~~~C~~~~~~~~C~C~~G~~g~~~~~C~~~~~~~~~~~~~~~~~~C~----~~~C~~~~~C~~~~-----g~~~C~C~~G   73 (243)
                      |++|+++.++|+|.|++||+|.....|             +++++|.    ..+|.++++|+++.     ++|.|.|++|
T Consensus        15 ng~C~~~~g~~~C~C~~G~~g~~~~~C-------------~~id~C~~~~~~~~C~~~~~C~~~~~~~~~g~y~C~C~~G   81 (186)
T 1z1y_A           15 NGQLVQMSNHFXCMCNEGLVHLSENTC-------------EEXNECXXETLGXACGEFGQCIENPDPAQVNMYXCGCIEG   81 (186)
T ss_dssp             TEEEEECSSCEEEEECTTEEEEETTEE-------------EECCCCSGGGTTSEEETTEEEEECSSTTSSCSEEEEECTT
T ss_pred             CCEeECCCCCeEeECCCCCccCCCCcc-------------CCCCcccCCCCCCCCCCCCEeecCCCCcCCCCEECCCCCC
Confidence            569999999999999999998744356             6789998    67899999999998     8999999999


Q ss_pred             cccCCCCCccCCCCCCCCCCCCcccCCcccCCCCCCCCCCCeee----eCCCCceeeCCCCCcc---CCCCCCccCCCCC
Q psy13148         74 YIGAPPNCRPECVQNTECPYDKACINEKCRDPCPGSCGQGAQCR----VINHSPVCYCPDGFIG---DAFSSCYPKPIEP  146 (243)
Q Consensus        74 ~~g~~~~c~~~C~~~~~C~~~~~C~~~~C~~~C~~~C~~~~~C~----~~~g~~~C~C~~G~~g---~~~~~C~~~~~~~  146 (243)
                      |+|...    .|. +++|...              +|.++++|+    +..++|+|.|++||+|   ++. .|+      
T Consensus        82 ~~g~~~----~C~-~d~C~~~--------------~C~~~g~C~~~~~~~~g~~~C~C~~Gy~g~~~~~~-~C~------  135 (186)
T 1z1y_A           82 YTLXED----TCV-LDVCQYX--------------NCGESGECIVEYLSEIQSAGCSCAIGXVPNPEDEX-XCT------  135 (186)
T ss_dssp             EEEETT----EEE-EGGGTTC--------------CCCTTEEEEEEEETTEEEEEEEECTEEEEETTTTT-EEE------
T ss_pred             CccCCC----CCC-CCcCcCC--------------CCCCCCEEeeCCcCCCCCceEECCCCCcccCCCCC-cce------
Confidence            999832    333 4566543              688889998    7778899999999999   434 487      


Q ss_pred             CCCCCCCC--cCC--CC-CCCCeeeCC----ceecCCCcccCCCc
Q psy13148        147 IQAPEQQA--DPC--IC-APNAVCRDN----VCVCLPDYYGDGYT  182 (243)
Q Consensus       147 ~~~~~~~~--~~C--~C-~~~~~C~~~----~C~C~~G~~G~~c~  182 (243)
                            ++  ++|  +| .++++|++.    +|.|++||+|+.+.
T Consensus       136 ------~~~~~~C~~~C~~~~~~C~n~~g~y~C~C~~G~~g~~~~  174 (186)
T 1z1y_A          136 ------XTGETACQLXCNTDNEVCXNVEGVYXCQCMEGFTFDXEX  174 (186)
T ss_dssp             ------EEECCCCCCCCCTTTEEEEEETTEEEEEECTTCEEETTT
T ss_pred             ------EcCCCcccccccccCcceecCCCCeeeECCCCCccCccc
Confidence                  43  788  89 888999876    79999999998876



>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1b9w_A Protein (merozoite surface protein 1); MSP-1, candidate malaria vaccine, surface antigen; 1.80A {Plasmodium cynomolgi} SCOP: g.3.11.4 g.3.11.4 PDB: 2npr_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.73
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.71
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.66
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.66
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.59
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.53
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.5
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.48
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.36
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.3
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.26
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.24
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.2
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.18
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.16
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.14
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.12
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.1
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 98.07
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.02
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.98
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.98
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.95
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.95
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.91
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.9
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.81
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.81
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.78
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.73
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 97.7
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.65
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 97.64
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.64
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.63
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.63
d1i0ua241 Low density lipoprotein (LDL) receptor, different 97.62
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.55
d1szba245 Mannose-binding protein associated serine protease 97.42
d1nt0a345 Mannose-binding protein associated serine protease 97.39
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 97.28
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.25
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.16
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 97.08
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 96.91
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 96.89
d1i0ua241 Low density lipoprotein (LDL) receptor, different 96.86
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 96.71
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 96.67
d1szba245 Mannose-binding protein associated serine protease 96.6
d1nt0a345 Mannose-binding protein associated serine protease 96.55
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 96.49
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 96.42
d3bpse140 Low density lipoprotein (LDL) receptor, different 96.38
d3bpse140 Low density lipoprotein (LDL) receptor, different 96.15
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 96.11
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 95.75
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 95.17
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 95.15
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 94.1
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 93.8
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 93.77
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 93.67
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 93.42
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 93.02
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 92.91
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 92.75
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 92.67
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 92.54
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 92.53
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 92.25
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 92.02
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 92.01
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 91.1
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 90.51
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 90.18
d1oiga_26 Dumpy {Fruit fly (Drosophila melanogaster) [TaxId: 86.7
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 85.03
d1ijqa250 Low density lipoprotein (LDL) receptor, different 83.94
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 83.71
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Neurogenic locus notch homolog protein 1, Notch1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.73  E-value=5e-09  Score=60.12  Aligned_cols=35  Identities=34%  Similarity=0.821  Sum_probs=32.3

Q ss_pred             CCCCCCC--CCCCCCCCeeeeCCCCCeeecCCCcccC
Q psy13148         43 EYVNPCI--PSPCGPYSQCRDINGSPSCSCLPNYIGA   77 (243)
Q Consensus        43 ~~~~~C~--~~~C~~~~~C~~~~g~~~C~C~~G~~g~   77 (243)
                      +|||+|.  ++||.++++|+++.++|+|.|++||+|.
T Consensus         1 qDideC~~~~~pC~n~g~C~n~~g~y~C~C~~G~~G~   37 (42)
T d2vj3a1           1 QDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGP   37 (42)
T ss_dssp             CCCCTTTSSSCSSSTTCEEEECSSSEEEECCTTEEST
T ss_pred             CCCccccCCCCCCCCCcEeECCCCCEEeECCCCCcCC
Confidence            3788997  5799999999999999999999999999



>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oiga_ g.3.18.1 (A:) Dumpy {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure