Psyllid ID: psy13148

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---

MFAKLLRVINHNPSCTCKAGFTGDPRVFCSRIPPPPPQESPPEYVNPCIPSPCGPYSQCRDINGSPSCSCLPNYIGAPPNCRPECVQNTECPYDKACINEKCRDPCPGSCGQGAQCRVINHSPVCYCPDGFIGDAFSSCYPKPIEPIQAPEQQADPCICAPNAVCRDNVCVCLPDYYGDGYTVCRPECIRNSDCANNKACIRNKCKNPCVPGTCGEGASSWTTGCTAEKKRNDTIYSLARLSK

ccccEEEEcccccEEEcccccccccccccccccccccccccccccccccccccccccEEEEcccccEEEcccccEEccccccccccccccccccccccccccccccccccccccEEEEccccEEEEcccccccccccccccccccccccccccccccccccccEEEccEEEcccccEEcccEEcccccccccccccccEEccccccccccccccccccEEccccccccccccccccccccccc

ccHHHEEEEccccEEEcccccccccccccccccccccccccccccccccccccccccEEEEccccEEEEccccccccccccccccccccccccccHHHccccccccccccccccEEEEEccccEEEccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccHHHcccccccccccccccccEEEEEEcccccccccccccHHHHcc

MFAKLLRVInhnpsctckagftgdprvfcsripppppqesppeyvnpcipspcgpysqcrdingspscsclpnyigappncrpecvqntecpydkacinekcrdpcpgscgqgaqcrvinhspvcycpdgfigdafsscypkpiepiqapeqqadpcicapnavcrdnvcvclpdyygdgytvcrpecirnsdcannkacirnkcknpcvpgtcgegasswttgctaekkrnDTIYSLARLSK

MFAKLLRVInhnpsctckagfTGDPRVFCSRIPPPPPQESPPEYVNPCIPSPCGPYSQCRDINGSPSCSCLPNYIGAPPNCRPECVQNTECPYDKACINEKCRDPCPGSCGQGAQCRVINHSPVCYCPDGFIGDAFSSCYPKPIEPIQAPEQQADPCICAPNAVCRDNVCVCLPDYYGDGYTVCRPECIRNSDCANNKACIrnkcknpcvpgtcgegasswttgctaekkrndtiyslarlsk

MFAKLLRVINHNPSCTCKAGFTGDPRVFCSRIpppppqesppeYVNPCIPSPCGPYSQCRDINGSPSCSCLPNYIGAPPNCRPECVQNTECPYDKACINEKCRDPCPGSCGQGAQCRVINHSPVCYCPDGFIGDAFSSCYPKPIEPIQAPEQQADPCICAPNAVCRDNVCVCLPDYYGDGYTVCRPECIRNSDCANNKACIRNKCKNPCVPGTCGEGASSWTTGCTAEKKRNDTIYSLARLSK

***********************************************CIPSPCGPYSQCRDINGSPSCSCLPNYIGAPPNCRPECVQNTECPYDKACINEKCRDPCPGSCGQGAQCRVINHSPVCYCPDGFIGDAFSSCYPKPIEPIQAPEQQADPCICAPNAVCRDNVCVCLPDYYGDGYTVCRPECIRNSDCANNKACIRNKCKNPCVPGTCGEGASSWTTGCTA****************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		243	2.2.26 [Sep-21-2011]
P33450		5147	Cadherin-related tumor su	no	N/A	0.432	0.020	0.304	1e-06
O88278		3313	Cadherin EGF LAG seven-pa	yes	N/A	0.679	0.049	0.265	4e-06
Q91ZI0		3301	Cadherin EGF LAG seven-pa	yes	N/A	0.613	0.045	0.271	1e-05
Q9NYQ7		3312	Cadherin EGF LAG seven-pa	yes	N/A	0.679	0.049	0.252	6e-05
Q8UWJ4		717	Delta-like protein D OS=D	yes	N/A	0.728	0.246	0.292	9e-05
P13508		1295	Protein glp-1 OS=Caenorha	no	N/A	0.670	0.125	0.257	0.0005

>sp\|P33450\|FAT_DROME Cadherin-related tumor suppressor OS=Drosophila melanogaster GN=ft PE=1 SV=3	Back alignment and function desciption

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 43/141 (30%), Positives = 57/141 (40%), Gaps = 36/141 (25%)

Query: 7    RVINHNPSCTCKAGFTGDPRVFCSRIPPPPPQESPPEYVNPCIPSPCGPYSQCRDINGSP 66
            RV+ H+ SC C +GF+G+    CSR              +PC+P+PC    QCR +    
Sbjct: 3992 RVV-HDYSCQCTSGFSGEQ---CSR------------RQDPCLPNPCHSQVQCRRLGSDF 4035

Query: 67   SCSCLPNYIGAPPNCRPECVQNTECPYDKACINEKCRDPCPGSCGQGAQCRVINHSPVCY 126
             C C  N  G   +C  E    ++  Y K C N        GSC +         S  C 
Sbjct: 4036 QCMCPANRDGK--HCEKE---RSDVCYSKPCRNG-------GSCQRSPD----GSSYFCL 4079

Query: 127  CPDGFIGD----AFSSCYPKP 143
            C  GF G+       SC P P
Sbjct: 4080 CRPGFRGNQCESVSDSCRPNP 4100

Could function as a cell-adhesion protein. Acts as a tumor suppressor. Required for correct morphogenesis.
Drosophila melanogaster (taxid: 7227)

>sp\|O88278\|CELR3_RAT Cadherin EGF LAG seven-pass G-type receptor 3 OS=Rattus norvegicus GN=Celsr3 PE=2 SV=1	Back alignment and function description

>sp\|Q91ZI0\|CELR3_MOUSE Cadherin EGF LAG seven-pass G-type receptor 3 OS=Mus musculus GN=Celsr3 PE=2 SV=2	Back alignment and function description

>sp\|Q9NYQ7\|CELR3_HUMAN Cadherin EGF LAG seven-pass G-type receptor 3 OS=Homo sapiens GN=CELSR3 PE=1 SV=2	Back alignment and function description

>sp\|Q8UWJ4\|DLLD_DANRE Delta-like protein D OS=Danio rerio GN=dld PE=1 SV=2	Back alignment and function description

>sp\|P13508\|GLP1_CAEEL Protein glp-1 OS=Caenorhabditis elegans GN=glp-1 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		243
328714521		16577	PREDICTED: hypothetical protein LOC10016	0.860	0.012	0.618	5e-63
270013391		21117	hypothetical protein TcasGA2_TC011986 [T	0.868	0.009	0.636	5e-62
195433142		3792	GK23922 [Drosophila willistoni] gi\|19416	0.868	0.055	0.588	2e-61
158299052		3202	AGAP010024-PA [Anopheles gambiae str. PE	0.851	0.064	0.602	4e-60
198475573		17011	GA26108 [Drosophila pseudoobscura pseudo	0.868	0.012	0.572	1e-59
157133857		5429	hypothetical protein AaeL_AAEL012905 [Ae	0.860	0.038	0.592	5e-59
442625928		19560	dumpy, isoform AA [Drosophila melanogast	0.864	0.010	0.601	2e-58
442625920		18014	dumpy, isoform W [Drosophila melanogaste	0.864	0.011	0.601	2e-58
442625916		21657	dumpy, isoform U [Drosophila melanogaste	0.864	0.009	0.601	3e-58
442625914		22300	dumpy, isoform T [Drosophila melanogaste	0.864	0.009	0.601	3e-58

>gi\|328714521\|ref\|XP_003245382.1\| PREDICTED: hypothetical protein LOC100166039 [Acyrthosiphon pisum]	Back alignment and taxonomy information

 Score =  246 bits (629), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 133/215 (61%), Positives = 155/215 (72%), Gaps = 6/215 (2%)

Query: 7     RVINHNPSCTCKAGFTGDPRVFCSRIPPPPPQESPPEYVNPCIPSPCGPYSQCRDINGSP 66
             +VINH+P CTC+  FTGDP   C  IP P PQ  P EYVNPCIPSPCGPYSQC D  G P
Sbjct: 11950 KVINHSPICTCRPKFTGDPFTHCFPIPLPLPQYVPTEYVNPCIPSPCGPYSQCYDNQGVP 12009

Query: 67    SCSCLPNYIGAPPNCRPECVQNTECPYDKACINEKCRDPCPGSCGQGAQCRVINHSPVCY 126
             SCSCL  Y G+PPNCRPECV N+ECP +KACI+E CRDPCPGSCG  A+C V+NH+P+C 
Sbjct: 12010 SCSCLSQYTGSPPNCRPECVMNSECPSNKACISEHCRDPCPGSCGYNAECNVLNHTPMCV 12069

Query: 127   CPDGFIGDAFSSCYPKPIEPIQAPEQQADPCI---CAPNAVCRDNVCVCLPDYYGDGYTV 183
             CP G IGD F+SCY KP E I  P   +DPC    C  NA C + VC CL +Y G+ Y  
Sbjct: 12070 CPYGMIGDPFTSCYSKPQENI--PVVHSDPCNPSPCGYNAECNNGVCTCLLEYQGNPYMG 12127

Query: 184   CRPECIRNSDCANNKACIRNKCKNPCVPGTCGEGA 218
             CRPEC+ N+DC   +ACI+NKCK+PC PG CG+ A
Sbjct: 12128 CRPECVINNDCPQKEACIKNKCKDPC-PGICGQNA 12161

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|270013391\|gb\|EFA09839.1\| hypothetical protein TcasGA2_TC011986 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|195433142\|ref\|XP_002064574.1\| GK23922 [Drosophila willistoni] gi\|194160659\|gb\|EDW75560.1\| GK23922 [Drosophila willistoni]	Back alignment and taxonomy information

>gi\|158299052\|ref\|XP_319172.4\| AGAP010024-PA [Anopheles gambiae str. PEST] gi\|157014183\|gb\|EAA13876.4\| AGAP010024-PA [Anopheles gambiae str. PEST]	Back alignment and taxonomy information

>gi\|198475573\|ref\|XP_002132955.1\| GA26108 [Drosophila pseudoobscura pseudoobscura] gi\|198138883\|gb\|EDY70357.1\| GA26108 [Drosophila pseudoobscura pseudoobscura]	Back alignment and taxonomy information

>gi\|157133857\|ref\|XP_001663043.1\| hypothetical protein AaeL_AAEL012905 [Aedes aegypti] gi\|108870667\|gb\|EAT34892.1\| AAEL012905-PA [Aedes aegypti]	Back alignment and taxonomy information

>gi\|442625928\|ref\|NP_001260042.1\| dumpy, isoform AA [Drosophila melanogaster] gi\|440213327\|gb\|AGB92578.1\| dumpy, isoform AA [Drosophila melanogaster]	Back alignment and taxonomy information

>gi\|442625920\|ref\|NP_001260038.1\| dumpy, isoform W [Drosophila melanogaster] gi\|440213323\|gb\|AGB92574.1\| dumpy, isoform W [Drosophila melanogaster]	Back alignment and taxonomy information

>gi\|442625916\|ref\|NP_001260036.1\| dumpy, isoform U [Drosophila melanogaster] gi\|440213321\|gb\|AGB92572.1\| dumpy, isoform U [Drosophila melanogaster]	Back alignment and taxonomy information

>gi\|442625914\|ref\|NP_001260035.1\| dumpy, isoform T [Drosophila melanogaster] gi\|440213320\|gb\|AGB92571.1\| dumpy, isoform T [Drosophila melanogaster]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		243
FB\|FBgn0053196		22	dp "dumpy" [Drosophila melanog	0.864	9.545	0.574	2.4e-68
WB\|WBGene00022816		2687	fbn-1 [Caenorhabditis elegans	0.707	0.064	0.288	2.5e-14
UNIPROTKB\|F1M294		202	LOC680396 "Protein LOC680396"	0.617	0.742	0.312	6.4e-12
UNIPROTKB\|Q9BYR0		210	KRTAP4-7 "Keratin-associated p	0.646	0.747	0.3	6.4e-12
UNIPROTKB\|I3LR68		224	I3LR68 "Uncharacterized protei	0.666	0.723	0.276	1.3e-11
UNIPROTKB\|E1BMY6		199	LOC100141108 "Uncharacterized	0.654	0.798	0.308	2.2e-11
WB\|WBGene00003738		1584	nid-1 [Caenorhabditis elegans	0.781	0.119	0.268	2.3e-11
UNIPROTKB\|P60411		292	KRTAP10-9 "Keratin-associated	0.637	0.530	0.296	9.2e-11
UNIPROTKB\|E1BJ92		199	LOC100848678 "Uncharacterized	0.617	0.753	0.304	9.4e-11
UNIPROTKB\|F1LV66		188	LOC680396 "Protein LOC680396"	0.600	0.776	0.272	1.2e-10

FB\|FBgn0053196 dp "dumpy" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 720 (258.5 bits), Expect = 2.4e-68, Sum P(2) = 2.4e-68
 Identities = 124/216 (57%), Positives = 150/216 (69%)

Query:     7 RVINHNPSCTCKAGFTGDPRVFCSRIXXXXXXXXXXXYVNPCIPSPCGPYSQCRDINGSP 66
             RV NHNP CTC +GFTGDP   C R             ++PC+PSPCG  SQCR+I+G+P
Sbjct: 14244 RVRNHNPICTCLSGFTGDPFTRCYR-QPPPPPVVEREPLDPCVPSPCGANSQCREIHGTP 14302

Query:    67 SCSCLPNYIGAPPNCRPECVQNTECPYDKACINEKCRDPCPGSCGQGAQCRVINHSPVCY 126
             SCSCLP Y+G PPNCRPEC  N ECP  +ACIN+KCRDPCPGSCG   QC VINH+P+C 
Sbjct: 14303 SCSCLPQYLGTPPNCRPECSINAECPSHQACINQKCRDPCPGSCGLNTQCSVINHTPICS 14362

Query:   127 CPDGFIGDAFSSCYPKPI-EPIQAPEQQADPCI---CAPNAVCRDNVCVCLPDYYGDGYT 182
             C  G+IGD FS C P+PI E I+ P    DPC    C  N  C + VC CLP+Y+GD YT
Sbjct: 14363 CLAGYIGDPFSVCNPEPIPEKIRDPLPPEDPCNPSPCGSNTQCNNGVCSCLPEYHGDPYT 14422

Query:   183 VCRPECIRNSDCANNKACIRNKCKNPCVPGTCGEGA 218
              CRPEC+ ++DC  ++AC+R+KC +PC PGTCG  A
Sbjct: 14423 GCRPECVLHTDCDRSRACVRHKCVDPC-PGTCGTNA 14457

GO:0007475 "apposition of dorsal and ventral imaginal disc-derived wing surfaces" evidence=IMP

GO:0005578 "proteinaceous extracellular matrix" evidence=NAS

GO:0007424 "open tracheal system development" evidence=IMP

GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=IEA

GO:0004867 "serine-type endopeptidase inhibitor activity" evidence=IEA

GO:0004519 "endonuclease activity" evidence=IEA

GO:0005509 "calcium ion binding" evidence=IEA

GO:0008362 "chitin-based embryonic cuticle biosynthetic process" evidence=IMP

GO:0040005 "chitin-based cuticle attachment to epithelium" evidence=IMP

GO:0031012 "extracellular matrix" evidence=ISM

GO:0005201 "extracellular matrix structural constituent" evidence=ISM

GO:0046331 "lateral inhibition" evidence=IMP

WB\|WBGene00022816 fbn-1 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

UNIPROTKB\|F1M294 LOC680396 "Protein LOC680396" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9BYR0 KRTAP4-7 "Keratin-associated protein 4-7" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|I3LR68 I3LR68 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BMY6 LOC100141108 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

WB\|WBGene00003738 nid-1 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

UNIPROTKB\|P60411 KRTAP10-9 "Keratin-associated protein 10-9" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BJ92 LOC100848678 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1LV66 LOC680396 "Protein LOC680396" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		243
KOG1214\|consensus		1289		99.59
KOG1214\|consensus		1289		99.45
KOG1219\|consensus		4289		99.25
KOG1219\|consensus		4289		99.2
KOG1225\|consensus		525		99.14
KOG4289\|consensus		2531		99.03
KOG1225\|consensus		525		98.97
KOG1217\|consensus		487		98.96
KOG1217\|consensus		487		98.86
KOG4289\|consensus		2531		98.78
KOG4260\|consensus		350		98.19
KOG1226\|consensus		783		97.98
KOG1226\|consensus		783		97.96
PF07645		42	EGF_CA: Calcium-binding EGF domain; InterPro: IPR0	97.93
KOG4260\|consensus		350		97.85
PF07645		42	EGF_CA: Calcium-binding EGF domain; InterPro: IPR0	97.82
PF12947		36	EGF_3: EGF domain; InterPro: IPR024731 This entry	97.82
smart00179		39	EGF_CA Calcium-binding EGF-like domain.	97.79
PF00008		32	EGF: EGF-like domain This is a sub-family of the P	97.76
KOG0994\|consensus		1758		97.63
PF00008		32	EGF: EGF-like domain This is a sub-family of the P	97.5
PF12947		36	EGF_3: EGF domain; InterPro: IPR024731 This entry	97.44
cd00054		38	EGF_CA Calcium-binding EGF-like domain, present in	97.43
smart00179		39	EGF_CA Calcium-binding EGF-like domain.	97.23
PF06247		197	Plasmod_Pvs28: Plasmodium ookinete surface protein	97.18
smart00181		35	EGF Epidermal growth factor-like domain.	96.69
cd00053		36	EGF Epidermal growth factor domain, found in epide	96.67
cd00054		38	EGF_CA Calcium-binding EGF-like domain, present in	96.66
PF12662		24	cEGF: Complement Clr-like EGF-like	96.32
PF12662		24	cEGF: Complement Clr-like EGF-like	96.21
KOG0994\|consensus		1758		96.17
cd00053		36	EGF Epidermal growth factor domain, found in epide	96.03
smart00181		35	EGF Epidermal growth factor-like domain.	96.01
PF12661		13	hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E	95.94
PF07974		32	EGF_2: EGF-like domain; InterPro: IPR013111 A sequ	95.91
PF07974		32	EGF_2: EGF-like domain; InterPro: IPR013111 A sequ	95.02
PF14670		36	FXa_inhibition: Coagulation Factor Xa inhibitory s	94.36
PF06247		197	Plasmod_Pvs28: Plasmodium ookinete surface protein	93.89
PF14670		36	FXa_inhibition: Coagulation Factor Xa inhibitory s	93.23
smart00051		63	DSL delta serrate ligand.	92.34
PF12946		37	EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730	91.77
smart00051		63	DSL delta serrate ligand.	88.78
cd01475		224	vWA_Matrilin VWA_Matrilin: In cartilaginous plate,	88.66
cd01475		224	vWA_Matrilin VWA_Matrilin: In cartilaginous plate,	84.36
PF01683		52	EB: EB module; InterPro: IPR006149 The EB domain h	83.61
KOG1836\|consensus		1705		83.56
KOG1218\|consensus		316		82.72

>KOG1214\|consensus	Back alignment and domain information

Probab=99.59  E-value=1.8e-14  Score=131.49  Aligned_cols=189  Identities=26%  Similarity=0.601  Sum_probs=127.9

Q ss_pred             CCeeeecC-CCceeecCCCCccCCCCCCcCCCCCCCCCCCCCCCCCCCC--CCCCCCCeeeeCCCCCeeecCCCcc--cC
Q psy13148          3 AKLLRVIN-HNPSCTCKAGFTGDPRVFCSRIPPPPPQESPPEYVNPCIP--SPCGPYSQCRDINGSPSCSCLPNYI--GA   77 (243)
Q Consensus         3 ~~~C~~~~-~~~~C~C~~G~~g~~~~~C~~~~~~~~~~~~~~~~~~C~~--~~C~~~~~C~~~~g~~~C~C~~G~~--g~   77 (243)
                      ++.|+... -.|+|.|..||.|++.. |             .|+++|+.  +.|+++++|++.+++|+|.|..||.  ++
T Consensus       705 ~a~C~pg~~~~~tcecs~g~~gdgr~-c-------------~d~~eca~~~~~CGp~s~Cin~pg~~rceC~~gy~F~dd  770 (1289)
T KOG1214|consen  705 TARCHPGTGVDYTCECSSGYQGDGRN-C-------------VDENECATGFHRCGPNSVCINLPGSYRCECRSGYEFADD  770 (1289)
T ss_pred             CccccCCCCcceEEEEeeccCCCCCC-C-------------CChhhhccCCCCCCCCceeecCCCceeEEEeecceeccC
Confidence            45677654 37899999999999874 5             78889985  5699999999999999999998875  44


Q ss_pred             CCCCccCCC--CCCCCCCCCcccCCcccCCCCCCCCCCC--eeeeCC-CCceeeCCCCCccCCCCCCccCCCCCCCCCCC
Q psy13148         78 PPNCRPECV--QNTECPYDKACINEKCRDPCPGSCGQGA--QCRVIN-HSPVCYCPDGFIGDAFSSCYPKPIEPIQAPEQ  152 (243)
Q Consensus        78 ~~~c~~~C~--~~~~C~~~~~C~~~~C~~~C~~~C~~~~--~C~~~~-g~~~C~C~~G~~g~~~~~C~~~~~~~~~~~~~  152 (243)
                      +.+|...-.  .++.|...            .+.|...+  .|+... +.|.|.|.|||.|++.. |.            
T Consensus       771 ~~tCV~i~~pap~n~Ce~g------------~h~C~i~g~a~c~~hGgs~y~C~CLPGfsGDG~~-c~------------  825 (1289)
T KOG1214|consen  771 RHTCVLITPPAPANPCEDG------------SHTCAIAGQARCVHHGGSTYSCACLPGFSGDGHQ-CT------------  825 (1289)
T ss_pred             CcceEEecCCCCCCccccC------------ccccCcCCceEEEecCCceEEEeecCCccCCccc-cc------------
Confidence            443332100  12233222            34565444  455544 44999999999999987 87            


Q ss_pred             CCcCC---CCCCCCeeeCC----ceecCCCcccCCCccCCCCCCCCCCCCCCCcccCCCccCCCCCCCCCCCC---eeec
Q psy13148        153 QADPC---ICAPNAVCRDN----VCVCLPDYYGDGYTVCRPECIRNSDCANNKACIRNKCKNPCVPGTCGEGA---SSWT  222 (243)
Q Consensus       153 ~~~~C---~C~~~~~C~~~----~C~C~~G~~G~~c~~~~~~C~~~~~C~~~~~C~~~~C~~~C~~~~C~~~~---~C~~  222 (243)
                      ++|+|   .|+..++|+++    .|+|.+||.||+.+ +++.=....+|...          .=-+-.|+.++   .|++
T Consensus       826 dvDeC~psrChp~A~CyntpgsfsC~C~pGy~GDGf~-CVP~~~~~T~C~~e----------r~hpl~chg~t~~~~~~D  894 (1289)
T KOG1214|consen  826 DVDECSPSRCHPAATCYNTPGSFSCRCQPGYYGDGFQ-CVPDTSSLTPCEQE----------RFHPLQCHGSTGFCWCVD  894 (1289)
T ss_pred             cccccCccccCCCceEecCCCcceeecccCccCCCce-ecCCCccCCccccc----------cccceeeccccceeEeeC
Confidence            78999   79999999987    89999999999987 55442222234321          00022344444   2334


Q ss_pred             CC---ccc-CcccCCCceeeecc
Q psy13148        223 TG---CTA-EKKRNDTIYSLARL  241 (243)
Q Consensus       223 ~~---C~c-~g~~g~~~~~c~~~  241 (243)
                      ..   +.+ ++..|++.-+|..+
T Consensus       895 p~~~e~p~~~~ppG~~~~~c~~~  917 (1289)
T KOG1214|consen  895 PDGHEVPGTQTPPGSTPPHCGPS  917 (1289)
T ss_pred             CCcccCCCCCCCCCCCCCCCCCc
Confidence            42   666 67777777666544

>KOG1214\|consensus	Back alignment and domain information

>KOG1219\|consensus	Back alignment and domain information

>KOG1219\|consensus	Back alignment and domain information

>KOG1225\|consensus	Back alignment and domain information

>KOG4289\|consensus	Back alignment and domain information

>KOG1225\|consensus	Back alignment and domain information

>KOG1217\|consensus	Back alignment and domain information

>KOG1217\|consensus	Back alignment and domain information

>KOG4289\|consensus	Back alignment and domain information

>KOG4260\|consensus	Back alignment and domain information

>KOG1226\|consensus	Back alignment and domain information

>KOG1226\|consensus	Back alignment and domain information

>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins	Back alignment and domain information

>KOG4260\|consensus	Back alignment and domain information

>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins	Back alignment and domain information

>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins	Back alignment and domain information

>smart00179 EGF_CA Calcium-binding EGF-like domain	Back alignment and domain information

>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins	Back alignment and domain information

>KOG0994\|consensus	Back alignment and domain information

>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins	Back alignment and domain information

>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins	Back alignment and domain information

>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins	Back alignment and domain information

>smart00179 EGF_CA Calcium-binding EGF-like domain	Back alignment and domain information

>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium	Back alignment and domain information

>smart00181 EGF Epidermal growth factor-like domain	Back alignment and domain information

>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium

Back alignment and domain information

>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins	Back alignment and domain information

>PF12662 cEGF: Complement Clr-like EGF-like	Back alignment and domain information

>PF12662 cEGF: Complement Clr-like EGF-like	Back alignment and domain information

>KOG0994\|consensus	Back alignment and domain information

Back alignment and domain information

>smart00181 EGF Epidermal growth factor-like domain	Back alignment and domain information

>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A	Back alignment and domain information

>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins	Back alignment and domain information

>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins	Back alignment and domain information

>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A	Back alignment and domain information

>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium	Back alignment and domain information

>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A	Back alignment and domain information

>smart00051 DSL delta serrate ligand	Back alignment and domain information

>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein	Back alignment and domain information

>smart00051 DSL delta serrate ligand	Back alignment and domain information

>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity	Back alignment and domain information

>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity	Back alignment and domain information

>PF01683 EB: EB module; InterPro: IPR006149 The EB domain has no known function	Back alignment and domain information

>KOG1836\|consensus	Back alignment and domain information

>KOG1218\|consensus	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		243
1yo8_A		634	Thrombospondin-2; EGF, Ca(2+)-binding domains, lec	3e-06
3k6s_B		687	Integrin beta-2; cell receptor, adhesion molecule,	2e-05
3v65_B		386	Low-density lipoprotein receptor-related protein;	3e-04

>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634	Back alignment and structure

 Score = 46.5 bits (110), Expect = 3e-06
 Identities = 42/196 (21%), Positives = 63/196 (32%), Gaps = 38/196 (19%)

Query: 45  VNPCIPSPCGPYSQCRDI-NGSPSC-SCLPNYIGAPPNCRP--ECVQNTECPYDKACINE 100
            + C+ +PC P +QC    +GS SC  C   ++G   +C    EC               
Sbjct: 3   PDGCLSNPCFPGAQCSSFPDGSWSCGFCPVGFLGNGTHCEDLDECALVP----------- 51

Query: 101 KCRDPCPGSCGQGAQCRVINHSPVCY-CPDGFIGDAFSSCYPKPIEPIQAPEQQADPC-- 157
              D C  S  +  +C        C  CP  + G+       +  +  +   +  +PC  
Sbjct: 52  ---DIC-FSTSKVPRCVNTQPGFHCLPCPPRYRGNQPVGVGLEAAKTEKQVCEPENPCKD 107

Query: 158 ---ICAPNAVCRDN--------VCVCLPDYYGDGYTVCRPECI-----RNSDCANNKACI 201
               C  +A C            C C   Y GDG        +      N  CA N    
Sbjct: 108 KTHNCHKHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNATYH 167

Query: 202 RNKCKNPCVPGTCGEG 217
             K   P +P +  E 
Sbjct: 168 CIKDNCPHLPNSGQED 183

PyMOL of 1yo8

>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		243
1z1y_A		186	Ookinete surface protein PVS25; four EGF-like doma	99.82
2vj3_A		135	Neurogenic locus notch homolog protein 1; transcri	99.82
2vj3_A		135	Neurogenic locus notch homolog protein 1; transcri	99.8
4d90_A		143	EGF-like repeat and discoidin I-like domain-conta	99.74
2ygq_A		324	WIF-1, WNT inhibitory factor 1; signaling protein,	99.7
4d90_A		143	EGF-like repeat and discoidin I-like domain-conta	99.68
1z1y_A		186	Ookinete surface protein PVS25; four EGF-like doma	99.68
2bou_A		143	EGF-like module containing mucin-like hormone rece	99.67
4fbr_A		267	Lectin, myxobacterial hemagglutinin; beta-barrel,	99.67
1yo8_A		634	Thrombospondin-2; EGF, Ca(2+)-binding domains, lec	99.63
3fcs_B		690	Integrin beta-3; beta propeller, rossmann fold, EG	99.61
1yo8_A		634	Thrombospondin-2; EGF, Ca(2+)-binding domains, lec	99.59
2bou_A		143	EGF-like module containing mucin-like hormone rece	99.53
2vj2_A		169	Jagged-1; signalling, polymorphism, glycoprotein,	99.52
4fbr_A		267	Lectin, myxobacterial hemagglutinin; beta-barrel,	99.47
2ygq_A		324	WIF-1, WNT inhibitory factor 1; signaling protein,	99.44
1uzk_A		162	Fibrillin-1; glycoprotein, extra-cellular matrix,	99.4
2vj2_A		169	Jagged-1; signalling, polymorphism, glycoprotein,	99.36
1dx5_I		118	Thrombomodulin; serine proteinase, EGF-like domain	99.35
3fcs_B		690	Integrin beta-3; beta propeller, rossmann fold, EG	99.33
1emn_A		82	Fibrillin; extracellular matrix, calcium-binding,	99.33
1tpg_A		91	T-plasminogen activator F1-G; plasminogen activati	99.33
1dx5_I		118	Thrombomodulin; serine proteinase, EGF-like domain	99.32
2w86_A		147	Fibrillin-1, fibrillin1; phosphoprotein, EGF-like	99.3
1x7a_L		146	Coagulation factor IX, light chain; inhibition, bl	99.29
1uzk_A		162	Fibrillin-1; glycoprotein, extra-cellular matrix,	99.28
3k6s_B		687	Integrin beta-2; cell receptor, adhesion molecule,	99.25
1lmj_A		86	Fibrillin 1; EGF, calcium, microfibril, neonatal,	99.25
1aut_L		114	Activated protein C; serine proteinase, plasma cal	99.21
2gy5_A		423	Angiopoietin-1 receptor; ligand-binding domain, tr	99.18
1tpg_A		91	T-plasminogen activator F1-G; plasminogen activati	99.14
2w86_A		147	Fibrillin-1, fibrillin1; phosphoprotein, EGF-like	99.13
1z6c_A		87	Vitamin K-dependent protein S; EGF module, blood c	99.09
1nfu_B		195	Coagulation factor XA, light chain; hydrolase; HET	99.08
2vh0_B		134	Activated factor XA light chain; serine protease,	99.08
2c4f_L		142	Coagulation factor VII precursor; blood coagulatio	99.05
1emn_A		82	Fibrillin; extracellular matrix, calcium-binding,	99.04
3k6s_B		687	Integrin beta-2; cell receptor, adhesion molecule,	99.03
2w2n_E		107	LDL receptor, low-density lipoprotein receptor; hy	99.01
1lmj_A		86	Fibrillin 1; EGF, calcium, microfibril, neonatal,	98.99
1aut_L		114	Activated protein C; serine proteinase, plasma cal	98.96
3h5c_B		317	Vitamin K-dependent protein Z; protein Z-protein Z	98.93
2gy5_A		423	Angiopoietin-1 receptor; ligand-binding domain, tr	98.89
1z6c_A		87	Vitamin K-dependent protein S; EGF module, blood c	98.89
1x7a_L		146	Coagulation factor IX, light chain; inhibition, bl	98.86
2w2n_E		107	LDL receptor, low-density lipoprotein receptor; hy	98.79
2c4f_L		142	Coagulation factor VII precursor; blood coagulatio	98.78
3h5c_B		317	Vitamin K-dependent protein Z; protein Z-protein Z	98.75
1nfu_B		195	Coagulation factor XA, light chain; hydrolase; HET	98.67
2vh0_B		134	Activated factor XA light chain; serine protease,	98.64
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	98.51
2p28_B		217	Integrin beta-2; hybrid domain, PSI domain, I-EGF	98.5
1edm_B		39	Factor IX; epidermal growth factor, EGF, calcium-	98.45
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	98.4
3v65_B		386	Low-density lipoprotein receptor-related protein;	98.36
2p28_B		217	Integrin beta-2; hybrid domain, PSI domain, I-EGF	98.33
3u7u_G		55	Neuregulin 1; signaling protein, transferase-trans	98.29
4aqs_A		525	Laminin subunit beta-1; cell adhesion; HET: NAG BM	98.28
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	98.26
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	98.18
2k2s_B		61	Micronemal protein 6; microneme protein complex, c	98.1
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	98.05
1edm_B		39	Factor IX; epidermal growth factor, EGF, calcium-	98.03
1egf_A		53	Epidermal growth factor; NMR {Mus musculus} SCOP:	97.99
1klo_A		162	Laminin; glycoprotein; 2.10A {Mus musculus} SCOP:	97.97
3v65_B		386	Low-density lipoprotein receptor-related protein;	97.93
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	97.88
1a3p_A		45	Epidermal growth factor; disulfide connectivities,	97.77
4aqs_A		525	Laminin subunit beta-1; cell adhesion; HET: NAG BM	97.73
2k2s_B		61	Micronemal protein 6; microneme protein complex, c	97.71
3u7u_G		55	Neuregulin 1; signaling protein, transferase-trans	97.7
1klo_A		162	Laminin; glycoprotein; 2.10A {Mus musculus} SCOP:	97.63
2wg3_C		463	Hedgehog-interacting protein; lipoprotein, develop	97.62
2wg3_C		463	Hedgehog-interacting protein; lipoprotein, develop	97.62
1k36_A		46	Epiregulin; EGF-like fold, hormone/growth factor c	97.62
1hae_A		63	Heregulin-alpha; growth factor; NMR {Homo sapiens}	97.53
1egf_A		53	Epidermal growth factor; NMR {Mus musculus} SCOP:	97.51
3ca7_A		52	Protein spitz; argos, EGF, developmental protein,	97.45
3ca7_A		52	Protein spitz; argos, EGF, developmental protein,	97.44
1ob1_C		99	Major merozoite surface protein; immune system, im	97.44
1a3p_A		45	Epidermal growth factor; disulfide connectivities,	97.42
1n1i_A		105	Merozoite surface protein-1; MSP1, malaria, surfac	97.36
1apq_A		53	Complement protease C1R; EGF, calcium binding, ser	97.3
3zyj_B		426	Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA	97.26
1hae_A		63	Heregulin-alpha; growth factor; NMR {Homo sapiens}	97.25
2jkh_L		55	Factor X light chain; plasma, calcium, zymogen, se	97.22
1gl4_A		285	Nidogen-1, entactin; immunoglobulin-like domain, e	97.19
2kl7_A		71	Fibulin-4; secreted, calcium, disease mutation, di	97.14
2kl7_A		71	Fibulin-4; secreted, calcium, disease mutation, di	97.14
3zyj_B		426	Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA	97.09
1k36_A		46	Epiregulin; EGF-like fold, hormone/growth factor c	97.05
1gl4_A		285	Nidogen-1, entactin; immunoglobulin-like domain, e	97.03
2jkh_L		55	Factor X light chain; plasma, calcium, zymogen, se	96.99
1nql_B		53	Epidermal growth factor; cell surface receptor, ty	96.84
1nql_B		53	Epidermal growth factor; cell surface receptor, ty	96.79
1g1s_A		162	P-selectin; selectin, lectin, EGF, sulphated, SLEX	96.77
1kli_L		69	Factor VIIA; extrinsic coagulation pathway, serine	96.74
1kig_L		51	Factor XA; glycoprotein, serine protease, plasma,	96.7
1kli_L		69	Factor VIIA; extrinsic coagulation pathway, serine	96.64
1n1i_A		105	Merozoite surface protein-1; MSP1, malaria, surfac	96.64
1ob1_C		99	Major merozoite surface protein; immune system, im	96.42
1apq_A		53	Complement protease C1R; EGF, calcium binding, ser	96.38
1g1s_A		162	P-selectin; selectin, lectin, EGF, sulphated, SLEX	95.92
2bz6_L		53	Blood coagulation factor VIIA; serine protease, en	95.84
1kig_L		51	Factor XA; glycoprotein, serine protease, plasma,	95.73
2fd6_A		122	Urokinase-type plasminogen activator; UPAR, ATF, A	95.54
3ltf_D		58	Protein spitz; receptor-ligand complex ectodomain	95.54
1q4g_A		553	Prostaglandin G/H synthase 1; cyclooxygenase, non-	95.46
2fd6_A		122	Urokinase-type plasminogen activator; UPAR, ATF, A	95.43
3ltf_D		58	Protein spitz; receptor-ligand complex ectodomain	95.43
1oig_A		26	Dumpy, CG33196-PB; structural protein; NMR {Drosop	95.07
2bz6_L		53	Blood coagulation factor VIIA; serine protease, en	95.05
3nt1_A		587	Prostaglandin-endoperoxide synthase 2; prostagland	95.05
3cfw_A		164	L-selectin; EGF, cell adhesion, EGF-like domain, g	94.53
1oig_A		26	Dumpy, CG33196-PB; structural protein; NMR {Drosop	94.11
1szb_A		170	Mannose binding lectin-associated serine protease-	93.8
2ygo_A		188	WIF-1, WNT inhibitory factor 1; signaling protein,	93.52
1q4g_A		553	Prostaglandin G/H synthase 1; cyclooxygenase, non-	93.16
3nt1_A		587	Prostaglandin-endoperoxide synthase 2; prostagland	93.01
2wph_E		59	Coagulation factor IXA light chain; serine proteas	92.65
3cfw_A		164	L-selectin; EGF, cell adhesion, EGF-like domain, g	92.32
2rnl_A		50	Amphiregulin; AR, colorectum cell-derived growth f	92.2
2wph_E		59	Coagulation factor IXA light chain; serine proteas	91.84
1g1t_A		157	E-selectin; EGF, adhesion molecule, SLEX, immune s	91.71
3e50_C		50	Protransforming growth factor alpha; IDE, TGF-alph	91.7
3e50_C		50	Protransforming growth factor alpha; IDE, TGF-alph	91.6
2rnl_A		50	Amphiregulin; AR, colorectum cell-derived growth f	91.55
1xdt_R		79	Hbegf, heparin-binding epidermal growth factor; co	91.34
1iox_A		50	Betacellulin; EGF-like fold, hormone/growth factor	91.31
2ygo_A		188	WIF-1, WNT inhibitory factor 1; signaling protein,	90.9
1b9w_A		95	Protein (merozoite surface protein 1); MSP-1, cand	90.64
1iox_A		50	Betacellulin; EGF-like fold, hormone/growth factor	90.25
1xdt_R		79	Hbegf, heparin-binding epidermal growth factor; co	90.25
2e26_A		725	Reelin, reeler protein; signaling protein; HET: NA	90.11
2i9a_A		145	Urokinase-type plasminogen activator; growth facto	89.74
2i9a_A		145	Urokinase-type plasminogen activator; growth facto	89.12
1szb_A		170	Mannose binding lectin-associated serine protease-	88.77
3asi_A		410	Neurexin-1-alpha; beta-sandwich, cell adhesion, sy	87.77
1g1t_A		157	E-selectin; EGF, adhesion molecule, SLEX, immune s	87.17
3f1s_B		283	Vitamin K-dependent protein Z; PZ, ZPI, complex, s	82.91
2p26_A		280	Integrin beta-2; hybrid domain, PSI domain, I-EGF	82.55
3asi_A		410	Neurexin-1-alpha; beta-sandwich, cell adhesion, sy	81.99
1nzi_A		159	Complement C1S component; calcium, innate immunity	80.82

>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A	Back alignment and structure

Probab=99.82  E-value=4.4e-22  Score=157.67  Aligned_cols=135  Identities=27%  Similarity=0.651  Sum_probs=111.8

Q ss_pred             CCeeeecCCCceeecCCCCccCCCCCCcCCCCCCCCCCCCCCCCCCC----CCCCCCCCeeeeCC-----CCCeeecCCC
Q psy13148          3 AKLLRVINHNPSCTCKAGFTGDPRVFCSRIPPPPPQESPPEYVNPCI----PSPCGPYSQCRDIN-----GSPSCSCLPN   73 (243)
Q Consensus         3 ~~~C~~~~~~~~C~C~~G~~g~~~~~C~~~~~~~~~~~~~~~~~~C~----~~~C~~~~~C~~~~-----g~~~C~C~~G   73 (243)
                      |++|+++.++|+|.|++||+|.....|             +++++|.    ..+|.++++|+++.     ++|.|.|++|
T Consensus        15 ng~C~~~~g~~~C~C~~G~~g~~~~~C-------------~~id~C~~~~~~~~C~~~~~C~~~~~~~~~g~y~C~C~~G   81 (186)
T 1z1y_A           15 NGQLVQMSNHFXCMCNEGLVHLSENTC-------------EEXNECXXETLGXACGEFGQCIENPDPAQVNMYXCGCIEG   81 (186)
T ss_dssp             TEEEEECSSCEEEEECTTEEEEETTEE-------------EECCCCSGGGTTSEEETTEEEEECSSTTSSCSEEEEECTT
T ss_pred             CCEeECCCCCeEeECCCCCccCCCCcc-------------CCCCcccCCCCCCCCCCCCEeecCCCCcCCCCEECCCCCC
Confidence            569999999999999999998744356             6789998    67899999999998     8999999999


Q ss_pred             cccCCCCCccCCCCCCCCCCCCcccCCcccCCCCCCCCCCCeee----eCCCCceeeCCCCCcc---CCCCCCccCCCCC
Q psy13148         74 YIGAPPNCRPECVQNTECPYDKACINEKCRDPCPGSCGQGAQCR----VINHSPVCYCPDGFIG---DAFSSCYPKPIEP  146 (243)
Q Consensus        74 ~~g~~~~c~~~C~~~~~C~~~~~C~~~~C~~~C~~~C~~~~~C~----~~~g~~~C~C~~G~~g---~~~~~C~~~~~~~  146 (243)
                      |+|...    .|. +++|...              +|.++++|+    +..++|+|.|++||+|   ++. .|+      
T Consensus        82 ~~g~~~----~C~-~d~C~~~--------------~C~~~g~C~~~~~~~~g~~~C~C~~Gy~g~~~~~~-~C~------  135 (186)
T 1z1y_A           82 YTLXED----TCV-LDVCQYX--------------NCGESGECIVEYLSEIQSAGCSCAIGXVPNPEDEX-XCT------  135 (186)
T ss_dssp             EEEETT----EEE-EGGGTTC--------------CCCTTEEEEEEEETTEEEEEEEECTEEEEETTTTT-EEE------
T ss_pred             CccCCC----CCC-CCcCcCC--------------CCCCCCEEeeCCcCCCCCceEECCCCCcccCCCCC-cce------
Confidence            999832    333 4566543              688889998    7778899999999999   434 487      


Q ss_pred             CCCCCCCC--cCC--CC-CCCCeeeCC----ceecCCCcccCCCc
Q psy13148        147 IQAPEQQA--DPC--IC-APNAVCRDN----VCVCLPDYYGDGYT  182 (243)
Q Consensus       147 ~~~~~~~~--~~C--~C-~~~~~C~~~----~C~C~~G~~G~~c~  182 (243)
                            ++  ++|  +| .++++|++.    +|.|++||+|+.+.
T Consensus       136 ------~~~~~~C~~~C~~~~~~C~n~~g~y~C~C~~G~~g~~~~  174 (186)
T 1z1y_A          136 ------XTGETACQLXCNTDNEVCXNVEGVYXCQCMEGFTFDXEX  174 (186)
T ss_dssp             ------EEECCCCCCCCCTTTEEEEEETTEEEEEECTTCEEETTT
T ss_pred             ------EcCCCcccccccccCcceecCCCCeeeECCCCCccCccc
Confidence                  43  788  89 888999876    79999999998876

PyMOL of 1z1y

>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A*	Back alignment and structure

>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A*	Back alignment and structure

>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens}	Back alignment and structure

>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens}	Back alignment and structure

>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens}	Back alignment and structure

>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A	Back alignment and structure

>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A	Back alignment and structure

>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A*	Back alignment and structure

>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A*	Back alignment and structure

>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B*	Back alignment and structure

>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A*	Back alignment and structure

>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A	Back alignment and structure

>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A	Back alignment and structure

>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A*	Back alignment and structure

>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens}	Back alignment and structure

>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A	Back alignment and structure

>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A	Back alignment and structure

>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A	Back alignment and structure

>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B*	Back alignment and structure

>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A	Back alignment and structure

>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A	Back alignment and structure

>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A	Back alignment and structure

>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens}	Back alignment and structure

>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L*	Back alignment and structure

>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A	Back alignment and structure

>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B*	Back alignment and structure

>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1	Back alignment and structure

>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L*	Back alignment and structure

>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B*	Back alignment and structure

>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A	Back alignment and structure

>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens}	Back alignment and structure

>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens}	Back alignment and structure

>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L*	Back alignment and structure

>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ...	Back alignment and structure

>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ...

Back alignment and structure

>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A	Back alignment and structure

>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B*	Back alignment and structure

>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A	Back alignment and structure

>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1	Back alignment and structure

>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L*	Back alignment and structure

>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens}	Back alignment and structure

>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B*	Back alignment and structure

>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens}	Back alignment and structure

>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L*	Back alignment and structure

>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A	Back alignment and structure

Back alignment and structure

>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens}	Back alignment and structure

>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L*	Back alignment and structure

>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ...	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L	Back alignment and structure

>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A	Back alignment and structure

>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A	Back alignment and structure

>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens}	Back alignment and structure

>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus}	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens}	Back alignment and structure

>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A	Back alignment and structure

>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A	Back alignment and structure

>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A	Back alignment and structure

>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens}	Back alignment and structure

>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1	Back alignment and structure

>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus}	Back alignment and structure

>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A	Back alignment and structure

>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens}	Back alignment and structure

>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A	Back alignment and structure

>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A	Back alignment and structure

>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A	Back alignment and structure

>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A	Back alignment and structure

>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A	Back alignment and structure

>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A	Back alignment and structure

>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D	Back alignment and structure

>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D	Back alignment and structure

>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A	Back alignment and structure

>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1	Back alignment and structure

>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4	Back alignment and structure

>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1	Back alignment and structure

>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A	Back alignment and structure

>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ...	Back alignment and structure

>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A	Back alignment and structure

>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens}	Back alignment and structure

>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens}	Back alignment and structure

>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A	Back alignment and structure

>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A	Back alignment and structure

>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ...	Back alignment and structure

>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C*	Back alignment and structure

>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C*	Back alignment and structure

>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A	Back alignment and structure

>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L*	Back alignment and structure

>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1	Back alignment and structure

>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L*	Back alignment and structure

>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4	Back alignment and structure

>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A	Back alignment and structure

>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1	Back alignment and structure

>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A	Back alignment and structure

>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L*	Back alignment and structure

>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1	Back alignment and structure

>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A	Back alignment and structure

>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster}	Back alignment and structure

>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ...	Back alignment and structure

>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A	Back alignment and structure

>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster}	Back alignment and structure

>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L*	Back alignment and structure

>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ...	Back alignment and structure

>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1	Back alignment and structure

>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A*	Back alignment and structure

>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ...	Back alignment and structure

>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ...	Back alignment and structure

>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B*	Back alignment and structure

>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens}	Back alignment and structure

>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens}	Back alignment and structure

>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B*	Back alignment and structure

>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A	Back alignment and structure

>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A	Back alignment and structure

>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A	Back alignment and structure

>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens}	Back alignment and structure

>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1	Back alignment and structure

>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A	Back alignment and structure

>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A*	Back alignment and structure

>1b9w_A Protein (merozoite surface protein 1); MSP-1, candidate malaria vaccine, surface antigen; 1.80A {Plasmodium cynomolgi} SCOP: g.3.11.4 g.3.11.4 PDB: 2npr_A	Back alignment and structure

>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A	Back alignment and structure

>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1	Back alignment and structure

>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A*	Back alignment and structure

>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A*	Back alignment and structure

>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A*	Back alignment and structure

>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1	Back alignment and structure

>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus}	Back alignment and structure

>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A	Back alignment and structure

>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens}	Back alignment and structure

>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A*	Back alignment and structure

>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus}	Back alignment and structure

>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		243
d2vj3a1		42	Neurogenic locus notch homolog protein 1, Notch1 {	98.73
d1edmb_		39	Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606	98.71
d2c4fl1		37	Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}	98.66
d2vj3a2		39	Neurogenic locus notch homolog protein 1, Notch1 {	98.66
d2vj3a1		42	Neurogenic locus notch homolog protein 1, Notch1 {	98.59
d1emoa1		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.53
d2vj3a3		35	Neurogenic locus notch homolog protein 1, Notch1 {	98.5
d1xkba1		39	Factor X, N-terminal module {Human (Homo sapiens)	98.48
d2vj3a2		39	Neurogenic locus notch homolog protein 1, Notch1 {	98.36
d1edmb_		39	Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606	98.3
d2vj3a3		35	Neurogenic locus notch homolog protein 1, Notch1 {	98.26
d2c4fl1		37	Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}	98.24
d1emoa1		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.2
d1xkba1		39	Factor X, N-terminal module {Human (Homo sapiens)	98.18
d1g1ta2		39	E-selectin, EGF-domain {Human (Homo sapiens) [TaxI	98.16
d1g1sa2		40	E-selectin, EGF-domain {Human (Homo sapiens) [TaxI	98.14
d1uzka1		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.12
d1lmja1		44	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.1
d1gl4a2		40	EGF-like domain of nidogen-1 {Mouse (Mus musculus)	98.07
d1autl1		48	Activated protein c (autoprothrombin IIa) {Human (	98.02
d1lmja1		44	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	97.98
d1g1ta2		39	E-selectin, EGF-domain {Human (Homo sapiens) [TaxI	97.98
d1q4ga2		42	Prostaglandin H2 synthase-1, EGF-like module {Shee	97.95
d1gl4a2		40	EGF-like domain of nidogen-1 {Mouse (Mus musculus)	97.95
d1lmja2		42	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	97.91
d1g1sa2		40	E-selectin, EGF-domain {Human (Homo sapiens) [TaxI	97.9
d1cvua2		41	Prostaglandin H2 synthase-1, EGF-like module {Mous	97.81
d1tpga1		41	Plasminogen activator (tissue-type), t-PA {Human (	97.81
d1uzka2		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	97.78
d1tpga1		41	Plasminogen activator (tissue-type), t-PA {Human (	97.73
d1apqa_		53	Complement protease C1R {Human (Homo sapiens) [Tax	97.7
d1lmja2		42	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	97.65
d1apqa_		53	Complement protease C1R {Human (Homo sapiens) [Tax	97.64
d1autl1		48	Activated protein c (autoprothrombin IIa) {Human (	97.64
d1dx5i3		40	Thrombomodulin, different EGF-like domains {Human	97.63
d1q4ga2		42	Prostaglandin H2 synthase-1, EGF-like module {Shee	97.63
d1i0ua2		41	Low density lipoprotein (LDL) receptor, different	97.62
d1cvua2		41	Prostaglandin H2 synthase-1, EGF-like module {Mous	97.55
d1szba2		45	Mannose-binding protein associated serine protease	97.42
d1nt0a3		45	Mannose-binding protein associated serine protease	97.39
d1haea_		63	Heregulin-alpha, EGF-like domain {Human (Homo sapi	97.28
d1uzka1		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	97.25
d1uzka2		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	97.16
d3egfa_		53	Epidermal growth factor, EGF {Mouse (Mus musculus)	97.08
d1nqlb_		48	Epidermal growth factor, EGF {Human (Homo sapiens)	96.91
d3egfa_		53	Epidermal growth factor, EGF {Mouse (Mus musculus)	96.89
d1i0ua2		41	Low density lipoprotein (LDL) receptor, different	96.86
d1dx5i3		40	Thrombomodulin, different EGF-like domains {Human	96.71
d1haea_		63	Heregulin-alpha, EGF-like domain {Human (Homo sapi	96.67
d1szba2		45	Mannose-binding protein associated serine protease	96.6
d1nt0a3		45	Mannose-binding protein associated serine protease	96.55
d1nqlb_		48	Epidermal growth factor, EGF {Human (Homo sapiens)	96.49
d1nzia2		42	Complement C1S component {Human (Homo sapiens) [Ta	96.42
d3bpse1		40	Low density lipoprotein (LDL) receptor, different	96.38
d3bpse1		40	Low density lipoprotein (LDL) receptor, different	96.15
d2i9aa1		40	Plasminogen activator (urokinase-type) {Human (Hom	96.11
d1nzia2		42	Complement C1S component {Human (Homo sapiens) [Ta	95.75
d1emoa2		39	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	95.17
d1emoa2		39	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	95.15
d1autl2		50	Activated protein c (autoprothrombin IIa) {Human (	94.1
d1ioxa_		50	Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]	93.8
d1kigl_		51	Factor X, N-terminal module {Cow (Bos taurus) [Tax	93.77
d1moxc_		49	Transforming growth factor alpha {Human (Homo sapi	93.67
d1k36a_		46	Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI	93.42
d1autl2		50	Activated protein c (autoprothrombin IIa) {Human (	93.02
d2p3ua1		51	Factor X, N-terminal module {Human (Homo sapiens)	92.91
d1k36a_		46	Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI	92.75
d1kigl_		51	Factor X, N-terminal module {Cow (Bos taurus) [Tax	92.67
d2i9aa1		40	Plasminogen activator (urokinase-type) {Human (Hom	92.54
d1ioxa_		50	Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]	92.53
d1jv2b4		31	Integrin beta EGF-like domains {Human (Homo sapien	92.25
d2p3ua1		51	Factor X, N-terminal module {Human (Homo sapiens)	92.02
d1l3ya_		41	Integrin beta EGF-like domains {Human (Homo sapien	92.01
d1moxc_		49	Transforming growth factor alpha {Human (Homo sapi	91.1
d1xdtr_		41	Heparin-binding epidermal growth factor, HBEGF {Hu	90.51
d1xdtr_		41	Heparin-binding epidermal growth factor, HBEGF {Hu	90.18
d1oiga_		26	Dumpy {Fruit fly (Drosophila melanogaster) [TaxId:	86.7
d1jv2b5		43	Integrin beta EGF-like domains {Human (Homo sapien	85.03
d1ijqa2		50	Low density lipoprotein (LDL) receptor, different	83.94
d1kloa1		55	Laminin gamma1 chain {Mouse (Mus musculus) [TaxId:	83.71

>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Neurogenic locus notch homolog protein 1, Notch1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.73  E-value=5e-09  Score=60.12  Aligned_cols=35  Identities=34%  Similarity=0.821  Sum_probs=32.3

Q ss_pred             CCCCCCC--CCCCCCCCeeeeCCCCCeeecCCCcccC
Q psy13148         43 EYVNPCI--PSPCGPYSQCRDINGSPSCSCLPNYIGA   77 (243)
Q Consensus        43 ~~~~~C~--~~~C~~~~~C~~~~g~~~C~C~~G~~g~   77 (243)
                      +|||+|.  ++||.++++|+++.++|+|.|++||+|.
T Consensus         1 qDideC~~~~~pC~n~g~C~n~~g~y~C~C~~G~~G~   37 (42)
T d2vj3a1           1 QDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGP   37 (42)
T ss_dssp             CCCCTTTSSSCSSSTTCEEEECSSSEEEECCTTEEST
T ss_pred             CCCccccCCCCCCCCCcEeECCCCCEEeECCCCCcCC
Confidence            3788997  5799999999999999999999999999

PyMOL of d2vj3a1

>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}	Back information, alignment and structure

>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}	Back information, alignment and structure

>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1oiga_ g.3.18.1 (A:) Dumpy {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure