Psyllid ID: psy13252

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------56
MTFRNSLRHICRTLRRSHIPVASNPPDMAPITRADIVMEYDERHYDSDYGFQQEFEQLVNEHFPDRSTKASEARENQHKNRYPDIKAYDQTRVKLTPVDGVPGSDYINANFVLGYKELKKFICAQGPMEHTVNDFWRMIWEQHLEIVIMLTNLEEYSKIKCAKYWPEQEEGDKTYGDFIVGLVNEKKFGEYILRELKLVRTASGKESEERSIFQYHYLAWKDFQAPENPSGLLKFIKHVNEAYSLEKGPILVHCRALVEVVQFGETEIRATDLKSTLETLKRVNDGNKKSELELEFEETHNKCSDHLIRSACQFYLIHQVNLASGPDQVYVLRLTQAKEENKSTTNAKSEDLTVLGVRLTQAKEENKSTTNAKSEENKDKNRDESIIPYDRNRVILSPAKDYSNYINASFIEAYDNTESFIITQDPDMEHTVHDFWRMISEHTISTIIMLSDRLTQAKEENKSTTNAKSEENKDKNRDESIIPYDRNRVILSPAKDYSNYINASFIEAYDNTESFIITQDPDMEHTVHDFWRMISEHTISTIIMLSDGLEETNKFRYK
ccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHccccccccHHHHcccccccccccccccccccccEEEEccccccccccEEccccccccccccEEEccccccccHHHHHHHHccccccEEEEEEccEEcccccccccccccccccEEEccEEEEEEEEEEEccEEEEEEEEEEcccccccccEEEEEEEcccccccccccccHHHHHHHHHHHHHcccccccEEEEccccccccccccEEEEHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEcccccccccEEEEEcccccccccEEEcccccccccHHHHHHHHHHccccEEEEccccccccccccccccccccccccccccccccccccccEEEEccccccccEEEEEccccccccccEEEcccccccccHHHHHHHHHcccccEEEEEccccccccccccc
ccEEEcccccccccccccccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHcccccEEEEEEccccHHHHHcccccccccHHHEEEcccccccccccEEEEEEEEEccEEEEEEEEccccHHHHHHHHHHHHHccccEEEEccccEEccEEcccccccccEEccEEEccEEEEccccEEccEEEEEEEEEEEccccccccEEEEEEEEcccccccccccccHHHHHHHHHHHHHcccccccEEEEcccccccccccHHHHHHHHHHHHHHHHcccccEEHHHHEHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccHHHHHHHHcccccccEEEEEcccccccccccccccccccccEEEcEcccccccEEEEEEccccccccEEEEccccccHHHHHHHHHHHHHHcccEEEEEHHHHHccccHcccccccccccccccccccccccccccEEEcEcccccccEEEEEEEccccccccEEEccccccHHHHHHHHHHHHHHccHEEEEHHHHHHccccHccc
mtfrnslrHICRTLRrshipvasnppdmapitradivmeyderhydsdygFQQEFEQLVnehfpdrstkaSEARENQhknrypdikaydqtrvkltpvdgvpgsdyinaNFVLGYKELKKFIcaqgpmehtvNDFWRMIWEQHLEIVIMLTNLEeyskikcakywpeqeegdktYGDFIVGLVNEKKFGEYILRELKLVRtasgkeseerSIFQYHYLAWkdfqapenpsgLLKFIKHVNeayslekgpiLVHCRALVEVVqfgeteirATDLKSTLETLkrvndgnkksELELEFEETHNKCSDHLIRSACQFYLIHQVNLASGPDQVYVLRLTQAKeenksttnaksedlTVLGVRLTQAkeenksttnakseenkdknrdesiipydrnrvilspakdysnyiNASFieaydntesfiitqdpdmehtVHDFWRMISEHTISTIIMLSDRLTQAKEenksttnakseenkdknrdesiipydrnrvilspakdysnyiNASFieaydntesfiitqdpdmehtVHDFWRMISEHTISTIIMLSdgleetnkfryk
mtfrnslrHICRTlrrshipvasnppdmapiTRADIVMEYDERHYDSDYGFQQEFEQLVNEHFPDRSTKasearenqhknrypdikaydqtrvkltpvdgvpgsdYINANFVLGYKELKKFICAQGPMEHTVNDFWRMIWEQHLEIVIMLTNLEEYSKIKCAKYWPEQEEGDKTYGDFIVGLVNEKKFGEYILRELKLVrtasgkeseeRSIFQYHYLAWKDFQAPENPSGLLKFIKHVNEAYSLEKGPILVHCRALVEVVQfgeteiratdlkstletlkrvndgnkkSELELEFEETHNKCSDHLIRSACQFYLIHQVNLASGPDQVYVLRLTQAkeenksttnaksedltvlgvrltqakeenksttnakseenkdknrdesiipydrnrvilspakdYSNYINASFIEAYDNTESFIITQDPDMEHTVHDFWRMISEHTISTIIMLSDRLTQAKeenksttnakseenkdknrdesiipydrnrvilspakdYSNYINASFIEAYDNTESFIITQDPDMEHTVHDFWRMISEHTISTIimlsdgleetnkfryk
MTFRNSLRHICRTLRRSHIPVASNPPDMAPITRADIVMEYDERHYDSDYGFQQEFEQLVNEHFPDRSTKASEARENQHKNRYPDIKAYDQTRVKLTPVDGVPGSDYINANFVLGYKELKKFICAQGPMEHTVNDFWRMIWEQHLEIVIMLTNLEEYSKIKCAKYWPEQEEGDKTYGDFIVGLVNEKKFGEYILRELKLVRTASGKESEERSIFQYHYLAWKDFQAPENPSGLLKFIKHVNEAYSLEKGPILVHCRALVEVVQFGETEIRATDLKSTLETLKRVNDGNKKSELELEFEETHNKCSDHLIRSACQFYLIHQVNLASGPDQVYVLRLTQAKEENKSTTNAKSEDLTVLGVRLTQAKEENKSTTNAKSEENKDKNRDESIIPYDRNRVILSPAKDYSNYINASFIEAYDNTESFIITQDPDMEHTVHDFWRMISEHTISTIIMLSDRLTQAKEENKSTTNAKSEENKDKNRDESIIPYDRNRVILSPAKDYSNYINASFIEAYDNTESFIITQDPDMEHTVHDFWRMISEHTISTIIMLSDGLEETNKFRYK
********HICRTLR***************ITRADIVMEYDERHYDSDYGFQQEFE****************************IKAYDQTRVKLTPVDGVPGSDYINANFVLGYKELKKFICAQGPMEHTVNDFWRMIWEQHLEIVIMLTNLEEYSKIKCAKYWPEQEEGDKTYGDFIVGLVNEKKFGEYILRELKLVRTA*******RSIFQYHYLAWKDFQAPENPSGLLKFIKHVNEAYSLEKGPILVHCRALVEVVQFGETEIRATDLKSTL*********************THNKCSDHLIRSACQFYLIHQVNLASGPDQVYVLRLT**************************************************IIPYDRNRVILSPAKDYSNYINASFIEAYDNTESFIITQDPDMEHTVHDFWRMISEHTISTIIMLS*****************************IIPYDRNRVILSPAKDYSNYINASFIEAYDNTESFIITQDPDMEHTVHDFWRMISEHTISTIIMLSD***********
*******************************TRADIVMEYDERHYDSDYGFQQEFEQLVNEHFPDRSTK***ARENQHKNRYPDIKAYDQTRVKLTPVDGVPGSDYINANFVLGYKELKKFICAQGPMEHTVNDFWRMIWEQHLEIVIMLTNLEEYSKIKCAKYWPEQEEGDKTYGDFIVGLVNEKKFGEYILRELKLVRTA*G**SEERSIFQYHYLAWKDFQAPENPSGLLKFIKHVNEAYSLEKGPILVHCRALVEVVQFGETEIRATDLKSTLETLKRVNDGNKKSELELEFEETHNKCSDHLIRSACQFYLIHQVNLASGPDQVYVLRLTQA******************GVRLTQAK*****************NRDESIIPYDRNRVILSPAKDYSNYINASFIEAYDNTESFIITQDPDMEHTVHDFWRMISEHTISTIIMLSDRLTQAKEENKSTTNAKSEENKDKNRDESIIPYDRNRVILSPAKDYSNYINASFIEAYDNTESFIITQDPDMEHTVHDFWRMISEHTISTIIMLSDGLEETNKFRY*
MTFRNSLRHICRTLRRSHIPVASNPPDMAPITRADIVMEYDERHYDSDYGFQQEFEQLVNEHFP*************HKNRYPDIKAYDQTRVKLTPVDGVPGSDYINANFVLGYKELKKFICAQGPMEHTVNDFWRMIWEQHLEIVIMLTNLEEYSKIKCAKYWPEQEEGDKTYGDFIVGLVNEKKFGEYILRELKLVR*********RSIFQYHYLAWKDFQAPENPSGLLKFIKHVNEAYSLEKGPILVHCRALVEVVQFGETEIRATDLKSTLETLKRVNDGNKKSELELEFEETHNKCSDHLIRSACQFYLIHQVNLASGPDQVYVLRLTQAK********AKSEDLTVLGVRLTQA*******************RDESIIPYDRNRVILSPAKDYSNYINASFIEAYDNTESFIITQDPDMEHTVHDFWRMISEHTISTIIMLSDRL**********************RDESIIPYDRNRVILSPAKDYSNYINASFIEAYDNTESFIITQDPDMEHTVHDFWRMISEHTISTIIMLSDGLEETNKFRYK
*T***S**HICRTLRRSHIPVASNPPDMAPITRADIVMEYDERHYDSDYGFQQEFEQLVNEHFPDRSTKASEARENQHKNRYPDIKAYDQTRVKLTPVDGVPGSDYINANFVLGYKELKKFICAQGPMEHTVNDFWRMIWEQHLEIVIMLTNLEEYSKIKCAKYWPEQEEGDKTYGDFIVGLVNEKKFGEYILRELKLVRTASGKESEERSIFQYHYLAWKDFQAPENPSGLLKFIKHVNEAYSLEKGPILVHCRALVEVVQFGETEIRATDLKSTLETLKRVNDGNKKSELELEFEETHNKCSDHLIRSACQFYLIHQVNLASGPDQVYVLRLTQAKEENKSTTNAKSEDLTVLGVRLTQAKEENKSTTNAKSEENKDKNRDESIIPYDRNRVILSPAKDYSNYINASFIEAYDNTESFIITQDPDMEHTVHDFWRMISEHTISTIIMLSDRLTQAKEENKSTTNAKSEENKDKNRDESIIPYDRNRVILSPAKDYSNYINASFIEAYDNTESFIITQDPDMEHTVHDFWRMISEHTISTIIMLSDGLEET******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTFRNSLRHICRTLRRSHIPVASNPPDMAPITRADIVMEYDERHYDSDYGFQQEFEQLVNEHFPDRSTKASEARENQHKNRYPDIKAYDQTRVKLTPVDGVPGSDYINANFVLGYKELKKFICAQGPMEHTVNDFWRMIWEQHLEIVIMLTNLEEYSKIKCAKYWPEQEEGDKTYGDFIVGLVNEKKFGEYILRELKLVRTASGKESEERSIFQYHYLAWKDFQAPENPSGLLKFIKHVNEAYSLEKGPILVHCRALVEVVQFGETEIRATDLKSTLETLKRVNDGNKKSELELEFEETHNKCSDHLIRSACQFYLIHQVNLASGPDQVYVLRLTQAKEENKSTTNAKSEDLTVLGVRxxxxxxxxxxxxxxxxxxxxxKNRDESIIPYDRNRVILSPAKDYSNYINASFIEAYDNTESFIITQDPDMEHTVHDFWRMISEHTISTIIMLSDRxxxxxxxxxxxxxxxxxxxxxKNRDESIIPYDRNRVILSPAKDYSNYINASFIEAYDNTESFIITQDPDMEHTVHDFWRMISEHTISTIIMLSDGLEETNKFRYK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query558 2.2.26 [Sep-21-2011]
P166201462 Tyrosine-protein phosphat yes N/A 0.786 0.300 0.481 1e-113
P234701445 Receptor-type tyrosine-pr yes N/A 0.763 0.294 0.345 2e-64
Q059091442 Receptor-type tyrosine-pr yes N/A 0.759 0.294 0.346 2e-64
P18433802 Receptor-type tyrosine-pr no N/A 0.718 0.5 0.363 3e-64
P23469700 Receptor-type tyrosine-pr no N/A 0.749 0.597 0.355 4e-64
Q646041898 Receptor-type tyrosine-pr no N/A 0.734 0.216 0.339 1e-63
A2A8L51898 Receptor-type tyrosine-pr no N/A 0.734 0.216 0.339 3e-63
P49446699 Receptor-type tyrosine-pr no N/A 0.749 0.597 0.350 1e-62
B2GV87699 Receptor-type tyrosine-pr no N/A 0.749 0.597 0.348 4e-62
A7MBJ41898 Receptor-type tyrosine-pr no N/A 0.724 0.212 0.337 4e-62
>sp|P16620|PTP69_DROME Tyrosine-protein phosphatase 69D OS=Drosophila melanogaster GN=Ptp69D PE=1 SV=2 Back     alignment and function desciption
 Score =  409 bits (1051), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 224/465 (48%), Positives = 296/465 (63%), Gaps = 26/465 (5%)

Query: 1    MTFRNSLRHIC---RTLRRSHIPVASNPP--DMAPITRADIVMEYDERHYDSDYGFQQEF 55
            +T R+SL       R    SH   + N    D  PI R D+   Y  RH D+DYGF +E+
Sbjct: 838  LTLRDSLSRALFGRRNHNHSHFITSGNHKGFDAGPIHRLDLENAYKNRHKDTDYGFLREY 897

Query: 56   EQLVNEHFPDRSTKASEARENQHKNRYPDIKAYDQTRVKLTPVDGVPGSDYINANFVLGY 115
            E L N  F DR+TK S+ +EN  KNRYPDIKAYDQTRVKL  ++G+  +DYINANFV+GY
Sbjct: 898  EMLPNR-FSDRTTKNSDLKENACKNRYPDIKAYDQTRVKLAVINGLQTTDYINANFVIGY 956

Query: 116  KELKKFICAQGPMEHTVNDFWRMIWEQHLEIVIMLTNLEEYSKIKCAKYWPEQEEGDKTY 175
            KE KKFICAQGPME T++DFWRMIWEQHLEI++MLTNLEEY+K KCAKYWPE+    K +
Sbjct: 957  KERKKFICAQGPMESTIDDFWRMIWEQHLEIIVMLTNLEEYNKAKCAKYWPEKVFDTKQF 1016

Query: 176  GDFIVGLVNEKKFGEYILRELKLVRTAS--GKESEERSIFQYHYLAWKDFQAPENPSGLL 233
            GD +V    E+K G+YI R L + +  +  G+E + R I QYHYL WKDF APE+P G++
Sbjct: 1017 GDILVKFAQERKTGDYIERTLNVSKNKANVGEEEDRRQITQYHYLTWKDFMAPEHPHGII 1076

Query: 234  KFIKHVNEAYSLEKGPILVHCRALVEVVQFGETEIRATDLKSTLETLKRVNDGNKKSELE 293
            KFI+ +N  YSL++GPILVHC A V       T +    L   LE    V+  N   +L 
Sbjct: 1077 KFIRQINSVYSLQRGPILVHCSAGVGRTG---TLVALDSLIQQLEEEDSVSIYNTVCDLR 1133

Query: 294  LEFEETHNKCSDHLIRSACQFYLIHQVNLASGP---DQVYVLRLTQAKEENKSTTNAKSE 350
                  H +  + L++S  Q+  +++  L +G      + +  +  A E  K   N    
Sbjct: 1134 ------HQR--NFLVQSLKQYIFLYRALLDTGTFGNTDICIDTMASAIESLKRKPNEGKC 1185

Query: 351  DLTV-LGVRLTQAKEENKSTTNAKSEENKDKNRDESIIPYDRNRVILS--PAKDYSNYIN 407
             L V     L  A E +KS +  ++EEN  KNR + IIPYDRNRVIL+  P ++ S YIN
Sbjct: 1186 KLEVEFEKLLATADEISKSCSVGENEENNMKNRSQEIIPYDRNRVILTPLPMRENSTYIN 1245

Query: 408  ASFIEAYDNTESFIITQDPDMEHTVHDFWRMISEHTISTIIMLSD 452
            ASFIE YDN+E+FII QDP +E+T+ DFWRMISE +++T++M+S+
Sbjct: 1246 ASFIEGYDNSETFIIAQDP-LENTIGDFWRMISEQSVTTLVMISE 1289
Possible cell adhesion receptor.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|P23470|PTPRG_HUMAN Receptor-type tyrosine-protein phosphatase gamma OS=Homo sapiens GN=PTPRG PE=1 SV=4 Back     alignment and function description
>sp|Q05909|PTPRG_MOUSE Receptor-type tyrosine-protein phosphatase gamma OS=Mus musculus GN=Ptprg PE=1 SV=1 Back     alignment and function description
>sp|P18433|PTPRA_HUMAN Receptor-type tyrosine-protein phosphatase alpha OS=Homo sapiens GN=PTPRA PE=1 SV=2 Back     alignment and function description
>sp|P23469|PTPRE_HUMAN Receptor-type tyrosine-protein phosphatase epsilon OS=Homo sapiens GN=PTPRE PE=1 SV=1 Back     alignment and function description
>sp|Q64604|PTPRF_RAT Receptor-type tyrosine-protein phosphatase F OS=Rattus norvegicus GN=Ptprf PE=2 SV=1 Back     alignment and function description
>sp|A2A8L5|PTPRF_MOUSE Receptor-type tyrosine-protein phosphatase F OS=Mus musculus GN=Ptprf PE=1 SV=1 Back     alignment and function description
>sp|P49446|PTPRE_MOUSE Receptor-type tyrosine-protein phosphatase epsilon OS=Mus musculus GN=Ptpre PE=1 SV=3 Back     alignment and function description
>sp|B2GV87|PTPRE_RAT Receptor-type tyrosine-protein phosphatase epsilon OS=Rattus norvegicus GN=Ptpre PE=2 SV=1 Back     alignment and function description
>sp|A7MBJ4|PTPRF_BOVIN Receptor-type tyrosine-protein phosphatase F OS=Bos taurus GN=PTPRF PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query558
270015427 1336 hypothetical protein TcasGA2_TC004289 [T 0.698 0.291 0.499 1e-134
91095025 1346 PREDICTED: similar to protein tyrosine p 0.698 0.289 0.499 1e-134
156547449 1433 PREDICTED: tyrosine-protein phosphatase 0.779 0.303 0.532 1e-131
383859812 1409 PREDICTED: tyrosine-protein phosphatase 0.691 0.273 0.485 1e-128
340727637 1446 PREDICTED: tyrosine-protein phosphatase 0.691 0.266 0.487 1e-127
350412038 1446 PREDICTED: tyrosine-protein phosphatase 0.691 0.266 0.487 1e-127
307178165 1482 Tyrosine-protein phosphatase 69D [Campon 0.691 0.260 0.475 1e-127
307211078 1477 Tyrosine-protein phosphatase 69D [Harpeg 0.691 0.261 0.477 1e-127
328780762 1406 PREDICTED: tyrosine-protein phosphatase 0.691 0.274 0.485 1e-126
380028434 1408 PREDICTED: LOW QUALITY PROTEIN: tyrosine 0.691 0.274 0.485 1e-126
>gi|270015427|gb|EFA11875.1| hypothetical protein TcasGA2_TC004289 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  485 bits (1248), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 253/507 (49%), Positives = 317/507 (62%), Gaps = 117/507 (23%)

Query: 1    MTFRNSLRHICRTLRRSHIPVASNPPDMAPITRADIVMEYDERHYDSDYGFQQEFEQLVN 60
            +TFR SLRH+ R+LR     V+ NPPDM PI++ ++V  Y ERH DSDYGFQQEFE L+ 
Sbjct: 728  ITFRTSLRHLYRSLRGRQRLVSLNPPDMCPISKGELVAAYIERHRDSDYGFQQEFE-LLP 786

Query: 61   EHFPDRSTKASEARENQHKNRYPDIKAYDQTRVKLTPVDGVPGSDYINANFVLGYKELKK 120
            + F DR+T+AS+AREN +KNRYPDIKAYDQTRVKL+ +D + GSDY+NANFV+GYKE KK
Sbjct: 787  DRFSDRTTRASDARENVYKNRYPDIKAYDQTRVKLSQIDSIAGSDYVNANFVMGYKERKK 846

Query: 121  FICAQGPMEHTVNDFWRMIWEQHLEIVIMLTNLEEYSKIKCAKYWPEQEEGDKTYGDFIV 180
            FICAQGPM+ TVNDFWRMIWEQHLE+++MLTNLEEYSK KCAKYWP++ +GDK +GD  V
Sbjct: 847  FICAQGPMDTTVNDFWRMIWEQHLELILMLTNLEEYSKTKCAKYWPDKCDGDKCFGDITV 906

Query: 181  GLVNEKKFGEYILRELKLVRTASGKESEERSIFQYHYLAWKDFQAPENPSGLLKFIKHVN 240
              V E ++ +YI+REL++ R A GK+ EER I QYHYL WKDF APE+P+G++KFIK VN
Sbjct: 907  THVQETRYSDYIVRELRISRNAPGKDKEERQITQYHYLVWKDFMAPEHPNGIIKFIKRVN 966

Query: 241  EAYSLEKGPILVHC---------------------------------------------- 254
            EAYS+EKG IL+HC                                              
Sbjct: 967  EAYSIEKGCILIHCSAGVGRTGTLVALDCLLQQLKEEEHVSIFNTICDLRHQRNFLVQSL 1026

Query: 255  -------RALVEVVQFGETEIRATDLKSTLETLKRVNDGNKKSELELEFEETHNKCSDHL 307
                   RAL+EV Q+G+TEI A +LK T++ L++ +    K +LE EFE   N      
Sbjct: 1027 KQYIFIYRALMEVAQYGDTEIGANELKVTVDKLRQCDKDRAKCKLEEEFENILN------ 1080

Query: 308  IRSACQFYLIHQVNLASGPDQVYVLRLTQAKEENKSTTNAKSEDLTVLGVRLTQAKEENK 367
                                         A E+ KS + AK                   
Sbjct: 1081 -----------------------------AFEDRKSCSVAK------------------- 1092

Query: 368  STTNAKSEENKDKNRDESIIPYDRNRVILSP--AKDYSNYINASFIEAYDNTESFIITQD 425
                   +EN++KNR + +IPYDRNRVIL+P   K++S YINASFIE YDNTESFIITQD
Sbjct: 1093 ------GDENREKNRSDVVIPYDRNRVILTPLSGKEHSTYINASFIEGYDNTESFIITQD 1146

Query: 426  PDMEHTVHDFWRMISEHTISTIIMLSD 452
            P  E T++DFWRMISE  IS I+MLS+
Sbjct: 1147 P-TESTINDFWRMISEQGISVIVMLSE 1172

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|91095025|ref|XP_970488.1| PREDICTED: similar to protein tyrosine phosphatase 69d, drome [Tribolium castaneum] Back     alignment and taxonomy information
>gi|156547449|ref|XP_001605126.1| PREDICTED: tyrosine-protein phosphatase 69D-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383859812|ref|XP_003705386.1| PREDICTED: tyrosine-protein phosphatase 69D-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340727637|ref|XP_003402146.1| PREDICTED: tyrosine-protein phosphatase 69D-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350412038|ref|XP_003489524.1| PREDICTED: tyrosine-protein phosphatase 69D-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307178165|gb|EFN66973.1| Tyrosine-protein phosphatase 69D [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307211078|gb|EFN87321.1| Tyrosine-protein phosphatase 69D [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328780762|ref|XP_001121003.2| PREDICTED: tyrosine-protein phosphatase 69D-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380028434|ref|XP_003697907.1| PREDICTED: LOW QUALITY PROTEIN: tyrosine-protein phosphatase 69D-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query558
FB|FBgn00140071462 Ptp69D "Protein tyrosine phosp 0.786 0.300 0.481 1.2e-106
UNIPROTKB|F1P521661 PTPRE "Uncharacterized protein 0.763 0.644 0.369 1.8e-64
UNIPROTKB|F1NPE8808 PTPRA "Uncharacterized protein 0.759 0.524 0.362 3.3e-63
UNIPROTKB|F1P3M5809 PTPRA "Uncharacterized protein 0.759 0.524 0.362 3.3e-63
UNIPROTKB|E1BPA0803 PTPRA "Uncharacterized protein 0.763 0.530 0.355 8.8e-63
UNIPROTKB|B7Z2A4813 PTPRA "Receptor-type tyrosine- 0.763 0.523 0.355 8.8e-63
UNIPROTKB|J3KP22658 PTPRA "Receptor-type tyrosine- 0.763 0.647 0.355 8.8e-63
UNIPROTKB|P18433802 PTPRA "Receptor-type tyrosine- 0.763 0.531 0.355 8.8e-63
UNIPROTKB|F1S8A4799 PTPRA "Uncharacterized protein 0.763 0.533 0.355 8.8e-63
UNIPROTKB|E2R5J7793 PTPRA "Uncharacterized protein 0.763 0.537 0.355 1.1e-62
FB|FBgn0014007 Ptp69D "Protein tyrosine phosphatase 69D" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1055 (376.4 bits), Expect = 1.2e-106, P = 1.2e-106
 Identities = 224/465 (48%), Positives = 299/465 (64%)

Query:     1 MTFRNSLRHIC---RTLRRSHIPVASNPP--DMAPITRADIVMEYDERHYDSDYGFQQEF 55
             +T R+SL       R    SH   + N    D  PI R D+   Y  RH D+DYGF +E+
Sbjct:   838 LTLRDSLSRALFGRRNHNHSHFITSGNHKGFDAGPIHRLDLENAYKNRHKDTDYGFLREY 897

Query:    56 EQLVNEHFPDRSTKASEARENQHKNRYPDIKAYDQTRVKLTPVDGVPGSDYINANFVLGY 115
             E L N  F DR+TK S+ +EN  KNRYPDIKAYDQTRVKL  ++G+  +DYINANFV+GY
Sbjct:   898 EMLPNR-FSDRTTKNSDLKENACKNRYPDIKAYDQTRVKLAVINGLQTTDYINANFVIGY 956

Query:   116 KELKKFICAQGPMEHTVNDFWRMIWEQHLEIVIMLTNLEEYSKIKCAKYWPEQEEGDKTY 175
             KE KKFICAQGPME T++DFWRMIWEQHLEI++MLTNLEEY+K KCAKYWPE+    K +
Sbjct:   957 KERKKFICAQGPMESTIDDFWRMIWEQHLEIIVMLTNLEEYNKAKCAKYWPEKVFDTKQF 1016

Query:   176 GDFIVGLVNEKKFGEYILRELKLVRTAS--GKESEERSIFQYHYLAWKDFQAPENPSGLL 233
             GD +V    E+K G+YI R L + +  +  G+E + R I QYHYL WKDF APE+P G++
Sbjct:  1017 GDILVKFAQERKTGDYIERTLNVSKNKANVGEEEDRRQITQYHYLTWKDFMAPEHPHGII 1076

Query:   234 KFIKHVNEAYSLEKGPILVHCRALVEVVQFGETEIRATDLKSTLETLKRVNDGNKKSELE 293
             KFI+ +N  YSL++GPILVHC A   V + G T +    L   LE    V+  N   +L 
Sbjct:  1077 KFIRQINSVYSLQRGPILVHCSA--GVGRTG-TLVALDSLIQQLEEEDSVSIYNTVCDLR 1133

Query:   294 LEFEETHNKCSDHLIRSACQFYLIHQVNLASGP---DQVYVLRLTQAKEENKSTTNAKSE 350
                   H +  + L++S  Q+  +++  L +G      + +  +  A E  K   N    
Sbjct:  1134 ------HQR--NFLVQSLKQYIFLYRALLDTGTFGNTDICIDTMASAIESLKRKPNEGKC 1185

Query:   351 DLTVLGVRLTQAKEE-NKSTTNAKSEENKDKNRDESIIPYDRNRVILSPA--KDYSNYIN 407
              L V   +L    +E +KS +  ++EEN  KNR + IIPYDRNRVIL+P   ++ S YIN
Sbjct:  1186 KLEVEFEKLLATADEISKSCSVGENEENNMKNRSQEIIPYDRNRVILTPLPMRENSTYIN 1245

Query:   408 ASFIEAYDNTESFIITQDPDMEHTVHDFWRMISEHTISTIIMLSD 452
             ASFIE YDN+E+FII QDP +E+T+ DFWRMISE +++T++M+S+
Sbjct:  1246 ASFIEGYDNSETFIIAQDP-LENTIGDFWRMISEQSVTTLVMISE 1289
GO:0004725 "protein tyrosine phosphatase activity" evidence=NAS;IDA
GO:0006470 "protein dephosphorylation" evidence=NAS;IDA
GO:0005886 "plasma membrane" evidence=ISS;IDA;NAS
GO:0005001 "transmembrane receptor protein tyrosine phosphatase activity" evidence=ISS
GO:0007415 "defasciculation of motor neuron axon" evidence=IGI;IMP
GO:0008045 "motor neuron axon guidance" evidence=IGI;IMP
GO:0007414 "axonal defasciculation" evidence=TAS
GO:0004728 "receptor signaling protein tyrosine phosphatase activity" evidence=NAS
GO:0007411 "axon guidance" evidence=IMP;NAS
GO:0048813 "dendrite morphogenesis" evidence=IMP
GO:0007409 "axonogenesis" evidence=IMP
GO:0030424 "axon" evidence=IDA
GO:0046331 "lateral inhibition" evidence=IMP
UNIPROTKB|F1P521 PTPRE "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NPE8 PTPRA "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3M5 PTPRA "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BPA0 PTPRA "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z2A4 PTPRA "Receptor-type tyrosine-protein phosphatase alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KP22 PTPRA "Receptor-type tyrosine-protein phosphatase alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P18433 PTPRA "Receptor-type tyrosine-protein phosphatase alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S8A4 PTPRA "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R5J7 PTPRA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3LOW CONFIDENCE prediction!
3rd Layer3.1.3.48LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query558
smart00194259 smart00194, PTPc, Protein tyrosine phosphatase, ca 4e-83
cd00047231 cd00047, PTPc, Protein tyrosine phosphatases (PTP) 2e-78
pfam00102233 pfam00102, Y_phosphatase, Protein-tyrosine phospha 5e-73
PHA02742303 PHA02742, PHA02742, protein tyrosine phosphatase; 9e-35
PHA02747312 PHA02747, PHA02747, protein tyrosine phosphatase; 2e-34
PHA02738320 PHA02738, PHA02738, hypothetical protein; Provisio 1e-33
smart00194 259 smart00194, PTPc, Protein tyrosine phosphatase, ca 2e-30
smart00194259 smart00194, PTPc, Protein tyrosine phosphatase, ca 4e-29
COG5599302 COG5599, PTP2, Protein tyrosine phosphatase [Signa 6e-29
PHA02746323 PHA02746, PHA02746, protein tyrosine phosphatase; 2e-27
cd00047 231 cd00047, PTPc, Protein tyrosine phosphatases (PTP) 2e-26
pfam00102 233 pfam00102, Y_phosphatase, Protein-tyrosine phospha 3e-26
pfam00102233 pfam00102, Y_phosphatase, Protein-tyrosine phospha 7e-26
cd00047231 cd00047, PTPc, Protein tyrosine phosphatases (PTP) 1e-25
PHA02747 312 PHA02747, PHA02747, protein tyrosine phosphatase; 4e-14
PHA02740298 PHA02740, PHA02740, protein tyrosine phosphatase; 7e-14
PHA02747312 PHA02747, PHA02747, protein tyrosine phosphatase; 5e-13
PHA02742303 PHA02742, PHA02742, protein tyrosine phosphatase; 3e-12
PHA02742 303 PHA02742, PHA02742, protein tyrosine phosphatase; 4e-12
PHA02738320 PHA02738, PHA02738, hypothetical protein; Provisio 9e-12
PHA02738 320 PHA02738, PHA02738, hypothetical protein; Provisio 3e-11
COG5599302 COG5599, PTP2, Protein tyrosine phosphatase [Signa 9e-11
COG5599 302 COG5599, PTP2, Protein tyrosine phosphatase [Signa 9e-11
smart00404105 smart00404, PTPc_motif, Protein tyrosine phosphata 4e-10
smart00012105 smart00012, PTPc_DSPc, Protein tyrosine phosphatas 4e-10
PHA02746 323 PHA02746, PHA02746, protein tyrosine phosphatase; 1e-07
PHA02746323 PHA02746, PHA02746, protein tyrosine phosphatase; 3e-07
PHA02740 298 PHA02740, PHA02740, protein tyrosine phosphatase; 0.002
>gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information 
 Score =  259 bits (664), Expect = 4e-83
 Identities = 91/207 (43%), Positives = 125/207 (60%), Gaps = 4/207 (1%)

Query: 50  GFQQEFEQLVNEHFPDRSTKASEARENQHKNRYPDIKAYDQTRVKLTPVDGVPGSDYINA 109
           G ++EFE+L      D S   +   EN+ KNRY D+  YD TRVKL P  G  GSDYINA
Sbjct: 1   GLEEEFEKLDRLKPDDESCTVAAFPENRDKNRYKDVLPYDHTRVKLKPPPG-EGSDYINA 59

Query: 110 NFVLGYKELKKFICAQGPMEHTVNDFWRMIWEQHLEIVIMLTNLEEYSKIKCAKYWPEQE 169
           +++ G    K +I  QGP+  TV DFWRM+WEQ + +++MLT L E  + KCA+YWP++E
Sbjct: 60  SYIDGPNGPKAYIATQGPLPSTVEDFWRMVWEQKVTVIVMLTELVEKGREKCAQYWPDEE 119

Query: 170 EGDKTYGDFIVGLVNEKKFGEYILRELKLVRTASGKESEERSIFQYHYLAWKDFQAPENP 229
               TYGD  V L + +K  +Y +R L++  T     SE R++  YHY  W D   PE+P
Sbjct: 120 GEPLTYGDITVTLKSVEKVDDYTIRTLEVTNT---GCSETRTVTHYHYTNWPDHGVPESP 176

Query: 230 SGLLKFIKHVNEAYSLEKGPILVHCRA 256
             +L  I+ V ++ S   GPI+VHC A
Sbjct: 177 ESILDLIRAVRKSQSTSTGPIVVHCSA 203

Length = 259
>gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase Back     alignment and domain information
>gnl|CDD|165109 PHA02742, PHA02742, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165114 PHA02747, PHA02747, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase Back     alignment and domain information
>gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase Back     alignment and domain information
>gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>gnl|CDD|165114 PHA02747, PHA02747, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165107 PHA02740, PHA02740, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165114 PHA02747, PHA02747, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165109 PHA02742, PHA02742, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165109 PHA02742, PHA02742, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165107 PHA02740, PHA02740, protein tyrosine phosphatase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 558
KOG4228|consensus1087 100.0
PHA02742303 protein tyrosine phosphatase; Provisional 100.0
PHA02740298 protein tyrosine phosphatase; Provisional 100.0
PHA02747312 protein tyrosine phosphatase; Provisional 100.0
KOG0790|consensus600 100.0
PHA02746323 protein tyrosine phosphatase; Provisional 100.0
PHA02738320 hypothetical protein; Provisional 100.0
KOG0792|consensus1144 100.0
KOG0791|consensus374 100.0
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 100.0
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 100.0
KOG0793|consensus1004 100.0
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 100.0
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 100.0
KOG4228|consensus1087 100.0
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 100.0
KOG0789|consensus415 100.0
PHA02742 303 protein tyrosine phosphatase; Provisional 99.97
PHA02747 312 protein tyrosine phosphatase; Provisional 99.96
PHA02746 323 protein tyrosine phosphatase; Provisional 99.96
PHA02738 320 hypothetical protein; Provisional 99.96
PHA02740 298 protein tyrosine phosphatase; Provisional 99.95
KOG0790|consensus 600 99.92
smart00194 258 PTPc Protein tyrosine phosphatase, catalytic domai 99.91
KOG0792|consensus 1144 99.89
COG5599 302 PTP2 Protein tyrosine phosphatase [Signal transduc 99.86
cd00047 231 PTPc Protein tyrosine phosphatases (PTP) catalyze 99.86
KOG0791|consensus 374 99.84
PF00102 235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 99.82
KOG0793|consensus 1004 99.82
KOG0789|consensus 415 99.74
PRK15375 535 pathogenicity island 1 effector protein StpP; Prov 99.66
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 99.63
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 99.63
PTZ00242166 protein tyrosine phosphatase; Provisional 99.09
PTZ00393241 protein tyrosine phosphatase; Provisional 98.64
KOG1720|consensus225 98.47
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 97.76
KOG2836|consensus173 97.73
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 97.67
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 97.06
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 96.66
PF05706168 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) 96.34
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 96.18
PRK12361547 hypothetical protein; Provisional 95.62
KOG1718|consensus198 95.13
PF14566149 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 93.94
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 92.42
KOG2283|consensus434 92.21
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 91.93
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 91.93
COG5350172 Predicted protein tyrosine phosphatase [General fu 90.86
COG2365249 Protein tyrosine/serine phosphatase [Signal transd 89.11
KOG1716|consensus285 87.7
KOG1719|consensus183 86.29
KOG4471|consensus717 83.79
PLN02727 986 NAD kinase 80.38
>KOG4228|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.1e-94  Score=790.68  Aligned_cols=441  Identities=39%  Similarity=0.668  Sum_probs=376.7

Q ss_pred             CcCHHhHHHHHHHHhcCCchhHHHHHHhhhhCCCCCCchhhhhhhhccCCCCCCCCCCCCCcceEecCCCCCCCCCceee
Q psy13252         30 PITRADIVMEYDERHYDSDYGFQQEFEQLVNEHFPDRSTKASEARENQHKNRYPDIKAYDQTRVKLTPVDGVPGSDYINA  109 (558)
Q Consensus        30 pi~~~~~~~~~~~~~~~~~~~~~~Ef~~l~~~~~~~~~~~~~~~~~N~~KNR~~ni~p~D~tRV~L~~~~~~~~~dYINA  109 (558)
                      ||++++|.+++++++++++.+|++||+.| +..  +.++.++.+++|+.||||.||++|||+||+|...+|++++|||||
T Consensus       522 pI~v~dl~~~i~~~~~~~~~~F~~Eyesl-~~~--~~~~~~s~~~en~~KNRY~nilayD~sRV~L~~i~Gd~~sDYINA  598 (1087)
T KOG4228|consen  522 PIPVADLLEHIERRKADDGYGFKQEYESL-PEG--QFTWEHSNKKENKQKNRYENILAYDHSRVILPPIEGDPNSDYINA  598 (1087)
T ss_pred             CccHHHHHHHHHHhhcccccchHHHHhhc-ccc--CCccccCccccccccccCCcchhhhcceeeecccCCCccccceee
Confidence            89999999999999999999999999999 444  678899999999999999999999999999999999999999999


Q ss_pred             eeecCCccccceEEecCCCCCchhhhhhhhhcCCccEEEEcCCccccCccccccccCCCCCCcceeceEEEEEeeeeeeC
Q psy13252        110 NFVLGYKELKKFICAQGPMEHTVNDFWRMIWEQHLEIVIMLTNLEEYSKIKCAKYWPEQEEGDKTYGDFIVGLVNEKKFG  189 (558)
Q Consensus       110 s~I~g~~~~~~yIatQ~Pl~~T~~dFW~MV~e~~v~~IVmLt~~~E~~~~kc~~YwP~~~~~~~~~g~~~V~~~~~~~~~  189 (558)
                      ||||||+.+++|||||||+++|++||||||||+++.+|||+|++.|.++.||.+|||+   ++.+||++.|++.+.+..+
T Consensus       599 nyIdGy~e~n~yIaaQgP~~eTv~DFWRMVWEq~S~~IVMvTnl~E~~r~kC~qYWP~---~t~~yGdi~V~~~~~~~~a  675 (1087)
T KOG4228|consen  599 NYIDGYKEPNAYIAAQGPRPETVGDFWRMVWEQKSAGIVMVTNLEEFSRVKCAQYWPE---GTETYGDIKVTLVQTKPLA  675 (1087)
T ss_pred             eeeecccccccceeccCCcccchHHHHHHheeccCCcEEEEecccccccccccccCCC---Cccccccccccceeeeeec
Confidence            9999999999999999999999999999999999999999999999999999999993   5889999999999999999


Q ss_pred             ceEEEEEEEEEecCCCCCceEEEEEEEEcCcCCCCCCCChHHHHHHHHHHHHHcCCCCCCEEEEcchhh-HHhhhcceee
Q psy13252        190 EYILRELKLVRTASGKESEERSIFQYHYLAWKDFQAPENPSGLLKFIKHVNEAYSLEKGPILVHCRALV-EVVQFGETEI  268 (558)
Q Consensus       190 ~~~~r~l~v~~~~~g~~~~~r~V~~~~y~~Wpd~gvP~~~~~ll~~i~~v~~~~~~~~~PIvVHCsaGv-rtg~~~~~~i  268 (558)
                      +|++|+|.|...  | ....|.|+||||++|||||+|..+.++|.|++.|+..++...||||||||||+ |||+|    |
T Consensus       676 ~y~iRtf~l~~~--g-~~~~R~v~qfhFt~Wpd~gvPe~~t~lL~f~rrvk~~~p~~aGPiVVHCSAGvGRTG~f----i  748 (1087)
T KOG4228|consen  676 EYGIRTFALKKQ--G-ENPKREVRQFHFTAWPDHGVPETPTGLLKFRRRVKTFNPPDAGPIVVHCSAGVGRTGCF----I  748 (1087)
T ss_pred             cceEEeeecccc--C-CCCCceeeeeeeccCCCCCCcccchHHHHHHHHhccCCCcCCCCEEEECCCCCCCcceE----E
Confidence            999999999873  3 55789999999999999999999999999999999988878899999999999 99998    4


Q ss_pred             ehHHHHHHHHHHhhccCCCCchhhHHHHHHHHhhcccccccccceeeeeeeeecc---cCCchhhHHhhhhhhHhccc-c
Q psy13252        269 RATDLKSTLETLKRVNDGNKKSELELEFEETHNKCSDHLIRSACQFYLIHQVNLA---SGPDQVYVLRLTQAKEENKS-T  344 (558)
Q Consensus       269 ~i~~l~~~l~~l~~~~~~~~~~~~~~e~~~~~r~~R~~~Vqt~~Qy~fi~~~~l~---~~~~~~~~~~~~~~~~~~~~-~  344 (558)
                      .+|.|.+.++.-+..+.        .++++.+|.||..||||.+||+|||+++++   +|.+++.+..+.......+. .
T Consensus       749 ~iDaml~~~~~e~~vdi--------y~~v~~lR~QR~~mVQt~eQYiFi~~AllE~~~~G~T~i~~~~~~~~~~~l~~~~  820 (1087)
T KOG4228|consen  749 VIDAMLDRLECEGKVDI--------YGHVKTLRRQRNNMVQTEEQYIFIHEALLEACLCGDTEVPASTLAPYSQKLKRID  820 (1087)
T ss_pred             EeHHHHHHHHhhCccce--------echhHHHHhccccccccHHHHHHHHHHHHHHHhcCCccccHHHHHHHHHHhccCC
Confidence            55555444444333332        567889999999999999999999999997   69999888766655543332 1


Q ss_pred             cccccchhhhhhhhhhhhhhcccccccccccccccCCCCCCCCCCCCceEEecC-CCCCCCCcccccccccCCCCceeee
Q psy13252        345 TNAKSEDLTVLGVRLTQAKEENKSTTNAKSEENKDKNRDESIIPYDRNRVILSP-AKDYSNYINASFIEAYDNTESFIIT  423 (558)
Q Consensus       345 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~knr~~~ilp~d~~rv~l~~-~~~~~~yinAs~i~g~~~~~~~i~t  423 (558)
                      +.....+++..+++|............|.+++|+.|||..+|+|||++||.|.+ ..++||||||||||||+.+++||+|
T Consensus       821 p~~~~t~le~EF~~L~~~~~~~~~~~~~~l~~N~~KNR~~~i~P~d~~rv~L~~~~G~~sdYINAs~idgy~~~~~fivt  900 (1087)
T KOG4228|consen  821 PPENKTGLEEEFKTLNSCKPRTRMMICGNLPENKSKNRQVNILPYDRNRVILIPTHGESSDYINASFIDGYRQPKAFIVT  900 (1087)
T ss_pred             CCCCCcchHHHHHHHhhccccchhhhccccchhcccccccccCCchhcccceeccCCCcccccchhhhcccCCcceEEEe
Confidence            111222444444444444433333445999999999999999999999999998 3348999999999999999999999


Q ss_pred             CCCCCcccHHHHHHhhhcccceeeeeecchhhhhcccccccCccccccccCCCCCCCCCCCCCCeeeecCCCCCCCcccc
Q psy13252        424 QDPDMEHTVHDFWRMISEHTISTIIMLSDRLTQAKEENKSTTNAKSEENKDKNRDESIIPYDRNRVILSPAKDYSNYINA  503 (558)
Q Consensus       424 q~P~~~~t~~dFwrmi~~~~~~~iVml~~~~e~~ke~~~~~~~~~~~~n~~knr~~~i~~~d~~rV~L~~~~~~~~YInA  503 (558)
                      |+| +.+|+.|||||||++++..||||.+....  ++++-.+..           ....+|+.-+|.........+|++-
T Consensus       901 q~P-L~~T~~DFWrmi~d~~~tsiVmL~~l~~~--~~C~qyw~~-----------~g~~~yg~i~Ve~~~~~~~~~~t~r  966 (1087)
T KOG4228|consen  901 QGP-LAETVEDFWRMIWDQNVTSIVMLTELKHP--EKCPQYWPP-----------EGSQRYGPIEVEDMNEHINPQYTAR  966 (1087)
T ss_pred             cCC-cccchHHHHHHhhccceeEEEEecccCcc--cccccccCC-----------cCceecCcEEEEecccccchhhhhh
Confidence            999 99999999999999999999999998887  555554432           2345788888887766666666665


Q ss_pred             cc
Q psy13252        504 SF  505 (558)
Q Consensus       504 s~  505 (558)
                      -|
T Consensus       967 ~f  968 (1087)
T KOG4228|consen  967 EF  968 (1087)
T ss_pred             hh
Confidence            55

>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>KOG0791|consensus Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>KOG0793|consensus Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>KOG0789|consensus Back     alignment and domain information
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>KOG0791|consensus Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG0793|consensus Back     alignment and domain information
>KOG0789|consensus Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG1720|consensus Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>KOG2836|consensus Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species Back     alignment and domain information
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>KOG1718|consensus Back     alignment and domain information
>PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>KOG2283|consensus Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1716|consensus Back     alignment and domain information
>KOG1719|consensus Back     alignment and domain information
>KOG4471|consensus Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query558
2jjd_A599 Protein Tyrosine Phosphatase, Receptor Type, E Isof 4e-65
2jjd_A 599 Protein Tyrosine Phosphatase, Receptor Type, E Isof 1e-15
2nlk_A627 Crystal Structure Of D1 And D2 Catalytic Domains Of 8e-63
2nlk_A 627 Crystal Structure Of D1 And D2 Catalytic Domains Of 9e-16
1lar_A575 Crystal Structure Of The Tandem Phosphatase Domains 3e-61
1lar_A 575 Crystal Structure Of The Tandem Phosphatase Domains 4e-13
2fh7_A595 Crystal Structure Of The Phosphatase Domains Of Hum 1e-59
2fh7_A 595 Crystal Structure Of The Phosphatase Domains Of Hum 5e-13
3sr9_A583 Crystal Structure Of Mouse Ptpsigma Length = 583 2e-58
3sr9_A 583 Crystal Structure Of Mouse Ptpsigma Length = 583 1e-12
1ygr_A610 Crystal Structure Of The Tandem Phosphatase Domain 4e-53
1ygr_A 610 Crystal Structure Of The Tandem Phosphatase Domain 7e-10
1yfo_A302 Receptor Protein Tyrosine Phosphatase Alpha, Domain 2e-48
1yfo_A302 Receptor Protein Tyrosine Phosphatase Alpha, Domain 1e-15
1yfo_A 302 Receptor Protein Tyrosine Phosphatase Alpha, Domain 1e-15
2c7s_A313 Crystal Structure Of Human Protein Tyrosine Phospha 1e-44
2c7s_A 313 Crystal Structure Of Human Protein Tyrosine Phospha 7e-14
2pbn_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 2e-44
2pbn_A 313 Crystal Structure Of The Human Tyrosine Receptor Ph 3e-12
2ooq_A286 Crystal Structure Of The Human Receptor Phosphatase 1e-43
2ooq_A 286 Crystal Structure Of The Human Receptor Phosphatase 1e-12
3qcl_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 2e-43
3qcl_A 310 Human Receptor Protein Tyrosine Phosphatase Gamma, 3e-12
3qcm_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 2e-43
3qcm_A 310 Human Receptor Protein Tyrosine Phosphatase Gamma, 2e-12
3qcb_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 3e-43
3qcb_A 310 Human Receptor Protein Tyrosine Phosphatase Gamma, 3e-12
2nv5_A299 Crystal Structure Of A C-Terminal Phosphatase Domai 1e-42
2nv5_A 299 Crystal Structure Of A C-Terminal Phosphatase Domai 1e-10
2h4v_A320 Crystal Structure Of The Human Tyrosine Receptor Ph 1e-42
2h4v_A 320 Crystal Structure Of The Human Tyrosine Receptor Ph 3e-12
2hy3_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 6e-42
2hy3_A 313 Crystal Structure Of The Human Tyrosine Receptor Ph 1e-10
1rpm_A278 Human Receptor Protein Tyrosine Phosphatase Mu, Dom 2e-41
1rpm_A 278 Human Receptor Protein Tyrosine Phosphatase Mu, Dom 2e-11
3s3e_A307 Crystal Structure Of The Catalytic Domain Of Ptp10d 3e-40
3s3e_A307 Crystal Structure Of The Catalytic Domain Of Ptp10d 4e-11
3s3e_A 307 Crystal Structure Of The Catalytic Domain Of Ptp10d 6e-11
2h02_A313 Structural Studies Of Protein Tyrosine Phosphatase 1e-37
2h02_A 313 Structural Studies Of Protein Tyrosine Phosphatase 2e-11
2ahs_A295 Crystal Structure Of The Catalytic Domain Of Human 2e-37
2ahs_A 295 Crystal Structure Of The Catalytic Domain Of Human 2e-11
2shp_A525 Tyrosine Phosphatase Shp-2 Length = 525 1e-36
2shp_A525 Tyrosine Phosphatase Shp-2 Length = 525 6e-09
2shp_A 525 Tyrosine Phosphatase Shp-2 Length = 525 1e-08
3b7o_A316 Crystal Structure Of The Human Tyrosine Phosphatase 1e-36
3b7o_A316 Crystal Structure Of The Human Tyrosine Phosphatase 6e-09
3b7o_A 316 Crystal Structure Of The Human Tyrosine Phosphatase 1e-08
3o5x_A276 Crystal Structure Of The Oncogenic Tyrosine Phospha 2e-35
3o5x_A276 Crystal Structure Of The Oncogenic Tyrosine Phospha 8e-09
3o5x_A 276 Crystal Structure Of The Oncogenic Tyrosine Phospha 1e-08
2h03_A291 Structural Studies Of Protein Tyrosine Phosphatase 2e-35
2h03_A 291 Structural Studies Of Protein Tyrosine Phosphatase 2e-11
3i36_A342 Crystal Structure Of Rat Protein Tyrosine Phosphata 6e-35
3i36_A342 Crystal Structure Of Rat Protein Tyrosine Phosphata 2e-12
3i36_A 342 Crystal Structure Of Rat Protein Tyrosine Phosphata 2e-11
2b3o_A532 Crystal Structure Of Human Tyrosine Phosphatase Shp 2e-34
2b3o_A532 Crystal Structure Of Human Tyrosine Phosphatase Shp 2e-08
2b3o_A 532 Crystal Structure Of Human Tyrosine Phosphatase Shp 2e-08
4gs0_A308 Crystal Structure Of Shp1 Catalytic Domain With Jak 3e-34
4gs0_A308 Crystal Structure Of Shp1 Catalytic Domain With Jak 3e-08
4gs0_A 308 Crystal Structure Of Shp1 Catalytic Domain With Jak 3e-08
2pi7_A312 Structure Of The Catalytic Domain Of The Chick Reti 3e-34
2pi7_A312 Structure Of The Catalytic Domain Of The Chick Reti 1e-08
2pi7_A 312 Structure Of The Catalytic Domain Of The Chick Reti 1e-08
1gwz_A299 Crystal Structure Of The Catalytic Domain Of The Pr 4e-34
1gwz_A299 Crystal Structure Of The Catalytic Domain Of The Pr 2e-08
1gwz_A 299 Crystal Structure Of The Catalytic Domain Of The Pr 3e-08
2gjt_A295 Crystal Structure Of The Human Receptor Phosphatase 5e-34
2gjt_A295 Crystal Structure Of The Human Receptor Phosphatase 3e-08
2gjt_A 295 Crystal Structure Of The Human Receptor Phosphatase 3e-08
2g59_A297 Crystal Structure Of The Catalytic Domain Of Protei 6e-34
2g59_A297 Crystal Structure Of The Catalytic Domain Of Protei 3e-08
2g59_A 297 Crystal Structure Of The Catalytic Domain Of Protei 3e-08
1nwl_A298 Crystal Structure Of The Ptp1b Complexed With Sp734 7e-34
1nwl_A 298 Crystal Structure Of The Ptp1b Complexed With Sp734 1e-07
4i8n_A354 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-33
4i8n_A 354 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-07
2nz6_A316 Crystal Structure Of The Ptprj Inactivating Mutant 2e-33
2nz6_A316 Crystal Structure Of The Ptprj Inactivating Mutant 7e-12
2nz6_A 316 Crystal Structure Of The Ptprj Inactivating Mutant 2e-11
3ps5_A595 Crystal Structure Of The Full-Length Human Protein 3e-33
3ps5_A 595 Crystal Structure Of The Full-Length Human Protein 2e-08
3ps5_A 595 Crystal Structure Of The Full-Length Human Protein 2e-08
2fjm_A310 The Structure Of Phosphotyrosine Phosphatase 1b In 3e-33
2fjm_A 310 The Structure Of Phosphotyrosine Phosphatase 1b In 2e-07
2pa5_A314 Crystal Structure Of Human Protein Tyrosine Phospha 3e-33
2pa5_A314 Crystal Structure Of Human Protein Tyrosine Phospha 1e-07
2pa5_A 314 Crystal Structure Of Human Protein Tyrosine Phospha 1e-07
2cfv_A316 Crystal Structure Of Human Protein Tyrosine Phospha 4e-33
2cfv_A316 Crystal Structure Of Human Protein Tyrosine Phospha 6e-12
2cfv_A 316 Crystal Structure Of Human Protein Tyrosine Phospha 2e-11
1bzc_A321 Human Ptp1b Catalytic Domain Complexed With Tpi Len 4e-33
1bzc_A 321 Human Ptp1b Catalytic Domain Complexed With Tpi Len 1e-07
2cma_A327 Structural Basis For Inhibition Of Protein Tyrosine 4e-33
2cma_A 327 Structural Basis For Inhibition Of Protein Tyrosine 1e-07
1nl9_A321 Potent, Selective Protein Tyrosine Phosphatase 1b I 4e-33
1nl9_A 321 Potent, Selective Protein Tyrosine Phosphatase 1b I 1e-07
1q6j_A310 The Structure Of Phosphotyrosine Phosphatase 1b In 4e-33
1q6j_A 310 The Structure Of Phosphotyrosine Phosphatase 1b In 2e-07
2azr_A299 Crystal Structure Of Ptp1b With Bicyclic Thiophene 5e-33
2azr_A 299 Crystal Structure Of Ptp1b With Bicyclic Thiophene 1e-07
1bzh_A298 Cyclic Peptide Inhibitor Of Human Ptp1b Length = 29 5e-33
1bzh_A 298 Cyclic Peptide Inhibitor Of Human Ptp1b Length = 29 1e-07
1g7g_A298 Human Ptp1b Catalytic Domain Complexes With Pnu1793 5e-33
1g7g_A 298 Human Ptp1b Catalytic Domain Complexes With Pnu1793 1e-07
2cm2_A304 Structure Of Protein Tyrosine Phosphatase 1b (P2121 5e-33
2cm2_A 304 Structure Of Protein Tyrosine Phosphatase 1b (P2121 1e-07
1g7f_A298 Human Ptp1b Catalytic Domain Complexed With Pnu1774 5e-33
1g7f_A 298 Human Ptp1b Catalytic Domain Complexed With Pnu1774 2e-07
1bzj_A297 Human Ptp1b Complexed With Tpicooh Length = 297 5e-33
1bzj_A 297 Human Ptp1b Complexed With Tpicooh Length = 297 1e-07
3sme_A300 Structure Of Ptp1b Inactivated By H2o2BICARBONATE L 6e-33
3sme_A 300 Structure Of Ptp1b Inactivated By H2o2BICARBONATE L 1e-07
2nt7_A299 Crystal Structure Of Ptp1b-inhibitor Complex Length 6e-33
2nt7_A 299 Crystal Structure Of Ptp1b-inhibitor Complex Length 2e-07
3cwe_A290 Ptp1b In Complex With A Phosphonic Acid Inhibitor L 6e-33
3cwe_A 290 Ptp1b In Complex With A Phosphonic Acid Inhibitor L 1e-07
2f6f_A302 The Structure Of The S295f Mutant Of Human Ptp1b Le 6e-33
2f6f_A 302 The Structure Of The S295f Mutant Of Human Ptp1b Le 1e-07
1lqf_A295 Structure Of Ptp1b In Complex With A Peptidic Bisph 6e-33
1lqf_A 295 Structure Of Ptp1b In Complex With A Peptidic Bisph 2e-07
1l8g_A321 Crystal Structure Of Ptp1b Complexed With 7-(1,1-di 6e-33
1l8g_A 321 Crystal Structure Of Ptp1b Complexed With 7-(1,1-di 1e-07
4gry_A288 Crystal Structure Of Shp1 Catalytic Domain With Jak 8e-33
4gry_A288 Crystal Structure Of Shp1 Catalytic Domain With Jak 3e-08
4gry_A 288 Crystal Structure Of Shp1 Catalytic Domain With Jak 3e-08
1ecv_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 8e-33
1ecv_A 298 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-07
2i1y_A301 Crystal Structure Of The Phosphatase Domain Of Huma 8e-33
2i1y_A 301 Crystal Structure Of The Phosphatase Domain Of Huma 3e-11
1fpr_A284 Crystal Structure Of The Complex Formed Between The 9e-33
1fpr_A284 Crystal Structure Of The Complex Formed Between The 3e-08
1fpr_A 284 Crystal Structure Of The Complex Formed Between The 3e-08
2i75_A320 Crystal Structure Of Human Protein Tyrosine Phospha 1e-32
2i75_A 320 Crystal Structure Of Human Protein Tyrosine Phospha 2e-09
1c86_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-32
1c86_A 298 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-07
1gfy_A298 Residue 259 Is A Key Determinant Of Substrate Speci 3e-32
1gfy_A 298 Residue 259 Is A Key Determinant Of Substrate Speci 2e-07
2qep_A304 Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2be 5e-32
2qep_A304 Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2be 1e-09
2qep_A 304 Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2be 1e-09
3qkp_A321 Protein Tyrosine Phosphatase 1b - Apo W179f Mutant 6e-32
3qkp_A 321 Protein Tyrosine Phosphatase 1b - Apo W179f Mutant 1e-07
2p6x_A309 Crystal Structure Of Human Tyrosine Phosphatase Ptp 7e-32
2p6x_A309 Crystal Structure Of Human Tyrosine Phosphatase Ptp 9e-11
2p6x_A 309 Crystal Structure Of Human Tyrosine Phosphatase Ptp 9e-11
3h2x_A302 Crystal Structure Of The Human Lymphoid Tyrosine Ph 7e-32
3h2x_A302 Crystal Structure Of The Human Lymphoid Tyrosine Ph 9e-11
3h2x_A 302 Crystal Structure Of The Human Lymphoid Tyrosine Ph 9e-11
1g1f_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 7e-32
1g1f_A 298 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-07
1een_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 8e-32
1een_A 321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-07
1aax_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 8e-32
1aax_A 321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-07
3zv2_A320 Human Protein-Tyrosine Phosphatase 1b C215a, S216a 8e-32
3zv2_A 320 Human Protein-Tyrosine Phosphatase 1b C215a, S216a 1e-07
2qcj_A313 Native Structure Of Lyp Length = 313 8e-32
2qcj_A313 Native Structure Of Lyp Length = 313 7e-11
2qcj_A 313 Native Structure Of Lyp Length = 313 7e-11
1i57_A310 Crystal Structure Of Apo Human Ptp1b (C215s) Mutant 9e-32
1i57_A 310 Crystal Structure Of Apo Human Ptp1b (C215s) Mutant 2e-07
1oeo_X321 Ptp1b With The Catalytic Cysteine Oxidized To Sulfo 1e-31
1oeo_X 321 Ptp1b With The Catalytic Cysteine Oxidized To Sulfo 1e-07
3eu0_A327 Crystal Structure Of The S-Nitrosylated Cys215 Of P 1e-31
3eu0_A 327 Crystal Structure Of The S-Nitrosylated Cys215 Of P 1e-07
1ptu_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-31
1ptu_A 321 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-07
1ptv_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-31
1ptv_A 321 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-07
1a5y_A330 Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate 1e-31
1a5y_A 330 Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate 1e-07
3a5k_A304 Crystal Structure Of Protein-Tyrosine Phosphatase 1 1e-31
3a5k_A 304 Crystal Structure Of Protein-Tyrosine Phosphatase 1 2e-07
1pa1_A310 Crystal Structure Of The C215d Mutant Of Protein Ty 2e-31
1pa1_A 310 Crystal Structure Of The C215d Mutant Of Protein Ty 2e-07
2oc3_A303 Crystal Structure Of The Catalytic Domain Of Human 4e-31
2oc3_A 303 Crystal Structure Of The Catalytic Domain Of Human 4e-14
1l8k_A314 T Cell Protein-Tyrosine Phosphatase Structure Lengt 6e-31
1l8k_A 314 T Cell Protein-Tyrosine Phosphatase Structure Lengt 3e-08
1p15_A253 Crystal Structure Of The D2 Domain Of Rptpa Length 1e-30
1p15_A 253 Crystal Structure Of The D2 Domain Of Rptpa Length 5e-13
3olr_A313 Ptpn22 In Complex With Consensus Phospho-Tyrosine P 2e-30
3olr_A313 Ptpn22 In Complex With Consensus Phospho-Tyrosine P 7e-11
3olr_A 313 Ptpn22 In Complex With Consensus Phospho-Tyrosine P 7e-11
1zc0_A309 Crystal Structure Of Human Hematopoietic Tyrosine P 3e-30
1zc0_A309 Crystal Structure Of Human Hematopoietic Tyrosine P 2e-09
1zc0_A 309 Crystal Structure Of Human Hematopoietic Tyrosine P 5e-09
2a3k_A296 Crystal Structure Of The Human Protein Tyrosine Pho 3e-30
2a3k_A296 Crystal Structure Of The Human Protein Tyrosine Pho 2e-09
2a3k_A 296 Crystal Structure Of The Human Protein Tyrosine Pho 5e-09
3o4s_A308 Crystal Structure Of Heptp With A Closed Wpd Loop A 3e-30
3o4s_A308 Crystal Structure Of Heptp With A Closed Wpd Loop A 2e-09
3o4s_A 308 Crystal Structure Of Heptp With A Closed Wpd Loop A 5e-09
3d42_A308 Crystal Structure Of Heptp In Complex With A Monoph 1e-29
3d42_A308 Crystal Structure Of Heptp In Complex With A Monoph 4e-09
3d42_A 308 Crystal Structure Of Heptp In Complex With A Monoph 1e-08
2gp0_A309 Heptp Catalytic Domain (Residues 44-339), S225d Mut 1e-29
2gp0_A309 Heptp Catalytic Domain (Residues 44-339), S225d Mut 2e-09
2gp0_A 309 Heptp Catalytic Domain (Residues 44-339), S225d Mut 5e-09
3brh_A310 Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To 1e-29
3brh_A310 Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To 9e-11
3brh_A 310 Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To 9e-11
2b49_A287 Crystal Structure Of The Catalytic Domain Of Protei 2e-29
2b49_A287 Crystal Structure Of The Catalytic Domain Of Protei 4e-10
2b49_A 287 Crystal Structure Of The Catalytic Domain Of Protei 4e-10
2qdc_A309 Crystal Structure Of The Heptp Catalytic Domain D23 2e-29
2qdc_A309 Crystal Structure Of The Heptp Catalytic Domain D23 2e-09
2qdc_A 309 Crystal Structure Of The Heptp Catalytic Domain D23 5e-09
2hvl_A309 Crystal Structure Of The Heptp Catalytic Domain C27 6e-29
2hvl_A309 Crystal Structure Of The Heptp Catalytic Domain C27 2e-09
2hvl_A 309 Crystal Structure Of The Heptp Catalytic Domain C27 5e-09
2qdm_A309 Crystal Structure Of The Heptp Catalytic Domain C27 4e-28
2qdm_A309 Crystal Structure Of The Heptp Catalytic Domain C27 2e-09
2qdm_A 309 Crystal Structure Of The Heptp Catalytic Domain C27 5e-09
2bij_A305 Crystal Structure Of The Human Protein Tyrosine Pho 3e-27
2bij_A 305 Crystal Structure Of The Human Protein Tyrosine Pho 5e-08
1wch_A315 Crystal Structure Of Ptpl1 Human Tyrosine Phosphata 4e-26
1wch_A 315 Crystal Structure Of Ptpl1 Human Tyrosine Phosphata 6e-10
2cjz_A305 Crystal Structure Of The C472s Mutant Of Human Prot 7e-26
2cjz_A 305 Crystal Structure Of The C472s Mutant Of Human Prot 6e-08
2bv5_A282 Crystal Structure Of The Human Protein Tyrosine Pho 1e-25
2bv5_A 282 Crystal Structure Of The Human Protein Tyrosine Pho 6e-08
2a8b_A283 Crystal Structure Of The Catalytic Domain Of Human 4e-24
2a8b_A283 Crystal Structure Of The Catalytic Domain Of Human 3e-08
2a8b_A 283 Crystal Structure Of The Catalytic Domain Of Human 5e-08
1jln_A297 Crystal Structure Of The Catalytic Domain Of Protei 4e-24
1jln_A297 Crystal Structure Of The Catalytic Domain Of Protei 1e-08
1jln_A 297 Crystal Structure Of The Catalytic Domain Of Protei 2e-08
2bzl_A325 Crystal Structure Of The Human Protein Tyrosine Pho 1e-21
2bzl_A325 Crystal Structure Of The Human Protein Tyrosine Pho 2e-10
2bzl_A 325 Crystal Structure Of The Human Protein Tyrosine Pho 2e-10
3m4u_A306 Crystal Structure Of Trypanosoma Brucei Protein Tyr 1e-18
4az1_A302 Crystal Structure Of The Trypanosoma Cruzi Protein 3e-18
>pdb|2JJD|A Chain A, Protein Tyrosine Phosphatase, Receptor Type, E Isoform Length = 599 Back     alignment and structure 
Iteration: 1

 Score =  245 bits (626), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 160/453 (35%), Positives = 237/453 (52%), Gaps = 35/453 (7%)
Query: 23  SNPPDMAPITRADIVMEYDERHYDSDYGFQQEFEQLVNEHFPDRSTKASEARENQHKNRY 82
           S P    PI    +  E   R  D    F++EF  L + H    + + +   EN+ KNRY
Sbjct: 2   SGPKKYFPIPVEHLEEEIRIRSADDCKQFREEFNSLPSGHI-QGTFELANKEENREKNRY 60
Query: 83  PDIKAYDQTRVKLTPVDGVPGSDYINANFVLGYKELKKFICAQGPMEHTVNDFWRMIWEQ 142
           P+I   D +RV L+ +DG+P SDYINA+++ GYKE  KFI AQGP + TVNDFWRM+WEQ
Sbjct: 61  PNILPNDHSRVILSQLDGIPCSDYINASYIDGYKEKNKFIAAQGPKQETVNDFWRMVWEQ 120
Query: 143 HLEIVIMLTNLEEYSKIKCAKYWPEQEEGDKTYGDFIVGLVNEKKFGEYILRELKLVRTA 202
               ++MLTNL+E  + KC +YWP+Q  G  TYG+  V + +     +Y +R+  +    
Sbjct: 121 KSATIVMLTNLKERKEEKCHQYWPDQ--GCWTYGNIRVCVEDCVVLVDYTIRKFCIQPQL 178
Query: 203 SGKESEERSIFQYHYLAWKDFQAPENPSGLLKFIKHVNEAYSLEKGPILVHCRALVEVVQ 262
                  R + Q H+ +W DF  P  P G+LKF+K V     +  GPI+VHC A      
Sbjct: 179 PDGCKAPRLVSQLHFTSWPDFGVPFTPIGMLKFLKKVKTLNPVHAGPIVVHCSA------ 232
Query: 263 FGETEIRATDLKSTLETLKRVNDGNKKSELELEFEETHNKCSDHLIRSACQFYLIHQVNL 322
                +  T     ++ +  +    +K ++  EF          ++++  Q+  I+Q  L
Sbjct: 233 ----GVGRTGTFIVIDAMMAMMHAEQKVDV-FEFVSRIRNQRPQMVQTDMQYTFIYQALL 287
Query: 323 ---ASGPDQVYVLRLTQAKEENKSTTNAKSEDLTVLGV-----RLTQAK--EENKSTTNA 372
                G  ++ V  L    E++  T +  +     +G+     +LT  +  +EN  T N 
Sbjct: 288 EYYLYGDTELDVSSL----EKHLQTMHGTTTHFDKIGLEEEFRKLTNVRIMKENMRTGNL 343
Query: 373 KSEENKDKNRDESIIPYDRNRVILSP--AKDYSNYINASFIEAYDNTESFIITQDPDMEH 430
            +  N  K R   IIPYD NRVILS    ++Y++YINASFI+ Y   + FI TQ P + H
Sbjct: 344 PA--NMKKARVIQIIPYDFNRVILSMKRGQEYTDYINASFIDGYRQKDYFIATQGP-LAH 400
Query: 431 TVHDFWRMISEHTISTIIMLSDRLTQAKEENKS 463
           TV DFWRMI E    TI+ML++   Q +E++K 
Sbjct: 401 TVEDFWRMIWEWKSHTIVMLTE--VQEREQDKC 431
>pdb|2JJD|A Chain A, Protein Tyrosine Phosphatase, Receptor Type, E Isoform Length = 599 Back     alignment and structure
>pdb|2NLK|A Chain A, Crystal Structure Of D1 And D2 Catalytic Domains Of Human Protein Tyrosine Phosphatase Gamma (D1+d2 Ptprg) Length = 627 Back     alignment and structure
>pdb|2NLK|A Chain A, Crystal Structure Of D1 And D2 Catalytic Domains Of Human Protein Tyrosine Phosphatase Gamma (D1+d2 Ptprg) Length = 627 Back     alignment and structure
>pdb|1LAR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domains Of Rptp Lar Length = 575 Back     alignment and structure
>pdb|1LAR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domains Of Rptp Lar Length = 575 Back     alignment and structure
>pdb|2FH7|A Chain A, Crystal Structure Of The Phosphatase Domains Of Human Ptp Sigma Length = 595 Back     alignment and structure
>pdb|2FH7|A Chain A, Crystal Structure Of The Phosphatase Domains Of Human Ptp Sigma Length = 595 Back     alignment and structure
>pdb|3SR9|A Chain A, Crystal Structure Of Mouse Ptpsigma Length = 583 Back     alignment and structure
>pdb|3SR9|A Chain A, Crystal Structure Of Mouse Ptpsigma Length = 583 Back     alignment and structure
>pdb|1YGR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domain Of Rptp Cd45 Length = 610 Back     alignment and structure
>pdb|1YGR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domain Of Rptp Cd45 Length = 610 Back     alignment and structure
>pdb|1YFO|A Chain A, Receptor Protein Tyrosine Phosphatase Alpha, Domain 1 From Mouse Length = 302 Back     alignment and structure
>pdb|1YFO|A Chain A, Receptor Protein Tyrosine Phosphatase Alpha, Domain 1 From Mouse Length = 302 Back     alignment and structure
>pdb|1YFO|A Chain A, Receptor Protein Tyrosine Phosphatase Alpha, Domain 1 From Mouse Length = 302 Back     alignment and structure
>pdb|2C7S|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Kappa At 1.95a Resolution Length = 313 Back     alignment and structure
>pdb|2C7S|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Kappa At 1.95a Resolution Length = 313 Back     alignment and structure
>pdb|2PBN|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma Length = 313 Back     alignment and structure
>pdb|2PBN|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma Length = 313 Back     alignment and structure
>pdb|2OOQ|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptprt Length = 286 Back     alignment and structure
>pdb|2OOQ|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptprt Length = 286 Back     alignment and structure
>pdb|3QCL|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-(4-Hydroxybut-1-Yn-1- Yl)benzoic Acid Length = 310 Back     alignment and structure
>pdb|3QCL|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-(4-Hydroxybut-1-Yn-1- Yl)benzoic Acid Length = 310 Back     alignment and structure
>pdb|3QCM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-{[3-({n-[2- (Methylamino)ethyl]glycyl}amino)phenyl]ethynyl}benzoic Acid Length = 310 Back     alignment and structure
>pdb|3QCM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-{[3-({n-[2- (Methylamino)ethyl]glycyl}amino)phenyl]ethynyl}benzoic Acid Length = 310 Back     alignment and structure
>pdb|3QCB|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, Apo Length = 310 Back     alignment and structure
>pdb|3QCB|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, Apo Length = 310 Back     alignment and structure
>pdb|2NV5|A Chain A, Crystal Structure Of A C-Terminal Phosphatase Domain Of Rattus Norvegicus Ortholog Of Human Protein Tyrosine Phosphatase, Receptor Type, D (Ptprd) Length = 299 Back     alignment and structure
>pdb|2NV5|A Chain A, Crystal Structure Of A C-Terminal Phosphatase Domain Of Rattus Norvegicus Ortholog Of Human Protein Tyrosine Phosphatase, Receptor Type, D (Ptprd) Length = 299 Back     alignment and structure
>pdb|2H4V|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphatase Gamma Length = 320 Back     alignment and structure
>pdb|2H4V|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphatase Gamma Length = 320 Back     alignment and structure
>pdb|2HY3|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma In Complex With Vanadate Length = 313 Back     alignment and structure
>pdb|2HY3|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma In Complex With Vanadate Length = 313 Back     alignment and structure
>pdb|1RPM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Mu, Domain 1 Length = 278 Back     alignment and structure
>pdb|1RPM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Mu, Domain 1 Length = 278 Back     alignment and structure
>pdb|3S3E|A Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster Length = 307 Back     alignment and structure
>pdb|3S3E|A Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster Length = 307 Back     alignment and structure
>pdb|3S3E|A Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster Length = 307 Back     alignment and structure
>pdb|2H02|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 313 Back     alignment and structure
>pdb|2H02|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 313 Back     alignment and structure
>pdb|2AHS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Receptor Phosphatase Beta Length = 295 Back     alignment and structure
>pdb|2AHS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Receptor Phosphatase Beta Length = 295 Back     alignment and structure
>pdb|2SHP|A Chain A, Tyrosine Phosphatase Shp-2 Length = 525 Back     alignment and structure
>pdb|2SHP|A Chain A, Tyrosine Phosphatase Shp-2 Length = 525 Back     alignment and structure
>pdb|2SHP|A Chain A, Tyrosine Phosphatase Shp-2 Length = 525 Back     alignment and structure
>pdb|3B7O|A Chain A, Crystal Structure Of The Human Tyrosine Phosphatase Shp2 (Ptpn11) With An Accessible Active Site Length = 316 Back     alignment and structure
>pdb|3B7O|A Chain A, Crystal Structure Of The Human Tyrosine Phosphatase Shp2 (Ptpn11) With An Accessible Active Site Length = 316 Back     alignment and structure
>pdb|3B7O|A Chain A, Crystal Structure Of The Human Tyrosine Phosphatase Shp2 (Ptpn11) With An Accessible Active Site Length = 316 Back     alignment and structure
>pdb|3O5X|A Chain A, Crystal Structure Of The Oncogenic Tyrosine Phosphatase Shp2 Complexed With A Salicylic Acid-Based Small Molecule Inhibitor Length = 276 Back     alignment and structure
>pdb|3O5X|A Chain A, Crystal Structure Of The Oncogenic Tyrosine Phosphatase Shp2 Complexed With A Salicylic Acid-Based Small Molecule Inhibitor Length = 276 Back     alignment and structure
>pdb|3O5X|A Chain A, Crystal Structure Of The Oncogenic Tyrosine Phosphatase Shp2 Complexed With A Salicylic Acid-Based Small Molecule Inhibitor Length = 276 Back     alignment and structure
>pdb|2H03|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 291 Back     alignment and structure
>pdb|2H03|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 291 Back     alignment and structure
>pdb|3I36|A Chain A, Crystal Structure Of Rat Protein Tyrosine Phosphatase Eta Catalytic Domain Length = 342 Back     alignment and structure
>pdb|3I36|A Chain A, Crystal Structure Of Rat Protein Tyrosine Phosphatase Eta Catalytic Domain Length = 342 Back     alignment and structure
>pdb|3I36|A Chain A, Crystal Structure Of Rat Protein Tyrosine Phosphatase Eta Catalytic Domain Length = 342 Back     alignment and structure
>pdb|2B3O|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Shp-1 Length = 532 Back     alignment and structure
>pdb|2B3O|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Shp-1 Length = 532 Back     alignment and structure
>pdb|2B3O|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Shp-1 Length = 532 Back     alignment and structure
>pdb|4GS0|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 308 Back     alignment and structure
>pdb|4GS0|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 308 Back     alignment and structure
>pdb|4GS0|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 308 Back     alignment and structure
>pdb|2PI7|A Chain A, Structure Of The Catalytic Domain Of The Chick Retinal Neurite Inhibitor-Receptor Protein Tyrosine Phosphatase Cryp-2CPTPRO Length = 312 Back     alignment and structure
>pdb|2PI7|A Chain A, Structure Of The Catalytic Domain Of The Chick Retinal Neurite Inhibitor-Receptor Protein Tyrosine Phosphatase Cryp-2CPTPRO Length = 312 Back     alignment and structure
>pdb|2PI7|A Chain A, Structure Of The Catalytic Domain Of The Chick Retinal Neurite Inhibitor-Receptor Protein Tyrosine Phosphatase Cryp-2CPTPRO Length = 312 Back     alignment and structure
>pdb|1GWZ|A Chain A, Crystal Structure Of The Catalytic Domain Of The Protein Tyrosine Phosphatase Shp-1 Length = 299 Back     alignment and structure
>pdb|1GWZ|A Chain A, Crystal Structure Of The Catalytic Domain Of The Protein Tyrosine Phosphatase Shp-1 Length = 299 Back     alignment and structure
>pdb|1GWZ|A Chain A, Crystal Structure Of The Catalytic Domain Of The Protein Tyrosine Phosphatase Shp-1 Length = 299 Back     alignment and structure
>pdb|2GJT|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptpro Length = 295 Back     alignment and structure
>pdb|2GJT|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptpro Length = 295 Back     alignment and structure
>pdb|2GJT|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptpro Length = 295 Back     alignment and structure
>pdb|2G59|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase From Homo Sapiens Length = 297 Back     alignment and structure
>pdb|2G59|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase From Homo Sapiens Length = 297 Back     alignment and structure
>pdb|2G59|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase From Homo Sapiens Length = 297 Back     alignment and structure
>pdb|1NWL|A Chain A, Crystal Structure Of The Ptp1b Complexed With Sp7343-Sp7964, A Ptyr Mimetic Length = 298 Back     alignment and structure
>pdb|1NWL|A Chain A, Crystal Structure Of The Ptp1b Complexed With Sp7343-Sp7964, A Ptyr Mimetic Length = 298 Back     alignment and structure
>pdb|4I8N|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b In Complex With An Inhibitor [(4-{(2s)-2-(1,3-Benzoxazol-2-Yl)-2-[(4-Fluorophenyl) Sulfamoyl]ethyl}phenyl)amino](Oxo)acetic Acid Length = 354 Back     alignment and structure
>pdb|4I8N|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b In Complex With An Inhibitor [(4-{(2s)-2-(1,3-Benzoxazol-2-Yl)-2-[(4-Fluorophenyl) Sulfamoyl]ethyl}phenyl)amino](Oxo)acetic Acid Length = 354 Back     alignment and structure
>pdb|2NZ6|A Chain A, Crystal Structure Of The Ptprj Inactivating Mutant C1239s Length = 316 Back     alignment and structure
>pdb|2NZ6|A Chain A, Crystal Structure Of The Ptprj Inactivating Mutant C1239s Length = 316 Back     alignment and structure
>pdb|2NZ6|A Chain A, Crystal Structure Of The Ptprj Inactivating Mutant C1239s Length = 316 Back     alignment and structure
>pdb|3PS5|A Chain A, Crystal Structure Of The Full-Length Human Protein Tyrosine Phosphatase Shp-1 Length = 595 Back     alignment and structure
>pdb|3PS5|A Chain A, Crystal Structure Of The Full-Length Human Protein Tyrosine Phosphatase Shp-1 Length = 595 Back     alignment and structure
>pdb|3PS5|A Chain A, Crystal Structure Of The Full-Length Human Protein Tyrosine Phosphatase Shp-1 Length = 595 Back     alignment and structure
>pdb|2FJM|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|2FJM|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|2PA5|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Ptpn9 Length = 314 Back     alignment and structure
>pdb|2PA5|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Ptpn9 Length = 314 Back     alignment and structure
>pdb|2PA5|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Ptpn9 Length = 314 Back     alignment and structure
>pdb|2CFV|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Receptor Type J Length = 316 Back     alignment and structure
>pdb|2CFV|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Receptor Type J Length = 316 Back     alignment and structure
>pdb|2CFV|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Receptor Type J Length = 316 Back     alignment and structure
>pdb|1BZC|A Chain A, Human Ptp1b Catalytic Domain Complexed With Tpi Length = 321 Back     alignment and structure
>pdb|1BZC|A Chain A, Human Ptp1b Catalytic Domain Complexed With Tpi Length = 321 Back     alignment and structure
>pdb|2CMA|A Chain A, Structural Basis For Inhibition Of Protein Tyrosine Phosphatase 1b By Isothiazolidinone Heterocyclic Phosphonate Mimetics Length = 327 Back     alignment and structure
>pdb|2CMA|A Chain A, Structural Basis For Inhibition Of Protein Tyrosine Phosphatase 1b By Isothiazolidinone Heterocyclic Phosphonate Mimetics Length = 327 Back     alignment and structure
>pdb|1NL9|A Chain A, Potent, Selective Protein Tyrosine Phosphatase 1b Inhibitor Compound 12 Using A Linked-Fragment Strategy Length = 321 Back     alignment and structure
>pdb|1NL9|A Chain A, Potent, Selective Protein Tyrosine Phosphatase 1b Inhibitor Compound 12 Using A Linked-Fragment Strategy Length = 321 Back     alignment and structure
>pdb|1Q6J|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|1Q6J|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|2AZR|A Chain A, Crystal Structure Of Ptp1b With Bicyclic Thiophene Inhibitor Length = 299 Back     alignment and structure
>pdb|2AZR|A Chain A, Crystal Structure Of Ptp1b With Bicyclic Thiophene Inhibitor Length = 299 Back     alignment and structure
>pdb|1BZH|A Chain A, Cyclic Peptide Inhibitor Of Human Ptp1b Length = 298 Back     alignment and structure
>pdb|1BZH|A Chain A, Cyclic Peptide Inhibitor Of Human Ptp1b Length = 298 Back     alignment and structure
>pdb|1G7G|A Chain A, Human Ptp1b Catalytic Domain Complexes With Pnu179326 Length = 298 Back     alignment and structure
>pdb|1G7G|A Chain A, Human Ptp1b Catalytic Domain Complexes With Pnu179326 Length = 298 Back     alignment and structure
>pdb|2CM2|A Chain A, Structure Of Protein Tyrosine Phosphatase 1b (P212121) Length = 304 Back     alignment and structure
>pdb|2CM2|A Chain A, Structure Of Protein Tyrosine Phosphatase 1b (P212121) Length = 304 Back     alignment and structure
>pdb|1G7F|A Chain A, Human Ptp1b Catalytic Domain Complexed With Pnu177496 Length = 298 Back     alignment and structure
>pdb|1G7F|A Chain A, Human Ptp1b Catalytic Domain Complexed With Pnu177496 Length = 298 Back     alignment and structure
>pdb|1BZJ|A Chain A, Human Ptp1b Complexed With Tpicooh Length = 297 Back     alignment and structure
>pdb|1BZJ|A Chain A, Human Ptp1b Complexed With Tpicooh Length = 297 Back     alignment and structure
>pdb|3SME|A Chain A, Structure Of Ptp1b Inactivated By H2o2BICARBONATE Length = 300 Back     alignment and structure
>pdb|3SME|A Chain A, Structure Of Ptp1b Inactivated By H2o2BICARBONATE Length = 300 Back     alignment and structure
>pdb|2NT7|A Chain A, Crystal Structure Of Ptp1b-inhibitor Complex Length = 299 Back     alignment and structure
>pdb|2NT7|A Chain A, Crystal Structure Of Ptp1b-inhibitor Complex Length = 299 Back     alignment and structure
>pdb|3CWE|A Chain A, Ptp1b In Complex With A Phosphonic Acid Inhibitor Length = 290 Back     alignment and structure
>pdb|3CWE|A Chain A, Ptp1b In Complex With A Phosphonic Acid Inhibitor Length = 290 Back     alignment and structure
>pdb|2F6F|A Chain A, The Structure Of The S295f Mutant Of Human Ptp1b Length = 302 Back     alignment and structure
>pdb|2F6F|A Chain A, The Structure Of The S295f Mutant Of Human Ptp1b Length = 302 Back     alignment and structure
>pdb|1LQF|A Chain A, Structure Of Ptp1b In Complex With A Peptidic Bisphosphonate Inhibitor Length = 295 Back     alignment and structure
>pdb|1LQF|A Chain A, Structure Of Ptp1b In Complex With A Peptidic Bisphosphonate Inhibitor Length = 295 Back     alignment and structure
>pdb|1L8G|A Chain A, Crystal Structure Of Ptp1b Complexed With 7-(1,1-dioxo-1h- Benzo[d]isothiazol-3-yloxymethyl)-2-(oxalyl-amino)-4,7- Dihydro-5h-thieno[2,3-c]pyran-3-carboxylic Acid Length = 321 Back     alignment and structure
>pdb|1L8G|A Chain A, Crystal Structure Of Ptp1b Complexed With 7-(1,1-dioxo-1h- Benzo[d]isothiazol-3-yloxymethyl)-2-(oxalyl-amino)-4,7- Dihydro-5h-thieno[2,3-c]pyran-3-carboxylic Acid Length = 321 Back     alignment and structure
>pdb|4GRY|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 288 Back     alignment and structure
>pdb|4GRY|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 288 Back     alignment and structure
>pdb|4GRY|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 288 Back     alignment and structure
>pdb|1ECV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With 5-Iodo-2-(Oxalyl-Amino)-Benzoic Acid Length = 298 Back     alignment and structure
>pdb|1ECV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With 5-Iodo-2-(Oxalyl-Amino)-Benzoic Acid Length = 298 Back     alignment and structure
>pdb|2I1Y|A Chain A, Crystal Structure Of The Phosphatase Domain Of Human Ptp Ia-2 Length = 301 Back     alignment and structure
>pdb|2I1Y|A Chain A, Crystal Structure Of The Phosphatase Domain Of Human Ptp Ia-2 Length = 301 Back     alignment and structure
>pdb|1FPR|A Chain A, Crystal Structure Of The Complex Formed Between The Catalytic Domain Of Shp-1 And An In Vitro Peptide Substrate Py469 Derived From Shps-1 Length = 284 Back     alignment and structure
>pdb|1FPR|A Chain A, Crystal Structure Of The Complex Formed Between The Catalytic Domain Of Shp-1 And An In Vitro Peptide Substrate Py469 Derived From Shps-1 Length = 284 Back     alignment and structure
>pdb|1FPR|A Chain A, Crystal Structure Of The Complex Formed Between The Catalytic Domain Of Shp-1 And An In Vitro Peptide Substrate Py469 Derived From Shps-1 Length = 284 Back     alignment and structure
>pdb|2I75|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase N4 (Ptpn4) Length = 320 Back     alignment and structure
>pdb|2I75|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase N4 (Ptpn4) Length = 320 Back     alignment and structure
>pdb|1C86|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b (R47v, D48n) Complexed With 2-(Oxalyl-Amino-4,7-Dihydro-5h- Thieno[2,3-C]pyran-3-Carboxylic Acid Length = 298 Back     alignment and structure
>pdb|1C86|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b (R47v, D48n) Complexed With 2-(Oxalyl-Amino-4,7-Dihydro-5h- Thieno[2,3-C]pyran-3-Carboxylic Acid Length = 298 Back     alignment and structure
>pdb|1GFY|A Chain A, Residue 259 Is A Key Determinant Of Substrate Specificity Of Protein-Tyrosine Phosphatase 1b And Alpha Length = 298 Back     alignment and structure
>pdb|1GFY|A Chain A, Residue 259 Is A Key Determinant Of Substrate Specificity Of Protein-Tyrosine Phosphatase 1b And Alpha Length = 298 Back     alignment and structure
>pdb|2QEP|A Chain A, Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2beta) Length = 304 Back     alignment and structure
>pdb|2QEP|A Chain A, Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2beta) Length = 304 Back     alignment and structure
>pdb|2QEP|A Chain A, Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2beta) Length = 304 Back     alignment and structure
>pdb|3QKP|A Chain A, Protein Tyrosine Phosphatase 1b - Apo W179f Mutant With Open Wpd-Loop Length = 321 Back     alignment and structure
>pdb|3QKP|A Chain A, Protein Tyrosine Phosphatase 1b - Apo W179f Mutant With Open Wpd-Loop Length = 321 Back     alignment and structure
>pdb|2P6X|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Ptpn22 Length = 309 Back     alignment and structure
>pdb|2P6X|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Ptpn22 Length = 309 Back     alignment and structure
>pdb|2P6X|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Ptpn22 Length = 309 Back     alignment and structure
>pdb|3H2X|A Chain A, Crystal Structure Of The Human Lymphoid Tyrosine Phosphatase Catalytic Domain Length = 302 Back     alignment and structure
>pdb|3H2X|A Chain A, Crystal Structure Of The Human Lymphoid Tyrosine Phosphatase Catalytic Domain Length = 302 Back     alignment and structure
>pdb|3H2X|A Chain A, Crystal Structure Of The Human Lymphoid Tyrosine Phosphatase Catalytic Domain Length = 302 Back     alignment and structure
>pdb|1G1F|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With A Tri-Phosphorylated Peptide (Rdi(Ptr) Etd(Ptr)(Ptr)rk) From The Insulin Receptor Kinase Length = 298 Back     alignment and structure
>pdb|1G1F|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With A Tri-Phosphorylated Peptide (Rdi(Ptr) Etd(Ptr)(Ptr)rk) From The Insulin Receptor Kinase Length = 298 Back     alignment and structure
>pdb|1EEN|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Acetyl-D-A-D-Bpa-Ptyr-L-I-P-Q-Q-G Length = 321 Back     alignment and structure
>pdb|1EEN|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Acetyl-D-A-D-Bpa-Ptyr-L-I-P-Q-Q-G Length = 321 Back     alignment and structure
>pdb|1AAX|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Two Bis(Para-Phosphophenyl)methane (Bppm) Molecules Length = 321 Back     alignment and structure
>pdb|1AAX|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Two Bis(Para-Phosphophenyl)methane (Bppm) Molecules Length = 321 Back     alignment and structure
>pdb|3ZV2|A Chain A, Human Protein-Tyrosine Phosphatase 1b C215a, S216a Mutant Length = 320 Back     alignment and structure
>pdb|3ZV2|A Chain A, Human Protein-Tyrosine Phosphatase 1b C215a, S216a Mutant Length = 320 Back     alignment and structure
>pdb|2QCJ|A Chain A, Native Structure Of Lyp Length = 313 Back     alignment and structure
>pdb|2QCJ|A Chain A, Native Structure Of Lyp Length = 313 Back     alignment and structure
>pdb|2QCJ|A Chain A, Native Structure Of Lyp Length = 313 Back     alignment and structure
>pdb|1I57|A Chain A, Crystal Structure Of Apo Human Ptp1b (C215s) Mutant Length = 310 Back     alignment and structure
>pdb|1I57|A Chain A, Crystal Structure Of Apo Human Ptp1b (C215s) Mutant Length = 310 Back     alignment and structure
>pdb|1OEO|X Chain X, Ptp1b With The Catalytic Cysteine Oxidized To Sulfonic Acid Length = 321 Back     alignment and structure
>pdb|1OEO|X Chain X, Ptp1b With The Catalytic Cysteine Oxidized To Sulfonic Acid Length = 321 Back     alignment and structure
>pdb|3EU0|A Chain A, Crystal Structure Of The S-Nitrosylated Cys215 Of Ptp1b Length = 327 Back     alignment and structure
>pdb|3EU0|A Chain A, Crystal Structure Of The S-Nitrosylated Cys215 Of Ptp1b Length = 327 Back     alignment and structure
>pdb|1PTU|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine-Containing Hexa-Peptide (Dadepyl-Nh2) Length = 321 Back     alignment and structure
>pdb|1PTU|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine-Containing Hexa-Peptide (Dadepyl-Nh2) Length = 321 Back     alignment and structure
>pdb|1PTV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine Length = 321 Back     alignment and structure
>pdb|1PTV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine Length = 321 Back     alignment and structure
>pdb|1A5Y|A Chain A, Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate Intermediate Length = 330 Back     alignment and structure
>pdb|1A5Y|A Chain A, Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate Intermediate Length = 330 Back     alignment and structure
>pdb|3A5K|A Chain A, Crystal Structure Of Protein-Tyrosine Phosphatase 1b Length = 304 Back     alignment and structure
>pdb|3A5K|A Chain A, Crystal Structure Of Protein-Tyrosine Phosphatase 1b Length = 304 Back     alignment and structure
>pdb|1PA1|A Chain A, Crystal Structure Of The C215d Mutant Of Protein Tyrosine Phosphatase 1b Length = 310 Back     alignment and structure
>pdb|1PA1|A Chain A, Crystal Structure Of The C215d Mutant Of Protein Tyrosine Phosphatase 1b Length = 310 Back     alignment and structure
>pdb|2OC3|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Protein Tyrosine Phosphatase Non-Receptor Type 18 Length = 303 Back     alignment and structure
>pdb|2OC3|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Protein Tyrosine Phosphatase Non-Receptor Type 18 Length = 303 Back     alignment and structure
>pdb|1L8K|A Chain A, T Cell Protein-Tyrosine Phosphatase Structure Length = 314 Back     alignment and structure
>pdb|1L8K|A Chain A, T Cell Protein-Tyrosine Phosphatase Structure Length = 314 Back     alignment and structure
>pdb|1P15|A Chain A, Crystal Structure Of The D2 Domain Of Rptpa Length = 253 Back     alignment and structure
>pdb|1P15|A Chain A, Crystal Structure Of The D2 Domain Of Rptpa Length = 253 Back     alignment and structure
>pdb|3OLR|A Chain A, Ptpn22 In Complex With Consensus Phospho-Tyrosine Peptide 1 Length = 313 Back     alignment and structure
>pdb|3OLR|A Chain A, Ptpn22 In Complex With Consensus Phospho-Tyrosine Peptide 1 Length = 313 Back     alignment and structure
>pdb|3OLR|A Chain A, Ptpn22 In Complex With Consensus Phospho-Tyrosine Peptide 1 Length = 313 Back     alignment and structure
>pdb|1ZC0|A Chain A, Crystal Structure Of Human Hematopoietic Tyrosine Phosphatase (heptp) Catalytic Domain Length = 309 Back     alignment and structure
>pdb|1ZC0|A Chain A, Crystal Structure Of Human Hematopoietic Tyrosine Phosphatase (heptp) Catalytic Domain Length = 309 Back     alignment and structure
>pdb|1ZC0|A Chain A, Crystal Structure Of Human Hematopoietic Tyrosine Phosphatase (heptp) Catalytic Domain Length = 309 Back     alignment and structure
>pdb|2A3K|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Ptpn7 (Heptp, Hematopoietic Protein Tyrosine Phosphatase) Length = 296 Back     alignment and structure
>pdb|2A3K|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Ptpn7 (Heptp, Hematopoietic Protein Tyrosine Phosphatase) Length = 296 Back     alignment and structure
>pdb|2A3K|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Ptpn7 (Heptp, Hematopoietic Protein Tyrosine Phosphatase) Length = 296 Back     alignment and structure
>pdb|3O4S|A Chain A, Crystal Structure Of Heptp With A Closed Wpd Loop And An Ordered E- Loop Length = 308 Back     alignment and structure
>pdb|3O4S|A Chain A, Crystal Structure Of Heptp With A Closed Wpd Loop And An Ordered E- Loop Length = 308 Back     alignment and structure
>pdb|3O4S|A Chain A, Crystal Structure Of Heptp With A Closed Wpd Loop And An Ordered E- Loop Length = 308 Back     alignment and structure
>pdb|3D42|A Chain A, Crystal Structure Of Heptp In Complex With A Monophosphorylated Erk2 Peptide Length = 308 Back     alignment and structure
>pdb|3D42|A Chain A, Crystal Structure Of Heptp In Complex With A Monophosphorylated Erk2 Peptide Length = 308 Back     alignment and structure
>pdb|3D42|A Chain A, Crystal Structure Of Heptp In Complex With A Monophosphorylated Erk2 Peptide Length = 308 Back     alignment and structure
>pdb|2GP0|A Chain A, Heptp Catalytic Domain (Residues 44-339), S225d Mutant Length = 309 Back     alignment and structure
>pdb|2GP0|A Chain A, Heptp Catalytic Domain (Residues 44-339), S225d Mutant Length = 309 Back     alignment and structure
>pdb|2GP0|A Chain A, Heptp Catalytic Domain (Residues 44-339), S225d Mutant Length = 309 Back     alignment and structure
>pdb|3BRH|A Chain A, Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To The Mono-Phosphorylated Lck Active Site Peptide Length = 310 Back     alignment and structure
>pdb|3BRH|A Chain A, Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To The Mono-Phosphorylated Lck Active Site Peptide Length = 310 Back     alignment and structure
>pdb|3BRH|A Chain A, Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To The Mono-Phosphorylated Lck Active Site Peptide Length = 310 Back     alignment and structure
>pdb|2B49|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase, Non-Receptor Type 3 Length = 287 Back     alignment and structure
>pdb|2B49|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase, Non-Receptor Type 3 Length = 287 Back     alignment and structure
>pdb|2B49|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase, Non-Receptor Type 3 Length = 287 Back     alignment and structure
>pdb|2QDC|A Chain A, Crystal Structure Of The Heptp Catalytic Domain D236a Mutant Length = 309 Back     alignment and structure
>pdb|2QDC|A Chain A, Crystal Structure Of The Heptp Catalytic Domain D236a Mutant Length = 309 Back     alignment and structure
>pdb|2QDC|A Chain A, Crystal Structure Of The Heptp Catalytic Domain D236a Mutant Length = 309 Back     alignment and structure
>pdb|2HVL|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270s Mutant Length = 309 Back     alignment and structure
>pdb|2HVL|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270s Mutant Length = 309 Back     alignment and structure
>pdb|2HVL|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270s Mutant Length = 309 Back     alignment and structure
>pdb|2QDM|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270sD236AQ314A Mutant Length = 309 Back     alignment and structure
>pdb|2QDM|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270sD236AQ314A Mutant Length = 309 Back     alignment and structure
>pdb|2QDM|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270sD236AQ314A Mutant Length = 309 Back     alignment and structure
>pdb|2BIJ|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 (step, Striatum Enriched Enriched Phosphatase) Length = 305 Back     alignment and structure
>pdb|2BIJ|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 (step, Striatum Enriched Enriched Phosphatase) Length = 305 Back     alignment and structure
>pdb|1WCH|A Chain A, Crystal Structure Of Ptpl1 Human Tyrosine Phosphatase Mutated In Colorectal Cancer - Evidence For A Second Phosphotyrosine Substrate Recognition Pocket Length = 315 Back     alignment and structure
>pdb|1WCH|A Chain A, Crystal Structure Of Ptpl1 Human Tyrosine Phosphatase Mutated In Colorectal Cancer - Evidence For A Second Phosphotyrosine Substrate Recognition Pocket Length = 315 Back     alignment and structure
>pdb|2CJZ|A Chain A, Crystal Structure Of The C472s Mutant Of Human Protein Tyrosine Phosphatase Ptpn5 (Step, Striatum Enriched Phosphatase) In Complex With Phosphotyrosine Length = 305 Back     alignment and structure
>pdb|2CJZ|A Chain A, Crystal Structure Of The C472s Mutant Of Human Protein Tyrosine Phosphatase Ptpn5 (Step, Striatum Enriched Phosphatase) In Complex With Phosphotyrosine Length = 305 Back     alignment and structure
>pdb|2BV5|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 At 1.8a Resolution Length = 282 Back     alignment and structure
>pdb|2BV5|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 At 1.8a Resolution Length = 282 Back     alignment and structure
>pdb|2A8B|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Phosphatase Receptor, Type R Length = 283 Back     alignment and structure
>pdb|2A8B|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Phosphatase Receptor, Type R Length = 283 Back     alignment and structure
>pdb|2A8B|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Phosphatase Receptor, Type R Length = 283 Back     alignment and structure
>pdb|1JLN|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase Ptp-SlBR7 Length = 297 Back     alignment and structure
>pdb|1JLN|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase Ptp-SlBR7 Length = 297 Back     alignment and structure
>pdb|1JLN|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase Ptp-SlBR7 Length = 297 Back     alignment and structure
>pdb|2BZL|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase N14 At 1.65 A Resolution Length = 325 Back     alignment and structure
>pdb|2BZL|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase N14 At 1.65 A Resolution Length = 325 Back     alignment and structure
>pdb|2BZL|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase N14 At 1.65 A Resolution Length = 325 Back     alignment and structure
>pdb|3M4U|A Chain A, Crystal Structure Of Trypanosoma Brucei Protein Tyrosine Phosphatase Tbptp1 Length = 306 Back     alignment and structure
>pdb|4AZ1|A Chain A, Crystal Structure Of The Trypanosoma Cruzi Protein Tyrosine Phosphatase Tcptp1, A Potential Therapeutic Target For Chagas' Disease Length = 302 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query558
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 1e-144
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 1e-82
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 5e-32
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 2e-27
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 3e-27
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 1e-140
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 6e-73
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 9e-28
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 1e-27
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 1e-27
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 1e-137
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 2e-80
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 2e-31
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 6e-27
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 1e-135
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 1e-74
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 4e-31
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 3e-27
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 4e-27
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 1e-107
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 4e-28
1yfo_A 302 D1, receptor protein tyrosine phosphatase alpha; h 9e-28
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 1e-104
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 5e-28
2ooq_A 286 Receptor-type tyrosine-protein phosphatase T; prot 9e-28
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 1e-103
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 7e-27
3s3e_A 307 Tyrosine-protein phosphatase 10D; differentiation, 1e-26
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 1e-102
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 2e-28
2gjt_A 295 Receptor-type tyrosine-protein phosphatase PTPro; 5e-28
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 1e-102
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 6e-27
2h4v_A 320 Receptor-type tyrosine-protein phosphatase gamma; 1e-26
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 1e-102
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 6e-28
2oc3_A 303 Tyrosine-protein phosphatase non-receptor type 18; 1e-27
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 1e-101
2i1y_A 301 Receptor-type tyrosine-protein phosphatase; recept 1e-26
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 1e-26
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 1e-100
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 6e-28
2hc1_A 291 Receptor-type tyrosine-protein phosphatase beta; p 1e-27
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 1e-100
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 1e-27
3i36_A 342 Vascular protein tyrosine phosphatase 1; PTP, hydr 3e-27
2pa5_A314 Tyrosine-protein phosphatase non-receptor type 9; 1e-100
2pa5_A314 Tyrosine-protein phosphatase non-receptor type 9; 4e-28
2pa5_A 314 Tyrosine-protein phosphatase non-receptor type 9; 6e-28
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 2e-99
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 3e-27
2p6x_A 309 Tyrosine-protein phosphatase non-receptor type 22; 4e-27
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 8e-94
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 2e-27
2bzl_A 325 Tyrosine-protein phosphatase, non-receptor type 14 4e-27
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 2e-93
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 2e-23
3b7o_A 316 Tyrosine-protein phosphatase non-receptor type 11; 2e-23
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 4e-93
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 8e-26
2i75_A 320 Tyrosine-protein phosphatase non-receptor type 4; 8e-26
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 5e-93
1zc0_A 309 Tyrosine-protein phosphatase, non-receptor type 7; 3e-24
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 4e-24
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 3e-92
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 5e-27
2cm2_A 304 Tyrosine-protein phosphatase non-receptor type 1; 6e-27
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 8e-92
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 1e-26
2b49_A 287 Protein tyrosine phosphatase, non-receptor type 3; 1e-26
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 9e-92
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 1e-25
1jln_A 297 STEP-like ptpase, protein tyrosine phosphatase, re 1e-25
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 2e-91
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 7e-25
1fpr_A 284 Protein-tyrosine phosphatase 1C; protein tyrosine 1e-24
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 2e-91
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 9e-28
1p15_A 253 Protein-tyrosine phosphatase alpha; transmembrane, 1e-27
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 2e-91
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 1e-26
1l8k_A 314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 1e-26
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 2e-90
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 2e-25
1wch_A 315 Protein tyrosine phosphatase, non-receptor type 13 2e-25
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 2e-88
2cjz_A 305 Human protein tyrosine phosphatase PTPN5; protein 6e-25
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 2e-24
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 1e-87
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 4e-25
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 1e-22
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 4e-87
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 4e-24
3m4u_A 306 Tyrosine specific protein phosphatase, putative; p 6e-24
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 2e-86
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 7e-36
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 2e-22
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 4e-86
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 8e-38
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 5e-23
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 2e-71
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 4e-22
1lyv_A 306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 6e-22
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 2e-61
1g4w_R 383 Protein tyrosine phosphatase SPTP; virulence facto 1e-16
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 3e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 4e-06
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 2e-04
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
 Score =  428 bits (1102), Expect = e-144
 Identities = 147/448 (32%), Positives = 214/448 (47%), Gaps = 45/448 (10%)

Query: 23  SNPPDMAPITRADIVMEYDERHYDSDYGFQQEFEQLVNEHFPDRSTKASEARENQHKNRY 82
           S P    PI    +  E   R  D    F++EF  L        + + +   EN+ KNRY
Sbjct: 2   SGPKKYFPIPVEHLEEEIRIRSADDCKQFREEFNSL-PSGHIQGTFELANKEENREKNRY 60

Query: 83  PDIKAYDQTRVKLTPVDGVPGSDYINANFVLGYKELKKFICAQGPMEHTVNDFWRMIWEQ 142
           P+I   D +RV L+ +DG+P SDYINA+++ GYKE  KFI AQGP + TVNDFWRM+WEQ
Sbjct: 61  PNILPNDHSRVILSQLDGIPCSDYINASYIDGYKEKNKFIAAQGPKQETVNDFWRMVWEQ 120

Query: 143 HLEIVIMLTNLEEYSKIKCAKYWPEQEEGDKTYGDFIVGLVNEKKFGEYILRELKLVRTA 202
               ++MLTNL+E  + KC +YWP  ++G  TYG+  V + +     +Y +R+  +    
Sbjct: 121 KSATIVMLTNLKERKEEKCHQYWP--DQGCWTYGNIRVCVEDCVVLVDYTIRKFCIQPQL 178

Query: 203 SGKESEERSIFQYHYLAWKDFQAPENPSGLLKFIKHVNEAYSLEKGPILVHCRALV---- 258
                  R + Q H+ +W DF  P  P G+LKF+K V     +  GPI+VHC A V    
Sbjct: 179 PDGCKAPRLVSQLHFTSWPDFGVPFTPIGMLKFLKKVKTLNPVHAGPIVVHCSAGVGRTG 238

Query: 259 ------EVVQFGETEIRATDLKSTLETL--KRVNDGNKKSELELEFEETHNKCSDHLIRS 310
                  ++     E +  D+   +  +  +R                        ++++
Sbjct: 239 TFIVIDAMMAMMHAE-QKVDVFEFVSRIRNQRP----------------------QMVQT 275

Query: 311 ACQFYLIHQ-VNLASGPDQVYVLRLTQAKEENKSTTNAKSEDLTVLGV---RLTQAKEEN 366
             Q+  I+Q +          +   +  K            D   L     +LT  +   
Sbjct: 276 DMQYTFIYQALLEYYLYGDTELDVSSLEKHLQTMHGTTTHFDKIGLEEEFRKLTNVRIMK 335

Query: 367 KSTTNAKSEENKDKNRDESIIPYDRNRVILSPAKD--YSNYINASFIEAYDNTESFIITQ 424
           ++        N  K R   IIPYD NRVILS  +   Y++YINASFI+ Y   + FI TQ
Sbjct: 336 ENMRTGNLPANMKKARVIQIIPYDFNRVILSMKRGQEYTDYINASFIDGYRQKDYFIATQ 395

Query: 425 DPDMEHTVHDFWRMISEHTISTIIMLSD 452
            P + HTV DFWRMI E    TI+ML++
Sbjct: 396 GP-LAHTVEDFWRMIWEWKSHTIVMLTE 422
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 Back     alignment and structure
>2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 Back     alignment and structure
>2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 Back     alignment and structure
>2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query558
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 100.0
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 100.0
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 100.0
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 100.0
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 100.0
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 100.0
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 100.0
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 100.0
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 100.0
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 100.0
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 100.0
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 100.0
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 100.0
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 100.0
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 100.0
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 100.0
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 100.0
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 100.0
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 100.0
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 100.0
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 100.0
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 100.0
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 100.0
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 100.0
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 100.0
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 100.0
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 100.0
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 100.0
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 100.0
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 100.0
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 100.0
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 100.0
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 100.0
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 100.0
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 100.0
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 100.0
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 100.0
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 100.0
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 100.0
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 100.0
4ge6_A 314 Tyrosine-protein phosphatase non-receptor type 9; 99.96
3s3e_A 307 Tyrosine-protein phosphatase 10D; differentiation, 99.95
2oc3_A 303 Tyrosine-protein phosphatase non-receptor type 18; 99.95
2ooq_A 286 Receptor-type tyrosine-protein phosphatase T; prot 99.95
2bzl_A 325 Tyrosine-protein phosphatase, non-receptor type 14 99.95
2hc1_A 291 Receptor-type tyrosine-protein phosphatase beta; p 99.95
1yfo_A 302 D1, receptor protein tyrosine phosphatase alpha; h 99.95
2b49_A 287 Protein tyrosine phosphatase, non-receptor type 3; 99.95
1p15_A 253 Protein-tyrosine phosphatase alpha; transmembrane, 99.95
2h4v_A 320 Receptor-type tyrosine-protein phosphatase gamma; 99.94
2gjt_A 295 Receptor-type tyrosine-protein phosphatase PTPro; 99.94
2cm2_A 304 Tyrosine-protein phosphatase non-receptor type 1; 99.94
2i75_A 320 Tyrosine-protein phosphatase non-receptor type 4; 99.94
2p6x_A 309 Tyrosine-protein phosphatase non-receptor type 22; 99.94
3m4u_A 306 Tyrosine specific protein phosphatase, putative; p 99.94
1fpr_A 284 Protein-tyrosine phosphatase 1C; protein tyrosine 99.94
1wch_A 315 Protein tyrosine phosphatase, non-receptor type 13 99.94
1l8k_A 314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 99.94
4i8n_A 354 Tyrosine-protein phosphatase non-receptor type 1; 99.94
3i36_A 342 Vascular protein tyrosine phosphatase 1; PTP, hydr 99.94
4grz_A 288 Tyrosine-protein phosphatase non-receptor type 6; 99.94
2i1y_A 301 Receptor-type tyrosine-protein phosphatase; recept 99.94
4az1_A 302 Tyrosine specific protein phosphatase; hydrolase, 99.94
3b7o_A 316 Tyrosine-protein phosphatase non-receptor type 11; 99.94
1zc0_A 309 Tyrosine-protein phosphatase, non-receptor type 7; 99.93
2cjz_A 305 Human protein tyrosine phosphatase PTPN5; protein 99.93
1jln_A 297 STEP-like ptpase, protein tyrosine phosphatase, re 99.92
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 99.92
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 99.92
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 99.91
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.9
1g4w_R 383 Protein tyrosine phosphatase SPTP; virulence facto 99.9
1lyv_A 306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 99.89
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 99.73
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 99.69
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 99.35
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.17
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 99.09
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 98.7
1d5r_A324 Phosphoinositide phosphotase PTEN; C2 domain, phos 98.64
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 98.59
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 98.44
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 98.25
2q05_A195 Late protein H1, dual specificity protein phosphat 98.24
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 98.18
3cm3_A176 Late protein H1, dual specificity protein phosphat 98.12
3n0a_A361 Tyrosine-protein phosphatase auxilin; phosphatase- 98.04
3v0d_A339 Voltage-sensor containing phosphatase; PTP, hydrol 97.98
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 97.85
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 97.82
1xri_A151 AT1G05000; structural genomics, protein structure 97.8
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 97.75
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 97.75
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 97.66
3rz2_A 189 Protein tyrosine phosphatase type IVA 1; tyrosine 97.53
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 97.51
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 97.46
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 97.46
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 97.42
2hcm_A164 Dual specificity protein phosphatase; structural g 97.31
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 97.24
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 97.19
2oud_A177 Dual specificity protein phosphatase 10; A central 97.18
2hxp_A155 Dual specificity protein phosphatase 9; human phos 97.12
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 97.08
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 97.08
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 97.05
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 97.02
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 96.99
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 96.97
3emu_A161 Leucine rich repeat and phosphatase domain contain 96.57
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 96.56
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 96.41
3nme_A294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 96.26
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 96.0
2f46_A156 Hypothetical protein; structural genomics, joint c 94.46
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 90.69
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
Probab=100.00  E-value=7.6e-90  Score=760.82  Aligned_cols=415  Identities=32%  Similarity=0.562  Sum_probs=348.3

Q ss_pred             CHHhHHHHHHHHhcCCchhHHHHHHhhhhCCCCCCchhhhhhhhccCCCCCCCCCCCCCcceEecCCCCCCCCCceeeee
Q psy13252         32 TRADIVMEYDERHYDSDYGFQQEFEQLVNEHFPDRSTKASEARENQHKNRYPDIKAYDQTRVKLTPVDGVPGSDYINANF  111 (558)
Q Consensus        32 ~~~~~~~~~~~~~~~~~~~~~~Ef~~l~~~~~~~~~~~~~~~~~N~~KNR~~ni~p~D~tRV~L~~~~~~~~~dYINAs~  111 (558)
                      .+++|.+|++++.+++..+|.+||++|.+.  ...++.++.+++|+.||||.||+|||+|||+|...++.+++|||||||
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~E~~~i~~~--~~~~~~~~~~~~N~~kNRy~~i~~~d~tRV~L~~~~~~~~~dYInAn~   78 (575)
T 1lar_A            1 MITDLADNIERLKANDGLKFSQEYESIDPG--QQFTWENSNLEVNKPKNRYANVIAYDHSRVILTSIDGVPGSDYINANY   78 (575)
T ss_dssp             CHHHHHHHHHHHSSTTTHHHHHHHHHCCCC--CCCCCHHHHSTTTGGGCSSTTCCCCTTTBCCCCCCTTSTTTTCCSEEE
T ss_pred             CHHHHHHHHHHHhhCccccHHHHHHhcccC--CCcchhhhcccccccccCCCCcCCCcCceeeecCCCCCCCCCceEEEE
Confidence            378999999999999999999999999432  245677888999999999999999999999999887777899999999


Q ss_pred             ecCCccccceEEecCCCCCchhhhhhhhhcCCccEEEEcCCccccCccccccccCCCCCCcceeceEEEEEeeeeeeCce
Q psy13252        112 VLGYKELKKFICAQGPMEHTVNDFWRMIWEQHLEIVIMLTNLEEYSKIKCAKYWPEQEEGDKTYGDFIVGLVNEKKFGEY  191 (558)
Q Consensus       112 I~g~~~~~~yIatQ~Pl~~T~~dFW~MV~e~~v~~IVmLt~~~E~~~~kc~~YwP~~~~~~~~~g~~~V~~~~~~~~~~~  191 (558)
                      |+|+..+++|||||||+++|++|||+||||+++.+|||||++.|.|+.||++|||...  ...||.|+|++.++....+|
T Consensus        79 i~~~~~~~~yIatQgPl~~T~~dFW~Mvwe~~~~~IVmlt~~~E~~~~kc~~YwP~~~--~~~~g~~~V~~~~~~~~~~~  156 (575)
T 1lar_A           79 IDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPARG--TETCGLIQVTLLDTVELATY  156 (575)
T ss_dssp             EEETTEEEEEEEECCCCTTTHHHHHHHHHHTTCCEEEECSCSEETTEECCCCCSCSSS--EEEETTEEEEEEEEEECSSE
T ss_pred             eccCCCCceeEecCCCCcchHHHHHHHHhhcCCCEEEEcccceeCCccccccccCCCC--CceeeeEEEEEEEEEecCCe
Confidence            9999988999999999999999999999999999999999999999999999999863  57899999999999999999


Q ss_pred             EEEEEEEEEecCCCCCceEEEEEEEEcCcCCCCCCCChHHHHHHHHHHHHHcCCCCCCEEEEcchhh-HHhhhcceeeeh
Q psy13252        192 ILRELKLVRTASGKESEERSIFQYHYLAWKDFQAPENPSGLLKFIKHVNEAYSLEKGPILVHCRALV-EVVQFGETEIRA  270 (558)
Q Consensus       192 ~~r~l~v~~~~~g~~~~~r~V~~~~y~~Wpd~gvP~~~~~ll~~i~~v~~~~~~~~~PIvVHCsaGv-rtg~~~~~~i~i  270 (558)
                      ++|+|.|+..   +..++|.|+||||++|||+|+|.++..+++|++.++.......+|||||||||+ |||+|+++++++
T Consensus       157 ~~r~l~l~~~---~~~~~r~V~h~~y~~WpD~gvP~~~~~~l~~~~~v~~~~~~~~~pivVHCsaGvGRTGtfiaid~~l  233 (575)
T 1lar_A          157 TVRTFALHKS---GSSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAML  233 (575)
T ss_dssp             EEEEEEEEET---TSCCEEEEEEEEECCSCSSSCCSCSHHHHHHHHHHHHHSCTTCCCEEEESSSSSSHHHHHHHHHHHH
T ss_pred             EEEEEeeecC---CCCccEEEEEEEeCCCCCCCcccCHHHHHHHHHHHHHhcCCCCCCEEEEecCCCcceeEEEEhHHHH
Confidence            9999999883   245789999999999999999999999999999999876667899999999999 999998766655


Q ss_pred             HHHHHHHHHHhhccCCCCchhhHHHHHHHHhhcccccccccceeeeeeeeeccc---CCchhhHHhhhhhhHhccccc-c
Q psy13252        271 TDLKSTLETLKRVNDGNKKSELELEFEETHNKCSDHLIRSACQFYLIHQVNLAS---GPDQVYVLRLTQAKEENKSTT-N  346 (558)
Q Consensus       271 ~~l~~~l~~l~~~~~~~~~~~~~~e~~~~~r~~R~~~Vqt~~Qy~fi~~~~l~~---~~~~~~~~~~~~~~~~~~~~~-~  346 (558)
                      +.+    +   ......     ..+.+..+|++|++||||.+||.|+|.+++++   |.+++.+..+........... .
T Consensus       234 ~~l----~---~~~~v~-----i~~~v~~lR~qR~~~Vqt~~Qy~fi~~~ll~~~~~g~T~Ip~~~L~~~v~~L~~~~~~  301 (575)
T 1lar_A          234 ERM----K---HEKTVD-----IYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAATCGHTEVPARNLYAHIQKLGQVPPG  301 (575)
T ss_dssp             HHH----H---HHSCCC-----HHHHHHHHHTTSTTSSCSHHHHHHHHHHHHHHHHHCCCCEEGGGHHHHHHHHTSCCTT
T ss_pred             HHH----h---ccCCCC-----HHHHHHHHHhhhhccCCCHHHHHHhHHHHHHHhhhccccchhhhhhhHHHhhcccccc
Confidence            433    2   222211     25677889999999999999999999999874   677666555544332221110 0


Q ss_pred             cccchhhhhhhhhhhhhhcccccccccccccccCCCCCCCCCCCCceEEecC--CCCCCCCcccccccccCCCCceeeeC
Q psy13252        347 AKSEDLTVLGVRLTQAKEENKSTTNAKSEENKDKNRDESIIPYDRNRVILSP--AKDYSNYINASFIEAYDNTESFIITQ  424 (558)
Q Consensus       347 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~knr~~~ilp~d~~rv~l~~--~~~~~~yinAs~i~g~~~~~~~i~tq  424 (558)
                      ....++......+.........+..|.+++|..||||.||+|||++||+|.+  +.+++||||||||+||..++.||+||
T Consensus       302 ~~~~~~~~Ef~~l~~~~~~~~~~~~~~~~~N~~kNRy~~i~p~d~sRV~L~~~~~~~~~dYInAs~i~g~~~~~~yIatQ  381 (575)
T 1lar_A          302 ESVTAMELEFKLLASSKAHTSRFISANLPCNKFKNRLVNIMPYELTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQ  381 (575)
T ss_dssp             CSSCHHHHHHHTTTCC----CCCTTTTSGGGGGGCSSTTCCCCTTTBCCCCCBTTBTTTTCCSEEEECCSSSTTCEEEEC
T ss_pred             chhhHHHHHHHHhhhcccCccceeeccCccccccCCCcceeccccceeeccCcCCCCCCCeeEEeeccCCCCccceEEec
Confidence            0112233333333322222344667889999999999999999999999986  55679999999999999999999999


Q ss_pred             CCCCcccHHHHHHhhhcccceeeeeecchhhhhcccccccCc
Q psy13252        425 DPDMEHTVHDFWRMISEHTISTIIMLSDRLTQAKEENKSTTN  466 (558)
Q Consensus       425 ~P~~~~t~~dFwrmi~~~~~~~iVml~~~~e~~ke~~~~~~~  466 (558)
                      +| +++|+.|||+|||+.++..|||++...+.+++++..++.
T Consensus       382 gP-l~~T~~dFW~MVwe~~~~~IVmLt~~~E~g~~kc~~YwP  422 (575)
T 1lar_A          382 GP-LAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWP  422 (575)
T ss_dssp             CC-CGGGHHHHHHHHHHTTCCEEEECSCSEETTEESSCCCSC
T ss_pred             CC-CcchHHHHHHHHHhcCCcEEEEccccccCCeecccccCC
Confidence            99 999999999999999999999999999998888877664
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 558
d1lara1317 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie 3e-62
d1lara1 317 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie 4e-20
d1lara1317 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie 7e-20
d1yfoa_288 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 1e-60
d1yfoa_288 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 3e-18
d1rpma_278 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 2e-57
d1rpma_278 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 6e-21
d1rpma_ 278 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 1e-19
d2f71a1297 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho 2e-54
d2f71a1 297 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho 2e-22
d2f71a1297 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho 7e-22
d1p15a_245 c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { 5e-53
d1p15a_245 c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { 7e-23
d1l8ka_273 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 4e-52
d1l8ka_273 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 5e-21
d1l8ka_ 273 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 3e-20
d1lara2249 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie 6e-52
d1lara2249 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie 2e-20
d1lara2 249 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie 2e-20
d2shpa1307 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( 3e-50
d2shpa1 307 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( 2e-17
d2shpa1307 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( 4e-17
d1fpra_284 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 3e-49
d1fpra_284 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 4e-16
d1jlna_297 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 6e-47
d1jlna_ 297 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 1e-19
d1jlna_297 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 9e-19
d1lyva_283 c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c 2e-45
d1lyva_ 283 c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c 5e-18
d1lyva_283 c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c 1e-17
d1g4us2243 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca 2e-43
d1g4us2 243 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca 5e-13
d1g4us2243 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca 8e-13
d1wcha_308 c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re 3e-41
d1wcha_308 c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re 3e-19
d1wcha_ 308 c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re 2e-18
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 1e-25
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 3e-04
d2pt0a1 313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 8e-04
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 4e-09
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 1e-04
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 4e-04
d1d5ra2174 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase 0.002
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Higher-molecular-weight phosphotyrosine protein phosphatases
domain: RPTP Lar
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  205 bits (522), Expect = 3e-62
 Identities = 99/317 (31%), Positives = 153/317 (48%), Gaps = 60/317 (18%)

Query: 34  ADIVMEYDERHYDSDYGFQQEFEQLVNEHFPDRSTKASEARENQHKNRYPDIKAYDQTRV 93
            D+    +    +    F QE+E +        + + S    N+ KNRY ++ AYD +RV
Sbjct: 3   TDLADNIERLKANDGLKFSQEYESIDPGQ--QFTWENSNLEVNKPKNRYANVIAYDHSRV 60

Query: 94  KLTPVDGVPGSDYINANFVLGYKELKKFICAQGPMEHTVNDFWRMIWEQHLEIVIMLTNL 153
            LT +DGVPGSDYINAN++ GY++   +I  QGP+  T+ DFWRM+WEQ    V+M+T L
Sbjct: 61  ILTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRL 120

Query: 154 EEYSKIKCAKYWPEQEEGDKTYGDFIVGLVNEKKFGEYILRELKLVRTASGKESEERSIF 213
           EE S++KC +YWP    G +T G   V L++  +   Y +R   L ++     SE+R + 
Sbjct: 121 EEKSRVKCDQYWP--ARGTETCGLIQVTLLDTVELATYTVRTFALHKS---GSSEKRELR 175

Query: 214 QYHYLAWKDFQAPENPSGLLKFIKHVNEAYSLEKGPILVHCRA----------------- 256
           Q+ ++AW D   PE P+ +L F++ V     L+ GP++VHC A                 
Sbjct: 176 QFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLER 235

Query: 257 ------------------------------------LVEVVQFGETEIRATDLKSTLETL 280
                                               L+E    G TE+ A +L + ++ L
Sbjct: 236 MKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAATCGHTEVPARNLYAHIQKL 295

Query: 281 KRVNDGNKKSELELEFE 297
            +V  G   + +ELEF+
Sbjct: 296 GQVPPGESVTAMELEFK 312
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query558
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 100.0
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 100.0
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 100.0
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 100.0
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 100.0
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 100.0
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 100.0
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 100.0
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 100.0
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 100.0
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 100.0
d1p15a_ 245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 99.94
d1rpma_ 278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 99.93
d2f71a1 297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 99.93
d1wcha_ 308 Tyrosine-protein phosphatase, non-receptor type 13 99.93
d1yfoa_ 288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 99.93
d1lara1 317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1lara2 249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1l8ka_ 273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 99.93
d2shpa1 307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 99.92
d1fpra_ 284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 99.92
d1jlna_ 297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 99.92
d1lyva_ 283 Protein-tyrosine phosphatase YopH, catalytic domai 99.87
d1g4us2 243 SptP tyrosine phosphatase, catalytic domain {Salmo 99.81
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.75
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 99.74
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 99.09
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 98.81
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 98.72
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 98.27
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 97.97
d2pt0a1 313 Myo-inositol hexaphosphate phosphohydrolase (phyta 97.88
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 97.42
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 96.67
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 96.48
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 96.29
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 86.83
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Higher-molecular-weight phosphotyrosine protein phosphatases
domain: Tyrosine phosphatase
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=6.7e-67  Score=528.09  Aligned_cols=282  Identities=37%  Similarity=0.644  Sum_probs=247.6

Q ss_pred             CCCcCHHhHHHHHHHHhcCCchhHHHHHHhhhhCCCCCCchhhhhhhhccCCCCCCCCCCCCCcceEecCCCCCCCCCce
Q psy13252         28 MAPITRADIVMEYDERHYDSDYGFQQEFEQLVNEHFPDRSTKASEARENQHKNRYPDIKAYDQTRVKLTPVDGVPGSDYI  107 (558)
Q Consensus        28 ~~pi~~~~~~~~~~~~~~~~~~~~~~Ef~~l~~~~~~~~~~~~~~~~~N~~KNR~~ni~p~D~tRV~L~~~~~~~~~dYI  107 (558)
                      .+|||+++|.++++++.+++..+|.+||+.| .......++.++..++|.+||||.||+|||+|||+|++.++.+++|||
T Consensus         2 ~~pi~~~~~~~~~~~~~~~~~~~~~~Ef~~l-~~~~~~~~~~~~~~~~N~~KNR~~~i~p~D~sRV~L~~~~~~~~~~YI   80 (288)
T d1yfoa_           2 YPPLPVDKLEEEINRRMADDNKLFREEFNAL-PACPIQATCEAASKEENKEKNRYVNILPYDHSRVHLTPVEGVPDSDYI   80 (288)
T ss_dssp             CCCEEHHHHHHHHHHHHHHHHHHHHHHHHHS-CSCSSCCCCHHHHCGGGGGGCSCTTCCCCTTTBCCCCCCTTCTTTTCC
T ss_pred             CCCEeHHHHHHHHHHHhhCccHHHHHHHHHh-hccCCCCchhhhcChhhhhcCCCCCcccCCCcEEEeCCCCCCCccccc
Confidence            6899999999999999988888999999999 444455678889999999999999999999999999988888889999


Q ss_pred             eeeeecCCccccceEEecCCCCCchhhhhhhhhcCCccEEEEcCCccccCccccccccCCCCCCcceeceEEEEEeeeee
Q psy13252        108 NANFVLGYKELKKFICAQGPMEHTVNDFWRMIWEQHLEIVIMLTNLEEYSKIKCAKYWPEQEEGDKTYGDFIVGLVNEKK  187 (558)
Q Consensus       108 NAs~I~g~~~~~~yIatQ~Pl~~T~~dFW~MV~e~~v~~IVmLt~~~E~~~~kc~~YwP~~~~~~~~~g~~~V~~~~~~~  187 (558)
                      |||||+|+..+++|||||+|+++|++|||+||||++|.+|||||++.|.+..+|.+|||.+  +...+|.|+|++.++..
T Consensus        81 NAs~v~g~~~~~~~I~tQ~Pl~~T~~dFW~MV~~~~~~~IVmL~~~~e~~~~~~~~y~p~~--~~~~~g~~~V~~~~~~~  158 (288)
T d1yfoa_          81 NASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQ--GCWTYGNVRVSVEDVTV  158 (288)
T ss_dssp             SEEEEEETTEEEEEEEECCCCGGGHHHHHHHHHHTTCCEEEECSCSEETTEECSCCCSCSS--SEEEETTEEEEEEEEEE
T ss_pred             ceEEeecCCCcceEEEecCCCccchhHHHHHHHhccCceEEEeeeeeeCCcccccccCCCC--CCeEecceEEEEEEEEE
Confidence            9999999999899999999999999999999999999999999999999999999999985  36789999999999999


Q ss_pred             eCceEEEEEEEEEecCC-CCCceEEEEEEEEcCcCCCCCCCChHHHHHHHHHHHHHcCCCCCCEEEEcchhh-HHhhhcc
Q psy13252        188 FGEYILRELKLVRTASG-KESEERSIFQYHYLAWKDFQAPENPSGLLKFIKHVNEAYSLEKGPILVHCRALV-EVVQFGE  265 (558)
Q Consensus       188 ~~~~~~r~l~v~~~~~g-~~~~~r~V~~~~y~~Wpd~gvP~~~~~ll~~i~~v~~~~~~~~~PIvVHCsaGv-rtg~~~~  265 (558)
                      ..+++.|+|.|...... ....+|.|+||||++|||+|+|.++..+++|++.|++......+||||||+||+ |||+|++
T Consensus       159 ~~~~~~r~~~v~~~~~~~~~~~~r~V~h~~y~~Wpd~~~P~~~~~~l~l~~~v~~~~~~~~~PivVHCs~G~gRtG~f~a  238 (288)
T d1yfoa_         159 LVDYTVRKFCIQQVGDVTNRKPQRLITQFHFTSWPDFGVPFTPIGMLKFLKKVKACNPQYAGAIVVHCSAGVGRTGTFVV  238 (288)
T ss_dssp             CSSEEEEEEEEEC---------CEEEEEEEECCCCSSSCCSCSHHHHHHHHHHHHHSCTTSCCEEEECSSSSHHHHHHHH
T ss_pred             cCCEEEEEEEEEecccccCCCccEEEEEEEeCCCCCCCCCCCHHHHHHHHHHHHHhccccCCcEEEEeCCCCcccHHHHH
Confidence            99999999999764321 234679999999999999999999999999999999877777899999999999 9999988


Q ss_pred             eeeehHHHHHHHHHHhhccCCCCchhhHHHHHHHHhhcccccccccceeeeeeeeeccc
Q psy13252        266 TEIRATDLKSTLETLKRVNDGNKKSELELEFEETHNKCSDHLIRSACQFYLIHQVNLAS  324 (558)
Q Consensus       266 ~~i~i~~l~~~l~~l~~~~~~~~~~~~~~e~~~~~r~~R~~~Vqt~~Qy~fi~~~~l~~  324 (558)
                      ++++++++    ..-...        -..+.++.+|++|++||||.+||.|||.++++|
T Consensus       239 l~~~~~~l----~~~~~v--------dv~~~v~~lR~qR~~~V~t~~QY~f~y~~l~~y  285 (288)
T d1yfoa_         239 IDAMLDMM----HSERKV--------DVYGFVSRIRAQRCQMVQTDMQYVFIYQALLEH  285 (288)
T ss_dssp             HHHHHHHH----HHSSEE--------CHHHHHHHHTTTSTTSSCSHHHHHHHHHHHHHH
T ss_pred             HHHHHHHH----HhCCCC--------CHHHHHHHHHhhccccCCCHHHHHHHHHHHHHH
Confidence            77665444    221111        136788899999999999999999999999865
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure