Psyllid ID: psy13286

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-
MVQARQEPTQFLYLNKLTPAKITSKATLIIVPTRELALQTSQICIELAKHLNVKVMVTTGGTNLRDDIMRIYQKVHLIIATPGRILDLMDKQVANMDHCKILVLDEADKLLSQDFKGMLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSDLFTRGIDVQAVNVVINFDFPKMAETYLHRIGRSGRYGHLGIAINLITYEDRYALHRIEKELGTEIKSIPKVIDPALYVARPEDMDRDNSTGASEENNVSK
cccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHcccccEEEcccHHHHHHHcccccccccccEEEEEccccccccccHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHcccccEEEEccccccccEEEEEEEcccccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHcccccEEEEEcccccccccccccEEEEccccccccccccccccccccccccEEEEEccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccc
cccccccccccHHHHHcccccccccEEEEEccHHHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHccccEEEEcccHHHHHHHccccccccEEEEEEcHHHHHHccccHHHHHHHHHHccHHcEEEEEEccccHHHHHHHHHHccccEEEEEcccccccccEEEEEEEcHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHcccccEEEEEHHHHcccccccccEEEEEcccccHHHHEEEEcccccccccEEEEEEEcHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccccccccc
mvqarqeptqflylnkltpakitskatlIIVPTRELALQTSQICIELAKHLNVKVMVttggtnlrDDIMRIYQKVHLIIATPGRILDLMDKqvanmdhcKILVLDEADKLLSQDFKGMLDHVISILPHERQILLYSATFPLTVKNFMEKhlkdpyeiNLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHrnrvfhdfrsglcrnlvcsdlftrgidvqaVNVVINFDFPKMAETYLHRigrsgryghLGIAINLITYEDRYALHRIEKELGTeiksipkvidpalyvarpedmdrdnstgaseennvsk
mvqarqeptqflylnkltpakitSKATLIIVPTRELALQTSQICIELAKHLNVKVMVttggtnlrdDIMRIYQKVHLIIATPGRILDLMDKQVANMDHCKILVLDEADKLLSQDFKGMLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSDLFTRGIDVQAVNVVINFDFPKMAETYLHRigrsgrygHLGIAINLITYEDRYALHRIEKElgteiksipkvidpalyvarpedmdrdnstgaseennvsk
MVQARQEPTQFLYLNKLTPAKITSKATLIIVPTRELALQTSQICIELAKHLNVKVMVTTGGTNLRDDIMRIYQKVHLIIATPGRILDLMDKQVANMDHCKILVLDEADKLLSQDFKGMLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSDLFTRGIDVQAVNVVINFDFPKMAETYLHRIGRSGRYGHLGIAINLITYEDRYALHRIEKELGTEIKSIPKVIDPALYVARPEDMDRDNSTGASEENNVSK
*********QFLYLNKLTPAKITSKATLIIVPTRELALQTSQICIELAKHLNVKVMVTTGGTNLRDDIMRIYQKVHLIIATPGRILDLMDKQVANMDHCKILVLDEADKLLSQDFKGMLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSDLFTRGIDVQAVNVVINFDFPKMAETYLHRIGRSGRYGHLGIAINLITYEDRYALHRIEKELGTEIKSIPKVIDPALYVA*********************
*VQARQEPTQFLYLNKLTPAKITSKATLIIVPTRELALQTSQICIELAKHLNVKVMVTTGGTNLRDDIMRIYQKVHLIIATPGRILDLMDKQVANMDHCKILVLDEADKLLSQDFKGMLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSDLFTRGIDVQAVNVVINFDFPKMAETYLHRIGRSGRYGHLGIAINLITYEDRYALHRIEKELGTEIKSIPKVIDP**************************
MVQARQEPTQFLYLNKLTPAKITSKATLIIVPTRELALQTSQICIELAKHLNVKVMVTTGGTNLRDDIMRIYQKVHLIIATPGRILDLMDKQVANMDHCKILVLDEADKLLSQDFKGMLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSDLFTRGIDVQAVNVVINFDFPKMAETYLHRIGRSGRYGHLGIAINLITYEDRYALHRIEKELGTEIKSIPKVIDPALYVARPED*****************
*******PTQFLYLNKLTPAKITSKATLIIVPTRELALQTSQICIELAKHLNVKVMVTTGGTNLRDDIMRIYQKVHLIIATPGRILDLMDKQVANMDHCKILVLDEADKLLSQDFKGMLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSDLFTRGIDVQAVNVVINFDFPKMAETYLHRIGRSGRYGHLGIAINLITYEDRYALHRIEKELGTEIKSIPKVIDPALYVARPE******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVQARQEPTQFLYLNKLTPAKITSKATLIIVPTRELALQTSQICIELAKHLNVKVMVTTGGTNLRDDIMRIYQKVHLIIATPGRILDLMDKQVANMDHCKILVLDEADKLLSQDFKGMLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSDLFTRGIDVQAVNVVINFDFPKMAETYLHRIGRSGRYGHLGIAINLITYEDRYALHRIEKELGTEIKSIPKVIDPALYVARPEDMDRDNSTGASEENNVSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query351 2.2.26 [Sep-21-2011]
P23128459 Putative ATP-dependent RN yes N/A 0.954 0.729 0.829 1e-165
Q95YF3430 ATP-dependent RNA helicas yes N/A 0.937 0.765 0.751 1e-148
Q0IHV9481 Probable ATP-dependent RN yes N/A 0.866 0.632 0.760 1e-140
P54823483 Probable ATP-dependent RN yes N/A 0.866 0.629 0.757 1e-140
P26196483 Probable ATP-dependent RN yes N/A 0.863 0.627 0.759 1e-140
Q5ZKB9483 Probable ATP-dependent RN yes N/A 0.863 0.627 0.756 1e-139
Q54E49423 Probable ATP-dependent RN yes N/A 0.900 0.747 0.719 1e-139
P54824481 ATP-dependent RNA helicas N/A N/A 0.866 0.632 0.757 1e-139
Q9WTM2472 Probable ATP-dependent RN yes N/A 0.863 0.641 0.753 1e-139
Q5RFQ5483 Probable ATP-dependent RN yes N/A 0.863 0.627 0.753 1e-138
>sp|P23128|DDX6_DROME Putative ATP-dependent RNA helicase me31b OS=Drosophila melanogaster GN=me31B PE=1 SV=3 Back     alignment and function desciption
 Score =  582 bits (1501), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 287/346 (82%), Positives = 312/346 (90%), Gaps = 11/346 (3%)

Query: 14  LNKLTPAKITSKATLIIVPTRELALQTSQICIELAKHLNVKVMVTTGGTNLRDDIMRIYQ 73
           L ++ P K   +A L++VPTRELALQTSQICIELAKHL+++VMVTTGGT L+DDI+RIYQ
Sbjct: 117 LEQIDPTKDYIQA-LVMVPTRELALQTSQICIELAKHLDIRVMVTTGGTILKDDILRIYQ 175

Query: 74  KVHLIIATPGRILDLMDKQVANMDHCKILVLDEADKLLSQDFKGMLDHVISILPHERQIL 133
           KV LIIATPGRILDLMDK+VA+M HC+ILVLDEADKLLS DF+GMLDHVI  LP + QIL
Sbjct: 176 KVQLIIATPGRILDLMDKKVADMSHCRILVLDEADKLLSLDFQGMLDHVILKLPKDPQIL 235

Query: 134 LYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQI 193
           L+SATFPLTVKNFMEKHL++PYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQI
Sbjct: 236 LFSATFPLTVKNFMEKHLREPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQI 295

Query: 194 NQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSDLF 253
           NQSIIFCNSTQRVELLAKKITELGYCCYYIHA+MAQAHRNRVFHDFR GLCRNLVCSDLF
Sbjct: 296 NQSIIFCNSTQRVELLAKKITELGYCCYYIHAKMAQAHRNRVFHDFRQGLCRNLVCSDLF 355

Query: 254 TRGIDVQAVNVVINFDFPKMAETYLHRIGRSGRYGHLGIAINLITYEDRYALHRIEKELG 313
           TRGIDVQAVNVVINFDFP+MAETYLHRIGRSGR+GHLGIAINLITYEDR+ LHRIEKELG
Sbjct: 356 TRGIDVQAVNVVINFDFPRMAETYLHRIGRSGRFGHLGIAINLITYEDRFDLHRIEKELG 415

Query: 314 TEIKSIPKVIDPALYVARP--------EDMDRDNSTGASEENNVSK 351
           TEIK IPKVIDPALYVA           + D +NS  A+EE NVSK
Sbjct: 416 TEIKPIPKVIDPALYVANVGASVGDTCNNSDLNNS--ANEEGNVSK 459
Unwinds RNA in an ATP-dependent fashion.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q95YF3|CGH1_CAEEL ATP-dependent RNA helicase cgh-1 OS=Caenorhabditis elegans GN=cgh-1 PE=1 SV=1 Back     alignment and function description
>sp|Q0IHV9|DDX6_XENTR Probable ATP-dependent RNA helicase ddx6 OS=Xenopus tropicalis GN=ddx6 PE=2 SV=1 Back     alignment and function description
>sp|P54823|DDX6_MOUSE Probable ATP-dependent RNA helicase DDX6 OS=Mus musculus GN=Ddx6 PE=2 SV=1 Back     alignment and function description
>sp|P26196|DDX6_HUMAN Probable ATP-dependent RNA helicase DDX6 OS=Homo sapiens GN=DDX6 PE=1 SV=2 Back     alignment and function description
>sp|Q5ZKB9|DDX6_CHICK Probable ATP-dependent RNA helicase DDX6 OS=Gallus gallus GN=DDX6 PE=2 SV=1 Back     alignment and function description
>sp|Q54E49|DDX6_DICDI Probable ATP-dependent RNA helicase ddx6 OS=Dictyostelium discoideum GN=ddx6 PE=3 SV=1 Back     alignment and function description
>sp|P54824|DDX6_XENLA ATP-dependent RNA helicase ddx6 OS=Xenopus laevis GN=ddx6 PE=1 SV=2 Back     alignment and function description
>sp|Q9WTM2|DDX6_CAVPO Probable ATP-dependent RNA helicase DDX6 (Fragment) OS=Cavia porcellus GN=DDX6 PE=2 SV=1 Back     alignment and function description
>sp|Q5RFQ5|DDX6_PONAB Probable ATP-dependent RNA helicase DDX6 OS=Pongo abelii GN=DDX6 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query351
383858347444 PREDICTED: putative ATP-dependent RNA he 0.943 0.745 0.878 1e-172
307168696443 Putative ATP-dependent RNA helicase me31 0.943 0.747 0.875 1e-172
332020362444 Putative ATP-dependent RNA helicase me31 0.943 0.745 0.875 1e-172
156547575445 PREDICTED: putative ATP-dependent RNA he 0.945 0.746 0.866 1e-171
158299881430 AGAP009135-PA [Anopheles gambiae str. PE 0.945 0.772 0.875 1e-171
340728954444 PREDICTED: putative ATP-dependent RNA he 0.943 0.745 0.869 1e-170
328783051444 PREDICTED: putative ATP-dependent RNA he 0.943 0.745 0.869 1e-170
157118999439 DEAD box ATP-dependent RNA helicase [Aed 0.945 0.756 0.866 1e-170
312377194415 hypothetical protein AND_11577 [Anophele 0.937 0.792 0.868 1e-169
307206923435 Putative ATP-dependent RNA helicase me31 0.905 0.731 0.896 1e-169
>gi|383858347|ref|XP_003704663.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  610 bits (1572), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 297/338 (87%), Positives = 315/338 (93%), Gaps = 7/338 (2%)

Query: 14  LNKLTPAKITSKATLIIVPTRELALQTSQICIELAKHLNVKVMVTTGGTNLRDDIMRIYQ 73
           L ++ P K   +A L+IVPTRELALQTSQICIELAKH+++KVMVTTGGT+LRDDIMRIYQ
Sbjct: 114 LEQVDPRKDVIQA-LVIVPTRELALQTSQICIELAKHMDIKVMVTTGGTDLRDDIMRIYQ 172

Query: 74  KVHLIIATPGRILDLMDKQVANMDHCKILVLDEADKLLSQDFKGMLDHVISILPHERQIL 133
           KV +IIATPGRILDLMDK VANMDHCKILVLDEADKLLSQDFKGMLDHVIS LPHERQIL
Sbjct: 173 KVQVIIATPGRILDLMDKNVANMDHCKILVLDEADKLLSQDFKGMLDHVISRLPHERQIL 232

Query: 134 LYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQI 193
           LYSATFPLTVK FMEKHL+DPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQI
Sbjct: 233 LYSATFPLTVKQFMEKHLRDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQI 292

Query: 194 NQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSDLF 253
            QSIIFCNSTQRVELLAKKIT+LGYCCYYIHA+MAQAHRNRVFHDFR+GLCRNLV SDLF
Sbjct: 293 TQSIIFCNSTQRVELLAKKITDLGYCCYYIHAKMAQAHRNRVFHDFRAGLCRNLVSSDLF 352

Query: 254 TRGIDVQAVNVVINFDFPKMAETYLHRIGRSGRYGHLGIAINLITYEDRYALHRIEKELG 313
           TRGIDVQAVNVVINFDFPKMAETYLHRIGRSGR+GHLGIAINLITYEDR+ LHRIE+ELG
Sbjct: 353 TRGIDVQAVNVVINFDFPKMAETYLHRIGRSGRFGHLGIAINLITYEDRFNLHRIEQELG 412

Query: 314 TEIKSIPKVIDPALYVARPEDMDRDNSTGASEENNVSK 351
           TEIK IPKVIDP+LYVARPED   +NS    EE NVSK
Sbjct: 413 TEIKPIPKVIDPSLYVARPED---NNSM---EEGNVSK 444

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307168696|gb|EFN61728.1| Putative ATP-dependent RNA helicase me31b [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332020362|gb|EGI60783.1| Putative ATP-dependent RNA helicase me31b [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|156547575|ref|XP_001602897.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like isoform 1 [Nasonia vitripennis] gi|345485131|ref|XP_003425200.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|158299881|ref|XP_319893.3| AGAP009135-PA [Anopheles gambiae str. PEST] gi|157013731|gb|EAA14695.3| AGAP009135-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|340728954|ref|XP_003402776.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like [Bombus terrestris] gi|350412268|ref|XP_003489590.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328783051|ref|XP_624586.2| PREDICTED: putative ATP-dependent RNA helicase me31b-like isoform 1 [Apis mellifera] gi|380013249|ref|XP_003690677.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like [Apis florea] Back     alignment and taxonomy information
>gi|157118999|ref|XP_001659287.1| DEAD box ATP-dependent RNA helicase [Aedes aegypti] gi|108875497|gb|EAT39722.1| AAEL008500-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|312377194|gb|EFR24088.1| hypothetical protein AND_11577 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|307206923|gb|EFN84769.1| Putative ATP-dependent RNA helicase me31b [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query351
FB|FBgn0004419459 me31B "maternal expression at 0.960 0.734 0.831 2.1e-148
WB|WBGene00000479430 cgh-1 [Caenorhabditis elegans 0.937 0.765 0.754 1.8e-133
UNIPROTKB|Q95YF3430 cgh-1 "ATP-dependent RNA helic 0.937 0.765 0.754 1.8e-133
DICTYBASE|DDB_G0291804423 ddx6 "DEAD/DEAH box helicase" 0.900 0.747 0.719 4.3e-125
UNIPROTKB|E1BDM8483 DDX6 "Uncharacterized protein" 0.900 0.654 0.738 7e-125
UNIPROTKB|E2RR01483 DDX6 "Uncharacterized protein" 0.900 0.654 0.738 7e-125
UNIPROTKB|P26196483 DDX6 "Probable ATP-dependent R 0.900 0.654 0.738 7e-125
UNIPROTKB|F1SAJ5483 DDX6 "Uncharacterized protein" 0.900 0.654 0.738 7e-125
MGI|MGI:104976483 Ddx6 "DEAD (Asp-Glu-Ala-Asp) b 0.900 0.654 0.738 7e-125
RGD|1564560483 Ddx6 "DEAD (Asp-Glu-Ala-Asp) b 0.900 0.654 0.738 7e-125
FB|FBgn0004419 me31B "maternal expression at 31B" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1449 (515.1 bits), Expect = 2.1e-148, P = 2.1e-148
 Identities = 286/344 (83%), Positives = 311/344 (90%)

Query:    14 LNKLTPAKITSKATLIIVPTRELALQTSQICIELAKHLNVKVMVTTGGTNLRDDIMRIYQ 73
             L ++ P K   +A L++VPTRELALQTSQICIELAKHL+++VMVTTGGT L+DDI+RIYQ
Sbjct:   117 LEQIDPTKDYIQA-LVMVPTRELALQTSQICIELAKHLDIRVMVTTGGTILKDDILRIYQ 175

Query:    74 KVHLIIATPGRILDLMDKQVANMDHCKILVLDEADKLLSQDFKGMLDHVISILPHERQIL 133
             KV LIIATPGRILDLMDK+VA+M HC+ILVLDEADKLLS DF+GMLDHVI  LP + QIL
Sbjct:   176 KVQLIIATPGRILDLMDKKVADMSHCRILVLDEADKLLSLDFQGMLDHVILKLPKDPQIL 235

Query:   134 LYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQI 193
             L+SATFPLTVKNFMEKHL++PYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQI
Sbjct:   236 LFSATFPLTVKNFMEKHLREPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQI 295

Query:   194 NQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSDLF 253
             NQSIIFCNSTQRVELLAKKITELGYCCYYIHA+MAQAHRNRVFHDFR GLCRNLVCSDLF
Sbjct:   296 NQSIIFCNSTQRVELLAKKITELGYCCYYIHAKMAQAHRNRVFHDFRQGLCRNLVCSDLF 355

Query:   254 TRGIDVQAVNVVINFDFPKMAETYLHRIGRSGRYGHLGIAINLITYEDRYALHRIEKELG 313
             TRGIDVQAVNVVINFDFP+MAETYLHRIGRSGR+GHLGIAINLITYEDR+ LHRIEKELG
Sbjct:   356 TRGIDVQAVNVVINFDFPRMAETYLHRIGRSGRFGHLGIAINLITYEDRFDLHRIEKELG 415

Query:   314 TEIKSIPKVIDPALYVARPE----DM--DRDNSTGASEENNVSK 351
             TEIK IPKVIDPALYVA       D   + D +  A+EE NVSK
Sbjct:   416 TEIKPIPKVIDPALYVANVGASVGDTCNNSDLNNSANEEGNVSK 459
GO:0004004 "ATP-dependent RNA helicase activity" evidence=ISS;NAS
GO:0005524 "ATP binding" evidence=IEA
GO:0003723 "RNA binding" evidence=IDA
GO:0000932 "cytoplasmic mRNA processing body" evidence=IDA
GO:0033962 "cytoplasmic mRNA processing body assembly" evidence=IMP
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0007095 "mitotic G2 DNA damage checkpoint" evidence=IGI
GO:0043186 "P granule" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
WB|WBGene00000479 cgh-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q95YF3 cgh-1 "ATP-dependent RNA helicase cgh-1" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291804 ddx6 "DEAD/DEAH box helicase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E1BDM8 DDX6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RR01 DDX6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P26196 DDX6 "Probable ATP-dependent RNA helicase DDX6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SAJ5 DDX6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:104976 Ddx6 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1564560 Ddx6 "DEAD (Asp-Glu-Ala-Asp) box helicase 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A3LWX3DHH1_PICST3, ., 6, ., 4, ., 1, 30.67600.91160.6286yesN/A
P54824DDX6_XENLA3, ., 6, ., 4, ., 1, 30.75730.86600.6320N/AN/A
Q75BS4DHH1_ASHGO3, ., 6, ., 4, ., 1, 30.69670.88310.6404yesN/A
Q54E49DDX6_DICDI3, ., 6, ., 4, ., 1, 30.71920.90020.7470yesN/A
P54823DDX6_MOUSE3, ., 6, ., 4, ., 1, 30.75730.86600.6293yesN/A
Q4WWD3DHH1_ASPFU3, ., 6, ., 4, ., 1, 30.68300.92020.6370yesN/A
Q6FQU5DHH1_CANGA3, ., 6, ., 4, ., 1, 30.69400.90020.6232yesN/A
Q9WTM2DDX6_CAVPO3, ., 6, ., 4, ., 1, 30.75320.86320.6419yesN/A
Q0IHV9DDX6_XENTR3, ., 6, ., 4, ., 1, 30.76060.86600.6320yesN/A
P23128DDX6_DROME3, ., 6, ., 4, ., 1, 30.82940.95440.7298yesN/A
Q6C0X2DHH1_YARLI3, ., 6, ., 4, ., 1, 30.70660.90020.6053yesN/A
Q95YF3CGH1_CAEEL3, ., 6, ., 4, ., 1, 30.75150.93730.7651yesN/A
Q8SQK9DHH1_ENCCU3, ., 6, ., 4, ., 1, 30.45560.92020.6605yesN/A
Q8RXK6RH8_ARATH3, ., 6, ., 4, ., 1, 30.74500.86030.5980yesN/A
Q6BJX6DHH1_DEBHA3, ., 6, ., 4, ., 1, 30.67090.89170.6065yesN/A
Q109G2RH12_ORYSJ3, ., 6, ., 4, ., 1, 30.71110.89450.6026yesN/A
Q5RFQ5DDX6_PONAB3, ., 6, ., 4, ., 1, 30.75320.86320.6273yesN/A
Q2U5A2DHH1_ASPOR3, ., 6, ., 4, ., 1, 30.680.92020.6320yesN/A
P26196DDX6_HUMAN3, ., 6, ., 4, ., 1, 30.75980.86320.6273yesN/A
Q6CSZ7DHH1_KLULA3, ., 6, ., 4, ., 1, 30.66870.90020.6147yesN/A
Q5ZKB9DDX6_CHICK3, ., 6, ., 4, ., 1, 30.75650.86320.6273yesN/A
Q4HW67DHH1_GIBZE3, ., 6, ., 4, ., 1, 30.67070.92020.6646yesN/A
P0CQ80DHH1_CRYNJ3, ., 6, ., 4, ., 1, 30.71050.86320.4848yesN/A
Q09181DHH1_SCHPO3, ., 6, ., 4, ., 1, 30.73260.86320.6247yesN/A
P39517DHH1_YEAST3, ., 6, ., 4, ., 1, 30.68760.90020.6245yesN/A
A2QY39DHH1_ASPNC3, ., 6, ., 4, ., 1, 30.68530.91160.6336yesN/A
Q7XMK8RH6_ORYSJ3, ., 6, ., 4, ., 1, 30.73750.85750.6044noN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.946
3rd Layer3.6.40.963

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query351
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 3e-94
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 6e-86
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 3e-62
cd00268203 cd00268, DEADc, DEAD-box helicases 4e-59
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 2e-57
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 1e-51
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-51
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 3e-49
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 2e-43
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 2e-40
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 7e-40
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 1e-34
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 1e-32
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 1e-30
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 1e-30
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 7e-25
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 3e-24
smart0049082 smart00490, HELICc, helicase superfamily c-termina 5e-24
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 2e-12
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 1e-11
TIGR01389 591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 1e-09
PRK11057 607 PRK11057, PRK11057, ATP-dependent DNA helicase Rec 2e-09
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 1e-07
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 2e-06
PRK00254 720 PRK00254, PRK00254, ski2-like helicase; Provisiona 1e-04
PLN03137 1195 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4 3e-04
COG1202 830 COG1202, COG1202, Superfamily II helicase, archaea 5e-04
TIGR04121 803 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA 0.001
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 0.001
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 0.001
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score =  289 bits (742), Expect = 3e-94
 Identities = 110/298 (36%), Positives = 174/298 (58%), Gaps = 6/298 (2%)

Query: 27  TLIIVPTRELALQTSQICIELAKHL-NVKVMVTTGGTNLRDDIMRIYQKVHLIIATPGRI 85
            LI+ PTRELA+Q ++   +L K+L  ++V V  GG ++R  I  + + V +++ATPGR+
Sbjct: 102 ALILAPTRELAVQIAEELRKLGKNLGGLRVAVVYGGVSIRKQIEALKRGVDIVVATPGRL 161

Query: 86  LDLMDKQVANMDHCKILVLDEADKLLSQDFKGMLDHVISILPHERQILLYSATFPLTVKN 145
           LDL+ +   ++   + LVLDEAD++L   F   ++ ++  LP +RQ LL+SAT P  ++ 
Sbjct: 162 LDLIKRGKLDLSGVETLVLDEADRMLDMGFIDDIEKILKALPPDRQTLLFSATMPDDIRE 221

Query: 146 FMEKHLKDPYEINL---MEELTLKGVTQYYAFV-QERQKVHCLNTLFSKLQINQSIIFCN 201
              ++L DP EI +     E TLK + Q+Y  V  E +K+  L  L       + I+F  
Sbjct: 222 LARRYLNDPVEIEVSVEKLERTLKKIKQFYLEVESEEEKLELLLKLLKDEDEGRVIVFVR 281

Query: 202 STQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSDLFTRGIDVQA 261
           + + VE LA+ + + G+    +H  + Q  R+R    F+ G  R LV +D+  RG+D+  
Sbjct: 282 TKRLVEELAESLRKRGFKVAALHGDLPQEERDRALEKFKDGELRVLVATDVAARGLDIPD 341

Query: 262 VNVVINFDFPKMAETYLHRIGRSGRYGHLGIAINLITY-EDRYALHRIEKELGTEIKS 318
           V+ VIN+D P   E Y+HRIGR+GR G  G+AI+ +T  E+   L RIEK L  ++ S
Sbjct: 342 VSHVINYDLPLDPEDYVHRIGRTGRAGRKGVAISFVTEEEEVKKLKRIEKRLERKLPS 399

Length = 513
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|234702 PRK00254, PRK00254, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|215597 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 351
KOG0326|consensus459 100.0
KOG0330|consensus476 100.0
KOG0331|consensus519 100.0
KOG0328|consensus400 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PTZ00110545 helicase; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0333|consensus673 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0345|consensus 567 100.0
KOG0335|consensus482 100.0
KOG0342|consensus543 100.0
KOG0338|consensus 691 100.0
KOG0343|consensus 758 100.0
KOG0340|consensus442 100.0
KOG0336|consensus629 100.0
KOG0339|consensus 731 100.0
KOG0346|consensus 569 100.0
KOG0332|consensus477 100.0
KOG0327|consensus397 100.0
KOG0341|consensus610 100.0
KOG4284|consensus 980 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG0350|consensus620 100.0
KOG0348|consensus 708 100.0
KOG0347|consensus 731 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
KOG0334|consensus 997 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 100.0
KOG0337|consensus 529 100.0
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 100.0
KOG0344|consensus593 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
PRK10689 1147 transcription-repair coupling factor; Provisional 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
KOG0329|consensus387 100.0
PHA02653 675 RNA helicase NPH-II; Provisional 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PRK01172 674 ski2-like helicase; Provisional 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
COG1204 766 Superfamily II helicase [General function predicti 100.0
COG1202 830 Superfamily II helicase, archaea-specific [General 100.0
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 100.0
PRK09200 790 preprotein translocase subunit SecA; Reviewed 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 100.0
PRK13766 773 Hef nuclease; Provisional 100.0
PRK14701 1638 reverse gyrase; Provisional 100.0
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 100.0
KOG0351|consensus 941 100.0
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 100.0
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 100.0
COG1205 851 Distinct helicase family with a unique C-terminal 100.0
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 100.0
KOG0352|consensus 641 99.98
KOG0354|consensus 746 99.98
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.98
KOG0952|consensus 1230 99.98
KOG0349|consensus725 99.97
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.97
KOG0353|consensus 695 99.97
KOG0951|consensus 1674 99.97
PRK04914 956 ATP-dependent helicase HepA; Validated 99.97
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.96
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.96
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.96
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.96
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.96
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.95
PRK05580679 primosome assembly protein PriA; Validated 99.95
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.95
PRK09694 878 helicase Cas3; Provisional 99.95
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.95
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.94
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.93
KOG0947|consensus 1248 99.92
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.92
KOG0948|consensus 1041 99.91
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.91
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.9
KOG0950|consensus 1008 99.9
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.88
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 99.88
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.88
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.88
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.86
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.85
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.85
KOG0385|consensus 971 99.84
COG4096 875 HsdR Type I site-specific restriction-modification 99.84
PRK05298652 excinuclease ABC subunit B; Provisional 99.84
KOG0922|consensus 674 99.83
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.83
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.83
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.82
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.82
KOG0949|consensus 1330 99.81
KOG0387|consensus 923 99.8
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.79
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.78
KOG0953|consensus 700 99.78
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.78
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.78
KOG0384|consensus 1373 99.75
KOG1123|consensus776 99.74
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.74
KOG0389|consensus941 99.73
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.71
KOG0923|consensus 902 99.71
KOG0390|consensus776 99.69
KOG0392|consensus1549 99.69
KOG4150|consensus 1034 99.68
KOG0920|consensus 924 99.66
smart0049082 HELICc helicase superfamily c-terminal domain. 99.66
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.66
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 99.65
KOG0924|consensus 1042 99.64
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.61
KOG0951|consensus 1674 99.59
smart00487201 DEXDc DEAD-like helicases superfamily. 99.59
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.56
KOG0926|consensus 1172 99.56
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 99.55
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.54
KOG1000|consensus689 99.49
COG4889 1518 Predicted helicase [General function prediction on 99.46
KOG0925|consensus 699 99.45
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.43
KOG0386|consensus 1157 99.41
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.35
PRK14873 665 primosome assembly protein PriA; Provisional 99.33
KOG0388|consensus1185 99.26
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.25
KOG4439|consensus901 99.23
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 99.23
KOG1002|consensus791 99.19
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.17
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.09
KOG1015|consensus 1567 99.07
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.0
KOG2340|consensus698 99.0
COG0610 962 Type I site-specific restriction-modification syst 98.88
KOG0391|consensus 1958 98.79
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 98.7
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 98.63
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 98.51
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 98.46
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 98.34
KOG1016|consensus 1387 98.28
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 98.25
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.13
KOG0952|consensus1230 98.0
KOG1001|consensus674 97.87
smart00489289 DEXDc3 DEAD-like helicases superfamily. 97.75
smart00488289 DEXDc2 DEAD-like helicases superfamily. 97.75
smart00492141 HELICc3 helicase superfamily c-terminal domain. 97.6
KOG0391|consensus 1958 97.58
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 97.57
smart00491142 HELICc2 helicase superfamily c-terminal domain. 97.5
PF13871 278 Helicase_C_4: Helicase_C-like 97.39
KOG0921|consensus 1282 97.13
PRK15483 986 type III restriction-modification system StyLTI en 97.0
COG3587 985 Restriction endonuclease [Defense mechanisms] 96.85
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 96.64
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 96.51
KOG0701|consensus 1606 96.51
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 96.29
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 96.02
KOG0298|consensus 1394 95.96
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 95.74
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 95.74
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 95.62
PRK05580 679 primosome assembly protein PriA; Validated 95.6
TIGR00595 505 priA primosomal protein N'. All proteins in this f 95.53
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 95.51
PRK14873 665 primosome assembly protein PriA; Provisional 95.38
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 95.27
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 95.03
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 95.01
KOG1513|consensus 1300 94.88
PRK10689 1147 transcription-repair coupling factor; Provisional 94.27
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 94.01
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 93.95
COG1198 730 PriA Primosomal protein N' (replication factor Y) 93.87
KOG1802|consensus 935 93.75
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 93.61
KOG0339|consensus 731 93.45
KOG1133|consensus821 93.36
KOG1803|consensus649 93.2
PRK14701 1638 reverse gyrase; Provisional 93.15
KOG0338|consensus 691 93.09
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 92.98
PF1324576 AAA_19: Part of AAA domain 92.74
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 92.7
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 92.7
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 92.42
KOG1132|consensus 945 92.41
KOG0330|consensus 476 92.09
PF03354 477 Terminase_1: Phage Terminase ; InterPro: IPR005021 91.87
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 91.85
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 91.57
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 91.54
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 90.84
PRK14974336 cell division protein FtsY; Provisional 90.83
PHA03368 738 DNA packaging terminase subunit 1; Provisional 90.62
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 90.48
TIGR00376 637 DNA helicase, putative. The gene product may repre 90.39
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 90.35
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 90.08
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 89.61
KOG0331|consensus519 89.24
PRK10875 615 recD exonuclease V subunit alpha; Provisional 89.18
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 88.34
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 88.05
KOG0347|consensus 731 87.86
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 87.68
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 87.58
PRK05642234 DNA replication initiation factor; Validated 87.28
COG4098441 comFA Superfamily II DNA/RNA helicase required for 86.96
KOG0298|consensus1394 86.88
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 86.7
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 86.61
KOG1805|consensus1100 86.01
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 85.77
smart00382148 AAA ATPases associated with a variety of cellular 85.66
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 85.62
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 84.99
KOG0350|consensus 620 84.67
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 84.62
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 84.32
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 84.15
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 84.14
PRK08084235 DNA replication initiation factor; Provisional 84.06
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 83.77
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 83.77
KOG0329|consensus 387 83.72
COG4626 546 Phage terminase-like protein, large subunit [Gener 83.07
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 82.84
COG1205 851 Distinct helicase family with a unique C-terminal 82.65
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 82.5
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 82.43
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 82.36
PRK09401 1176 reverse gyrase; Reviewed 82.01
KOG1132|consensus 945 81.96
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 81.84
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 81.64
KOG0344|consensus593 81.62
cd00032243 CASc Caspase, interleukin-1 beta converting enzyme 81.59
PF0230290 PTS_IIB: PTS system, Lactose/Cellobiose specific I 81.36
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 81.35
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 81.22
PRK13766 773 Hef nuclease; Provisional 81.1
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 81.07
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 80.99
PTZ00110545 helicase; Provisional 80.52
>KOG0326|consensus Back     alignment and domain information 
Probab=100.00  E-value=8.6e-62  Score=396.41  Aligned_cols=324  Identities=77%  Similarity=1.201  Sum_probs=314.8

Q ss_pred             ccCCcchhhhcccCcCCCCCceEEEEcCCHHHHHHHHHHHHHHHhhCCceEEEEECCcchHHHHHHHhCCCcEEEEccHH
Q psy13286          5 RQEPTQFLYLNKLTPAKITSKATLIIVPTRELALQTSQICIELAKHLNVKVMVTTGGTNLRDDIMRIYQKVHLIIATPGR   84 (351)
Q Consensus         5 ~tgs~~l~~l~~l~~~~~~~~~~lil~P~~~L~~q~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~Ilv~Tp~~   84 (351)
                      |||++.+|+|.++.+.... -.+++++||++||.|..+.|+++.+..++++...+||++.++++..+....+++|+||++
T Consensus       135 KT~a~~IP~Lekid~~~~~-IQ~~ilVPtrelALQtSqvc~~lskh~~i~vmvttGGT~lrDDI~Rl~~~VH~~vgTPGR  213 (459)
T KOG0326|consen  135 KTAAYCIPVLEKIDPKKNV-IQAIILVPTRELALQTSQVCKELSKHLGIKVMVTTGGTSLRDDIMRLNQTVHLVVGTPGR  213 (459)
T ss_pred             CccceechhhhhcCccccc-eeEEEEeecchhhHHHHHHHHHHhcccCeEEEEecCCcccccceeeecCceEEEEcCChh
Confidence            4555699999999988877 899999999999999999999999999999999999999999988888999999999999


Q ss_pred             HHHHHhccCcCCCCccEEEEcccccccCcchHHHHHHHHHhCCCCCcEEEEEeeCcchHHHHHHHhcCCCeEEeeccccc
Q psy13286         85 ILDLMDKQVANMDHCKILVLDEADKLLSQDFKGMLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELT  164 (351)
Q Consensus        85 l~~~l~~~~~~~~~~~lvViDE~h~~~~~~~~~~~~~~~~~~~~~~~~i~~SaT~~~~~~~~~~~~~~~~~~~~~~~~~~  164 (351)
                      ++++.+.+-.++++..++|+||||.+++.+|.+.+..++..+|+.+|++++|||+|-.+..|+.+++.+|+.+++-++..
T Consensus       214 IlDL~~KgVa~ls~c~~lV~DEADKlLs~~F~~~~e~li~~lP~~rQillySATFP~tVk~Fm~~~l~kPy~INLM~eLt  293 (459)
T KOG0326|consen  214 ILDLAKKGVADLSDCVILVMDEADKLLSVDFQPIVEKLISFLPKERQILLYSATFPLTVKGFMDRHLKKPYEINLMEELT  293 (459)
T ss_pred             HHHHHhcccccchhceEEEechhhhhhchhhhhHHHHHHHhCCccceeeEEecccchhHHHHHHHhccCcceeehhhhhh
Confidence            99999999889999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCceEEEEEcCcccHHHHHHHHHhhCCCCcEEEEeCchHHHHHHHHHHHhcCCeEEEeccCCCHHHHHHHHHHhhcCCc
Q psy13286        165 LKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLC  244 (351)
Q Consensus       165 ~~~~~~~~~~~~~~~k~~~l~~~l~~~~~~~~lIf~~~~~~~~~l~~~L~~~~~~~~~~~~~~~~~~r~~~~~~f~~g~~  244 (351)
                      ..++.++|.++.+..|..+|..++....-.++||||+|...++.+|+.+...|+.+.++|+.|.++.|.++..+|++|.+
T Consensus       294 l~GvtQyYafV~e~qKvhCLntLfskLqINQsIIFCNS~~rVELLAkKITelGyscyyiHakM~Q~hRNrVFHdFr~G~c  373 (459)
T KOG0326|consen  294 LKGVTQYYAFVEERQKVHCLNTLFSKLQINQSIIFCNSTNRVELLAKKITELGYSCYYIHAKMAQEHRNRVFHDFRNGKC  373 (459)
T ss_pred             hcchhhheeeechhhhhhhHHHHHHHhcccceEEEeccchHhHHHHHHHHhccchhhHHHHHHHHhhhhhhhhhhhcccc
Confidence            99999999999999999999999999998999999999999999999999999999999999999999999999999999


Q ss_pred             cEEEEeCcCCCCCCCCCCCEEEEecCCCChhhHhhhccccccCCCceeEEEEeccchHHHHHHHHHHhccccCCCCcccc
Q psy13286        245 RNLVCSDLFTRGIDVQAVNVVINFDFPKMAETYLHRIGRSGRYGHLGIAINLITYEDRYALHRIEKELGTEIKSIPKVID  324 (351)
Q Consensus       245 ~ilv~T~~~~~G~di~~~~~Vi~~~~p~s~~~~~q~~GR~gR~~~~~~~i~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~  324 (351)
                      +.||||+.+.+|+|++++++|||||+|+++++|+||+||+||.|..|.+|.++..+|...++++|+.+|+++..+|..+|
T Consensus       374 rnLVctDL~TRGIDiqavNvVINFDfpk~aEtYLHRIGRsGRFGhlGlAInLityedrf~L~~IE~eLGtEI~pip~~iD  453 (459)
T KOG0326|consen  374 RNLVCTDLFTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRFGHLGLAINLITYEDRFNLYRIEQELGTEIKPIPSNID  453 (459)
T ss_pred             ceeeehhhhhcccccceeeEEEecCCCCCHHHHHHHccCCccCCCcceEEEEEehhhhhhHHHHHHHhccccccCCCcCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccc
Q psy13286        325 PALYV  329 (351)
Q Consensus       325 ~~~~~  329 (351)
                      +.+|.
T Consensus       454 k~lyv  458 (459)
T KOG0326|consen  454 KSLYV  458 (459)
T ss_pred             ccccc
Confidence            98774

>KOG0330|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG0701|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG1513|consensus Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG1133|consensus Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>cd00032 CASc Caspase, interleukin-1 beta converting enzyme (ICE) homologues; Cysteine-dependent aspartate-directed proteases that mediate programmed cell death (apoptosis) Back     alignment and domain information
>PF02302 PTS_IIB: PTS system, Lactose/Cellobiose specific IIB subunit; InterPro: IPR003501 The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query351
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 1e-133
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 3e-89
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 9e-60
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 1e-59
2hyi_C413 Structure Of The Human Exon Junction Complex With A 1e-59
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 1e-59
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 1e-59
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 2e-59
2vso_A395 Crystal Structure Of A Translation Initiation Compl 1e-54
1fuu_A394 Yeast Initiation Factor 4a Length = 394 3e-52
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 5e-52
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 7e-52
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 4e-50
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 2e-49
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 3e-49
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 4e-47
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 6e-45
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 4e-40
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 5e-40
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 5e-40
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 5e-40
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 1e-39
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 2e-39
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 2e-39
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 4e-39
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 7e-35
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 1e-30
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 2e-27
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 3e-25
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 5e-24
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 2e-22
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 2e-21
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 2e-21
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 2e-20
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 2e-20
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 5e-20
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 8e-20
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 1e-19
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 1e-19
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 2e-19
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 2e-19
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 1e-18
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 1e-18
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 4e-18
2jgn_A185 Ddx3 Helicase Domain Length = 185 4e-18
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 9e-18
3sqw_A 579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 4e-17
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 4e-17
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 5e-17
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 6e-17
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 7e-17
2oxc_A230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 1e-16
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 5e-16
3ly5_A262 Ddx18 Dead-Domain Length = 262 1e-15
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 5e-15
2kbe_A226 Solution Structure Of Amino-Terminal Domain Of Dbp5 5e-13
3i32_A 300 Dimeric Structure Of A Hera Helicase Fragment Inclu 6e-13
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 1e-12
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 3e-12
3fhc_B235 Crystal Structure Of Human Dbp5 In Complex With Nup 4e-11
3fmo_B300 Crystal Structure Of The Nucleoporin Nup214 In Comp 5e-11
1oyw_A 523 Structure Of The Recq Catalytic Core Length = 523 1e-07
1oyy_A 523 Structure Of The Recq Catalytic Core Bound To Atp-G 2e-07
4db2_A257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 6e-07
4db4_A256 Mss116p Dead-Box Helicase Domain 2 Bound To A Chima 6e-07
4db2_C257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 6e-07
3dkp_A245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 8e-07
2zj2_A 720 Archaeal Dna Helicase Hjm Apo State In Form 1 Lengt 1e-06
1gm5_A780 Structure Of Recg Bound To Three-Way Dna Junction L 1e-04
2fwr_A472 Structure Of Archaeoglobus Fulgidis Xpb Length = 47 2e-04
2fzl_A219 Structure Of C-Terminal Domain Of Archaeoglobus Ful 3e-04
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure 
Iteration: 1

 Score =  471 bits (1211), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 218/321 (67%), Positives = 264/321 (82%), Gaps = 1/321 (0%)
Query: 14  LNKLTPAKITSKATLIIVPTRELALQTSQICIELAKHLNVKVMVTTGGTNLRDDIMRIYQ 73
           L K+ P K+     LI+VPTRELALQTSQ+   L KH  +  MVTTGGTNLRDDI+R+ +
Sbjct: 80  LEKVKP-KLNKIQALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNE 138
Query: 74  KVHLIIATPGRILDLMDKQVANMDHCKILVLDEADKLLSQDFKGMLDHVISILPHERQIL 133
            VH+++ TPGR+LDL  ++VA++  C + ++DEADK+LS+DFK +++ ++S LP   Q L
Sbjct: 139 TVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSL 198
Query: 134 LYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQI 193
           L+SATFPLTVK FM KHL  PYEINLMEELTLKG+TQYYAFV+ERQK+HCLNTLFSKLQI
Sbjct: 199 LFSATFPLTVKEFMVKHLHKPYEINLMEELTLKGITQYYAFVEERQKLHCLNTLFSKLQI 258
Query: 194 NQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSDLF 253
           NQ+IIFCNST RVELLAKKIT+LGY CYY HARM Q  RN+VFH+FR G  R LVCSDL 
Sbjct: 259 NQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLL 318
Query: 254 TRGIDVQAVNVVINFDFPKMAETYLHRIGRSGRYGHLGIAINLITYEDRYALHRIEKELG 313
           TRGID+QAVNVVINFDFPK AETYLHRIGRSGR+GHLG+AINLI + DR+ L++IE+ELG
Sbjct: 319 TRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELG 378
Query: 314 TEIKSIPKVIDPALYVARPED 334
           TEI +IP  ID +LYVA  ++
Sbjct: 379 TEIAAIPATIDKSLYVAENDE 399
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 Back     alignment and structure
>pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 Back     alignment and structure
>pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 Back     alignment and structure
>pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 Back     alignment and structure
>pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 Back     alignment and structure
>pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|2ZJ2|A Chain A, Archaeal Dna Helicase Hjm Apo State In Form 1 Length = 720 Back     alignment and structure
>pdb|1GM5|A Chain A, Structure Of Recg Bound To Three-Way Dna Junction Length = 780 Back     alignment and structure
>pdb|2FWR|A Chain A, Structure Of Archaeoglobus Fulgidis Xpb Length = 472 Back     alignment and structure
>pdb|2FZL|A Chain A, Structure Of C-Terminal Domain Of Archaeoglobus Fulgidus Xpb Length = 219 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query351
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 1e-179
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 1e-160
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 1e-158
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 1e-157
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 1e-155
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-129
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 1e-125
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 1e-110
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 2e-98
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 6e-88
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 3e-82
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 2e-81
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 3e-81
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 2e-80
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 8e-80
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 2e-79
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 4e-74
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 8e-74
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 1e-63
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 1e-58
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 3e-56
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 1e-54
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 8e-51
3bor_A237 Human initiation factor 4A-II; translation initiat 2e-49
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-47
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 1e-42
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 1e-41
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 1e-40
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 3e-40
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 4e-40
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 3e-38
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 2e-37
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 3e-37
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 3e-37
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 1e-36
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 1e-35
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 1e-34
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 9e-34
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 2e-33
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 3e-33
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 3e-17
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 2e-09
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 7e-10
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 2e-09
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 6e-08
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 8e-08
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 8e-08
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 9e-08
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 1e-07
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 3e-07
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 5e-07
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 2e-06
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 3e-06
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 1e-05
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 1e-05
3b6e_A216 Interferon-induced helicase C domain-containing P; 2e-05
3h1t_A590 Type I site-specific restriction-modification syst 8e-04
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
 Score =  501 bits (1292), Expect = e-179
 Identities = 218/321 (67%), Positives = 264/321 (82%), Gaps = 1/321 (0%)

Query: 14  LNKLTPAKITSKATLIIVPTRELALQTSQICIELAKHLNVKVMVTTGGTNLRDDIMRIYQ 73
           L K+ P     +A LI+VPTRELALQTSQ+   L KH  +  MVTTGGTNLRDDI+R+ +
Sbjct: 80  LEKVKPKLNKIQA-LIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNE 138

Query: 74  KVHLIIATPGRILDLMDKQVANMDHCKILVLDEADKLLSQDFKGMLDHVISILPHERQIL 133
            VH+++ TPGR+LDL  ++VA++  C + ++DEADK+LS+DFK +++ ++S LP   Q L
Sbjct: 139 TVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSL 198

Query: 134 LYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQI 193
           L+SATFPLTVK FM KHL  PYEINLMEELTLKG+TQYYAFV+ERQK+HCLNTLFSKLQI
Sbjct: 199 LFSATFPLTVKEFMVKHLHKPYEINLMEELTLKGITQYYAFVEERQKLHCLNTLFSKLQI 258

Query: 194 NQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSDLF 253
           NQ+IIFCNST RVELLAKKIT+LGY CYY HARM Q  RN+VFH+FR G  R LVCSDL 
Sbjct: 259 NQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLL 318

Query: 254 TRGIDVQAVNVVINFDFPKMAETYLHRIGRSGRYGHLGIAINLITYEDRYALHRIEKELG 313
           TRGID+QAVNVVINFDFPK AETYLHRIGRSGR+GHLG+AINLI + DR+ L++IE+ELG
Sbjct: 319 TRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELG 378

Query: 314 TEIKSIPKVIDPALYVARPED 334
           TEI +IP  ID +LYVA  ++
Sbjct: 379 TEIAAIPATIDKSLYVAENDE 399
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Length = 523 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Length = 510 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Length = 590 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query351
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 100.0
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
4gl2_A 699 Interferon-induced helicase C domain-containing P; 100.0
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 100.0
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 100.0
1yks_A440 Genome polyprotein [contains: flavivirin protease 100.0
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 100.0
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 100.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 100.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 100.0
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 100.0
3h1t_A590 Type I site-specific restriction-modification syst 100.0
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 100.0
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.98
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.97
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.97
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.97
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.97
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.97
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.97
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.97
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.96
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.96
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.96
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.96
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.96
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.91
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.93
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.93
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.93
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.92
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.92
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.92
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.92
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.92
3bor_A237 Human initiation factor 4A-II; translation initiat 99.92
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.91
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.91
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.91
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.91
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.91
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.91
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.91
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.91
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.89
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.81
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.71
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.7
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.67
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.62
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.55
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.48
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.45
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 97.94
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 97.23
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 95.54
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 95.32
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 95.14
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 94.78
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 94.71
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 94.22
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 94.02
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 92.85
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 92.79
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 92.71
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 92.4
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 92.33
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 92.24
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 91.86
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 91.86
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 91.75
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 91.68
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 91.19
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 90.94
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 90.89
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 90.57
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 90.52
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 90.33
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 89.92
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 88.13
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 88.13
3bor_A237 Human initiation factor 4A-II; translation initiat 87.83
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 87.69
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 87.66
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 86.52
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 86.22
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 85.94
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 85.38
2l82_A162 Designed protein OR32; structural genomics, northe 84.59
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 84.14
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 83.65
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 83.33
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 83.27
3foj_A100 Uncharacterized protein; protein SSP1007, structur 82.99
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 82.72
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 82.53
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 82.51
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 82.45
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 82.1
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 82.05
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 81.78
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 81.57
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 81.47
1yks_A440 Genome polyprotein [contains: flavivirin protease 81.04
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 80.91
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 80.62
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 80.52
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 80.47
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 80.09
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=3.1e-53  Score=388.80  Aligned_cols=324  Identities=28%  Similarity=0.453  Sum_probs=291.4

Q ss_pred             CcccccCCc-----chhhhcccCcCC----CCCceEEEEcCCHHHHHHHHHHHHHHHhhCCceEEEEECCcchHHHHHHH
Q psy13286          1 MVQARQEPT-----QFLYLNKLTPAK----ITSKATLIIVPTRELALQTSQICIELAKHLNVKVMVTTGGTNLRDDIMRI   71 (351)
Q Consensus         1 ~~~a~tgs~-----~l~~l~~l~~~~----~~~~~~lil~P~~~L~~q~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~   71 (351)
                      +++|+||||     ++|++..+....    ..++++||++||++|+.|+++.+++++...++++..++|+.....+...+
T Consensus        97 i~~a~TGsGKT~a~~lpil~~l~~~~~~~~~~~~~~lil~PtreLa~Q~~~~~~~~~~~~~~~~~~~~gg~~~~~~~~~l  176 (434)
T 2db3_A           97 MACAQTGSGKTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECI  176 (434)
T ss_dssp             EEECCTTSSHHHHHHHHHHHHHHHSCCCCCTTCCSEEEECSSHHHHHHHHHHHHHHTTTSSCCCCEECTTSCHHHHHHHH
T ss_pred             EEECCCCCCchHHHHHHHHHHHHhcccccccCCccEEEEecCHHHHHHHHHHHHHHhccCCcEEEEEECCCCHHHHHHHh
Confidence            478999997     677877765432    23589999999999999999999999988889999999999988887777


Q ss_pred             hCCCcEEEEccHHHHHHHhccCcCCCCccEEEEcccccccCcchHHHHHHHHHhC--CCCCcEEEEEeeCcchHHHHHHH
Q psy13286         72 YQKVHLIIATPGRILDLMDKQVANMDHCKILVLDEADKLLSQDFKGMLDHVISIL--PHERQILLYSATFPLTVKNFMEK  149 (351)
Q Consensus        72 ~~~~~Ilv~Tp~~l~~~l~~~~~~~~~~~lvViDE~h~~~~~~~~~~~~~~~~~~--~~~~~~i~~SaT~~~~~~~~~~~  149 (351)
                      ..+++|+|+||++|.+++.++...+.+++++|+||||++.+.+|...+..++..+  +...|++++|||++..+..+...
T Consensus       177 ~~~~~Ivv~Tp~~l~~~l~~~~~~l~~~~~lVlDEah~~~~~gf~~~~~~i~~~~~~~~~~q~l~~SAT~~~~~~~~~~~  256 (434)
T 2db3_A          177 TRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGE  256 (434)
T ss_dssp             TTCCSEEEECHHHHHHHHHTTSCCCTTCCEEEEETHHHHTSTTTHHHHHHHHHCTTSCSSCEEEEEESCCCHHHHHHHHT
T ss_pred             hcCCCEEEEChHHHHHHHHhCCcccccCCeEEEccHhhhhccCcHHHHHHHHHhcCCCCCceEEEEeccCCHHHHHHHHH
Confidence            8899999999999999999888889999999999999999999999999998875  56789999999999999999999


Q ss_pred             hcCCCeEEeeccc-cccCCceEEEEEcCcccHHHHHHHHHhhCCCCcEEEEeCchHHHHHHHHHHHhcCCeEEEeccCCC
Q psy13286        150 HLKDPYEINLMEE-LTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMA  228 (351)
Q Consensus       150 ~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~k~~~l~~~l~~~~~~~~lIf~~~~~~~~~l~~~L~~~~~~~~~~~~~~~  228 (351)
                      ++.++..+..... .....+.+.+..+....|...+..++.....+ +||||++++.++.+++.|+..++.+..+||+++
T Consensus       257 ~l~~~~~i~~~~~~~~~~~i~~~~~~~~~~~k~~~l~~~l~~~~~~-~lVF~~t~~~a~~l~~~L~~~~~~~~~lhg~~~  335 (434)
T 2db3_A          257 FLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQADG-TIVFVETKRGADFLASFLSEKEFPTTSIHGDRL  335 (434)
T ss_dssp             TCSSCEEEEESSTTCCCTTEEEEEEECCGGGHHHHHHHHHHHCCTT-EEEECSSHHHHHHHHHHHHHTTCCEEEESTTSC
T ss_pred             hccCCEEEEeccccccccccceEEEEeCcHHHHHHHHHHHHhCCCC-EEEEEeCcHHHHHHHHHHHhCCCCEEEEeCCCC
Confidence            9988877766532 34556788888888889999999999887644 999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhcCCccEEEEeCcCCCCCCCCCCCEEEEecCCCChhhHhhhccccccCCCceeEEEEec-cchHHHHHH
Q psy13286        229 QAHRNRVFHDFRSGLCRNLVCSDLFTRGIDVQAVNVVINFDFPKMAETYLHRIGRSGRYGHLGIAINLIT-YEDRYALHR  307 (351)
Q Consensus       229 ~~~r~~~~~~f~~g~~~ilv~T~~~~~G~di~~~~~Vi~~~~p~s~~~~~q~~GR~gR~~~~~~~i~~~~-~~~~~~~~~  307 (351)
                      +.+|.++++.|++|+.+|||||+++++|+|+|++++||+||+|.+..+|+||+||+||.|+.|.+++|++ .++......
T Consensus       336 ~~~R~~~l~~F~~g~~~vLvaT~v~~rGlDi~~v~~VI~~d~p~~~~~y~qriGR~gR~g~~G~a~~~~~~~~~~~~~~~  415 (434)
T 2db3_A          336 QSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEKDRAIAAD  415 (434)
T ss_dssp             HHHHHHHHHHHHTSSCSEEEECGGGTSSCCCTTCCEEEESSCCSSHHHHHHHHTTSSCTTCCEEEEEEECTTTCGGGHHH
T ss_pred             HHHHHHHHHHHHcCCCcEEEEchhhhCCCCcccCCEEEEECCCCCHHHHHHHhcccccCCCCCEEEEEEeccccHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999998 457778899


Q ss_pred             HHHHhccccCCCCccccc
Q psy13286        308 IEKELGTEIKSIPKVIDP  325 (351)
Q Consensus       308 l~~~l~~~~~~~~~~~~~  325 (351)
                      +.+.+....+++|..+.+
T Consensus       416 l~~~l~~~~~~vp~~l~~  433 (434)
T 2db3_A          416 LVKILEGSGQTVPDFLRT  433 (434)
T ss_dssp             HHHHHHHTTCCCCGGGC-
T ss_pred             HHHHHHHcCCCCCHHHHh
Confidence            999999999999988764
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2l82_A Designed protein OR32; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 351
d1s2ma2171 c.37.1.19 (A:252-422) Putative ATP-dependent RNA h 1e-34
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 3e-31
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 5e-31
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 6e-30
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 2e-26
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 3e-24
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 2e-23
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 3e-23
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 1e-21
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 2e-21
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 1e-20
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 4e-20
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 5e-19
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 9e-19
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 1e-18
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 3e-18
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 1e-17
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 2e-16
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 5e-16
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 7e-16
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 1e-15
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 2e-14
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 2e-13
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 4e-11
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 5e-11
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 5e-10
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 3e-08
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 5e-07
d1z3ix1346 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fi 7e-04
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 8e-04
d1yksa2 299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 0.002
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative ATP-dependent RNA helicase DHH1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  123 bits (308), Expect = 1e-34
 Identities = 133/169 (78%), Positives = 150/169 (88%)

Query: 162 ELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCY 221
           ELTLKG+TQYYAFV+ERQK+HCLNTLFSKLQINQ+IIFCNST RVELLAKKIT+LGY CY
Sbjct: 1   ELTLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCY 60

Query: 222 YIHARMAQAHRNRVFHDFRSGLCRNLVCSDLFTRGIDVQAVNVVINFDFPKMAETYLHRI 281
           Y HARM Q  RN+VFH+FR G  R LVCSDL TRGID+QAVNVVINFDFPK AETYLHRI
Sbjct: 61  YSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRI 120

Query: 282 GRSGRYGHLGIAINLITYEDRYALHRIEKELGTEIKSIPKVIDPALYVA 330
           GRSGR+GHLG+AINLI + DR+ L++IE+ELGTEI +IP  ID +LYVA
Sbjct: 121 GRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIAAIPATIDKSLYVA 169
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query351
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.98
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.97
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.97
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.95
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.94
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.94
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.94
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.93
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.93
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.93
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.93
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.92
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.92
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.89
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.86
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.86
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.86
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.81
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.79
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.79
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.79
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.79
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.77
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.71
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.69
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.61
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.61
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.57
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.56
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.53
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.51
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.5
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.47
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.46
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.45
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.4
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 99.05
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.67
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 98.34
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.34
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.26
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.23
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.88
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 96.01
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 95.2
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 93.84
d2eyqa2117 Transcription-repair coupling factor, TRCF {Escher 93.64
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 93.19
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 92.81
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 92.34
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 92.19
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 91.93
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 91.35
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 90.93
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 89.91
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 89.34
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 88.66
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 88.58
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 88.07
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 87.31
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 86.78
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 86.72
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 85.48
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 84.36
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 83.06
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 82.27
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 81.26
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 80.49
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative ATP-dependent RNA helicase DHH1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=6.7e-35  Score=230.01  Aligned_cols=168  Identities=79%  Similarity=1.277  Sum_probs=161.6

Q ss_pred             cccCCceEEEEEcCcccHHHHHHHHHhhCCCCcEEEEeCchHHHHHHHHHHHhcCCeEEEeccCCCHHHHHHHHHHhhcC
Q psy13286        163 LTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSG  242 (351)
Q Consensus       163 ~~~~~~~~~~~~~~~~~k~~~l~~~l~~~~~~~~lIf~~~~~~~~~l~~~L~~~~~~~~~~~~~~~~~~r~~~~~~f~~g  242 (351)
                      .+..++.|+|..+...+|...|..+++..++.++||||+++++++.++..|+..++.+..+||+++..+|..+++.|++|
T Consensus         2 ~tl~~i~q~yi~v~~~~K~~~L~~ll~~~~~~k~iVF~~~~~~~~~l~~~L~~~g~~~~~~h~~~~~~~r~~~~~~f~~~   81 (171)
T d1s2ma2           2 LTLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQG   81 (171)
T ss_dssp             CBCTTEEEEEEECCGGGHHHHHHHHHHHSCCSEEEEECSSHHHHHHHHHHHHHHTCCEEEECTTSCHHHHHHHHHHHHTT
T ss_pred             CCccceEEEEEEcCHHHHHHHHHHHHHhCCCCceEEEEeeeehhhHhHHhhhcccccccccccccchhhhhhhhhhcccC
Confidence            45678999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccEEEEeCcCCCCCCCCCCCEEEEecCCCChhhHhhhccccccCCCceeEEEEeccchHHHHHHHHHHhccccCCCCcc
Q psy13286        243 LCRNLVCSDLFTRGIDVQAVNVVINFDFPKMAETYLHRIGRSGRYGHLGIAINLITYEDRYALHRIEKELGTEIKSIPKV  322 (351)
Q Consensus       243 ~~~ilv~T~~~~~G~di~~~~~Vi~~~~p~s~~~~~q~~GR~gR~~~~~~~i~~~~~~~~~~~~~l~~~l~~~~~~~~~~  322 (351)
                      +.++||||+.+++|+|+|++++||+||+|+++.+|+||+||+||.|+.|.+++|+.+.|...+..+++.++.++.++|..
T Consensus        82 ~~~ilv~Td~~~~Gid~~~v~~VI~~d~p~~~~~y~qr~GR~gR~g~~g~~i~~v~~~e~~~~~~i~~~l~~~~~~~p~~  161 (171)
T d1s2ma2          82 KVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIAAIPAT  161 (171)
T ss_dssp             SSSEEEESSCSSSSCCCTTEEEEEESSCCSSHHHHHHHHCBSSCTTCCEEEEEEECGGGHHHHHHHHHHHTCCCEECCSS
T ss_pred             ccccccchhHhhhccccceeEEEEecCCcchHHHHHHHhhhcccCCCccEEEEEeCHHHHHHHHHHHHHHCCCCCCCCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccc
Q psy13286        323 IDPALYVA  330 (351)
Q Consensus       323 ~~~~~~~~  330 (351)
                      +++..+.+
T Consensus       162 ~d~~~~~~  169 (171)
T d1s2ma2         162 IDKSLYVA  169 (171)
T ss_dssp             CCGGGTCC
T ss_pred             cchhhhhc
Confidence            99877643
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2eyqa2 c.37.1.19 (A:349-465) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure