Psyllid ID: psy13287


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSGDSSAMM
cHHHHHHHcccccEEEEEEccccHHHHHHHHHHcccccEEEEccccccccEEEEEEEEccccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHcccccEEEEHHHHcccc
cHHHHHHHccHHHcEEEEEccccHHHHHHHHHHHcccEEEEEccccccccEEEEEEEccHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHccccEEEHcccccHHHHHHHHHHHHccccEEEEEEHHHHccc
MLDHVISILPHERQILLYSATFPLTVKNFMEKhlkdpyeiNLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRnlvcsgdssamm
MLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNlvcsgdssamm
MLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSGDSSAMM
***HVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVC********
MLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSGDSSAMM
MLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSGDSSAMM
MLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSGDSSAMM
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSGDSSAMM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query140 2.2.26 [Sep-21-2011]
P23128459 Putative ATP-dependent RN yes N/A 0.95 0.289 0.924 2e-70
Q95YF3430 ATP-dependent RNA helicas yes N/A 0.95 0.309 0.812 6e-62
P54823483 Probable ATP-dependent RN yes N/A 0.95 0.275 0.781 6e-61
Q5RFQ5483 Probable ATP-dependent RN yes N/A 0.95 0.275 0.781 7e-61
P26196483 Probable ATP-dependent RN yes N/A 0.95 0.275 0.781 7e-61
Q5ZKB9483 Probable ATP-dependent RN yes N/A 0.95 0.275 0.781 7e-61
Q0IHV9481 Probable ATP-dependent RN yes N/A 0.95 0.276 0.781 1e-60
P54824481 ATP-dependent RNA helicas N/A N/A 0.95 0.276 0.781 2e-60
Q09181 485 Putative ATP-dependent RN yes N/A 0.95 0.274 0.781 4e-60
A1CJ18 503 ATP-dependent RNA helicas N/A N/A 0.95 0.264 0.751 4e-60
>sp|P23128|DDX6_DROME Putative ATP-dependent RNA helicase me31b OS=Drosophila melanogaster GN=me31B PE=1 SV=3 Back     alignment and function desciption
 Score =  263 bits (672), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 128/133 (96%)

Query: 1   MLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQE 60
           MLDHVI  LP + QILL+SATFPLTVKNFMEKHL++PYEINLMEELTLKGVTQYYAFVQE
Sbjct: 220 MLDHVILKLPKDPQILLFSATFPLTVKNFMEKHLREPYEINLMEELTLKGVTQYYAFVQE 279

Query: 61  RQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFH 120
           RQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHA+MAQAHRNRVFH
Sbjct: 280 RQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHAKMAQAHRNRVFH 339

Query: 121 DFRSGLCRNLVCS 133
           DFR GLCRNLVCS
Sbjct: 340 DFRQGLCRNLVCS 352




Unwinds RNA in an ATP-dependent fashion.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q95YF3|CGH1_CAEEL ATP-dependent RNA helicase cgh-1 OS=Caenorhabditis elegans GN=cgh-1 PE=1 SV=1 Back     alignment and function description
>sp|P54823|DDX6_MOUSE Probable ATP-dependent RNA helicase DDX6 OS=Mus musculus GN=Ddx6 PE=2 SV=1 Back     alignment and function description
>sp|Q5RFQ5|DDX6_PONAB Probable ATP-dependent RNA helicase DDX6 OS=Pongo abelii GN=DDX6 PE=2 SV=1 Back     alignment and function description
>sp|P26196|DDX6_HUMAN Probable ATP-dependent RNA helicase DDX6 OS=Homo sapiens GN=DDX6 PE=1 SV=2 Back     alignment and function description
>sp|Q5ZKB9|DDX6_CHICK Probable ATP-dependent RNA helicase DDX6 OS=Gallus gallus GN=DDX6 PE=2 SV=1 Back     alignment and function description
>sp|Q0IHV9|DDX6_XENTR Probable ATP-dependent RNA helicase ddx6 OS=Xenopus tropicalis GN=ddx6 PE=2 SV=1 Back     alignment and function description
>sp|P54824|DDX6_XENLA ATP-dependent RNA helicase ddx6 OS=Xenopus laevis GN=ddx6 PE=1 SV=2 Back     alignment and function description
>sp|Q09181|DHH1_SCHPO Putative ATP-dependent RNA helicase ste13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste13 PE=3 SV=1 Back     alignment and function description
>sp|A1CJ18|DHH1_ASPCL ATP-dependent RNA helicase dhh1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dhh1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
156547575 445 PREDICTED: putative ATP-dependent RNA he 0.95 0.298 0.947 2e-71
158299881 430 AGAP009135-PA [Anopheles gambiae str. PE 0.95 0.309 0.947 3e-70
312377194 415 hypothetical protein AND_11577 [Anophele 0.95 0.320 0.947 3e-70
332020362 444 Putative ATP-dependent RNA helicase me31 0.95 0.299 0.939 4e-70
340728954 444 PREDICTED: putative ATP-dependent RNA he 0.95 0.299 0.939 4e-70
328783051 444 PREDICTED: putative ATP-dependent RNA he 0.95 0.299 0.939 4e-70
383858347 444 PREDICTED: putative ATP-dependent RNA he 0.95 0.299 0.939 4e-70
307168696 443 Putative ATP-dependent RNA helicase me31 0.95 0.300 0.939 5e-70
242014232 460 DEAD box ATP-dependent RNA helicase, put 0.95 0.289 0.932 6e-70
307206923 435 Putative ATP-dependent RNA helicase me31 0.95 0.305 0.939 6e-70
>gi|156547575|ref|XP_001602897.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like isoform 1 [Nasonia vitripennis] gi|345485131|ref|XP_003425200.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 126/133 (94%), Positives = 131/133 (98%)

Query: 1   MLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQE 60
           MLDHVIS LPHERQILLYSATFPLTVK FMEKHL+DPYEINLMEELTLKGVTQYYAFVQE
Sbjct: 217 MLDHVISRLPHERQILLYSATFPLTVKQFMEKHLRDPYEINLMEELTLKGVTQYYAFVQE 276

Query: 61  RQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFH 120
           RQKVHCLNTLFSKLQINQSIIFCN+TQRVELLAKKIT+LGYCCYYIHA+MAQAHRNRVFH
Sbjct: 277 RQKVHCLNTLFSKLQINQSIIFCNTTQRVELLAKKITDLGYCCYYIHAKMAQAHRNRVFH 336

Query: 121 DFRSGLCRNLVCS 133
           DFR+GLCRNLVCS
Sbjct: 337 DFRAGLCRNLVCS 349




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|158299881|ref|XP_319893.3| AGAP009135-PA [Anopheles gambiae str. PEST] gi|157013731|gb|EAA14695.3| AGAP009135-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|312377194|gb|EFR24088.1| hypothetical protein AND_11577 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|332020362|gb|EGI60783.1| Putative ATP-dependent RNA helicase me31b [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340728954|ref|XP_003402776.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like [Bombus terrestris] gi|350412268|ref|XP_003489590.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328783051|ref|XP_624586.2| PREDICTED: putative ATP-dependent RNA helicase me31b-like isoform 1 [Apis mellifera] gi|380013249|ref|XP_003690677.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like [Apis florea] Back     alignment and taxonomy information
>gi|383858347|ref|XP_003704663.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307168696|gb|EFN61728.1| Putative ATP-dependent RNA helicase me31b [Camponotus floridanus] Back     alignment and taxonomy information
>gi|242014232|ref|XP_002427795.1| DEAD box ATP-dependent RNA helicase, putative [Pediculus humanus corporis] gi|212512264|gb|EEB15057.1| DEAD box ATP-dependent RNA helicase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307206923|gb|EFN84769.1| Putative ATP-dependent RNA helicase me31b [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
FB|FBgn0004419459 me31B "maternal expression at 0.95 0.289 0.924 4.7e-64
WB|WBGene00000479430 cgh-1 [Caenorhabditis elegans 0.95 0.309 0.812 1.2e-56
UNIPROTKB|Q95YF3430 cgh-1 "ATP-dependent RNA helic 0.95 0.309 0.812 1.2e-56
ZFIN|ZDB-GENE-030131-6611483 wu:fk48d07 "wu:fk48d07" [Danio 0.95 0.275 0.781 6.8e-56
ZFIN|ZDB-GENE-070912-83485 ddx6 "DEAD (Asp-Glu-Ala-Asp) b 0.95 0.274 0.781 3.7e-55
UNIPROTKB|E1C8R1483 DDX6 "Probable ATP-dependent R 0.95 0.275 0.781 6.1e-55
UNIPROTKB|Q5ZKB9483 DDX6 "Probable ATP-dependent R 0.95 0.275 0.781 6.1e-55
UNIPROTKB|E1BDM8483 DDX6 "Uncharacterized protein" 0.95 0.275 0.781 6.1e-55
UNIPROTKB|E2RR01483 DDX6 "Uncharacterized protein" 0.95 0.275 0.781 6.1e-55
UNIPROTKB|P26196483 DDX6 "Probable ATP-dependent R 0.95 0.275 0.781 6.1e-55
FB|FBgn0004419 me31B "maternal expression at 31B" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 653 (234.9 bits), Expect = 4.7e-64, P = 4.7e-64
 Identities = 123/133 (92%), Positives = 128/133 (96%)

Query:     1 MLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQE 60
             MLDHVI  LP + QILL+SATFPLTVKNFMEKHL++PYEINLMEELTLKGVTQYYAFVQE
Sbjct:   220 MLDHVILKLPKDPQILLFSATFPLTVKNFMEKHLREPYEINLMEELTLKGVTQYYAFVQE 279

Query:    61 RQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFH 120
             RQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHA+MAQAHRNRVFH
Sbjct:   280 RQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHAKMAQAHRNRVFH 339

Query:   121 DFRSGLCRNLVCS 133
             DFR GLCRNLVCS
Sbjct:   340 DFRQGLCRNLVCS 352




GO:0004004 "ATP-dependent RNA helicase activity" evidence=ISS;NAS
GO:0005524 "ATP binding" evidence=IEA
GO:0003723 "RNA binding" evidence=IDA
GO:0000932 "cytoplasmic mRNA processing body" evidence=IDA
GO:0033962 "cytoplasmic mRNA processing body assembly" evidence=IMP
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0007095 "mitotic G2 DNA damage checkpoint" evidence=IGI
GO:0043186 "P granule" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
WB|WBGene00000479 cgh-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q95YF3 cgh-1 "ATP-dependent RNA helicase cgh-1" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6611 wu:fk48d07 "wu:fk48d07" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070912-83 ddx6 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C8R1 DDX6 "Probable ATP-dependent RNA helicase DDX6" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKB9 DDX6 "Probable ATP-dependent RNA helicase DDX6" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BDM8 DDX6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RR01 DDX6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P26196 DDX6 "Probable ATP-dependent RNA helicase DDX6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A3LWX3DHH1_PICST3, ., 6, ., 4, ., 1, 30.72930.950.2612yesN/A
Q75BS4DHH1_ASHGO3, ., 6, ., 4, ., 1, 30.74430.950.2747yesN/A
Q54E49DDX6_DICDI3, ., 6, ., 4, ., 1, 30.76690.950.3144yesN/A
P54823DDX6_MOUSE3, ., 6, ., 4, ., 1, 30.78190.950.2753yesN/A
Q4WWD3DHH1_ASPFU3, ., 6, ., 4, ., 1, 30.75180.950.2623yesN/A
Q6C0X2DHH1_YARLI3, ., 6, ., 4, ., 1, 30.74430.950.2547yesN/A
Q6FQU5DHH1_CANGA3, ., 6, ., 4, ., 1, 30.75930.950.2623yesN/A
Q9WTM2DDX6_CAVPO3, ., 6, ., 4, ., 1, 30.76690.950.2817yesN/A
Q0IHV9DDX6_XENTR3, ., 6, ., 4, ., 1, 30.78190.950.2765yesN/A
P23128DDX6_DROME3, ., 6, ., 4, ., 1, 30.92480.950.2897yesN/A
Q2U5A2DHH1_ASPOR3, ., 6, ., 4, ., 1, 30.75180.950.2602yesN/A
Q95YF3CGH1_CAEEL3, ., 6, ., 4, ., 1, 30.81200.950.3093yesN/A
Q8SQK9DHH1_ENCCU3, ., 6, ., 4, ., 1, 30.51160.92140.2638yesN/A
Q8RXK6RH8_ARATH3, ., 6, ., 4, ., 1, 30.75750.94280.2613yesN/A
Q6BJX6DHH1_DEBHA3, ., 6, ., 4, ., 1, 30.69170.950.2577yesN/A
Q109G2RH12_ORYSJ3, ., 6, ., 4, ., 1, 30.76510.94280.2533yesN/A
Q5RFQ5DDX6_PONAB3, ., 6, ., 4, ., 1, 30.78190.950.2753yesN/A
P26196DDX6_HUMAN3, ., 6, ., 4, ., 1, 30.78190.950.2753yesN/A
Q6CSZ7DHH1_KLULA3, ., 6, ., 4, ., 1, 30.71420.950.2587yesN/A
Q5ZKB9DDX6_CHICK3, ., 6, ., 4, ., 1, 30.78190.950.2753yesN/A
Q4HW67DHH1_GIBZE3, ., 6, ., 4, ., 1, 30.72180.950.2736yesN/A
Q09181DHH1_SCHPO3, ., 6, ., 4, ., 1, 30.78190.950.2742yesN/A
P0CQ80DHH1_CRYNJ3, ., 6, ., 4, ., 1, 30.73680.950.2128yesN/A
P39517DHH1_YEAST3, ., 6, ., 4, ., 1, 30.75180.950.2628yesN/A
A2QY39DHH1_ASPNC3, ., 6, ., 4, ., 1, 30.75180.950.2633yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 2e-34
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 1e-22
PRK11776 460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 1e-14
PRK10590 456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 2e-14
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 8e-14
cd00268203 cd00268, DEADc, DEAD-box helicases 5e-11
PTZ00110 545 PTZ00110, PTZ00110, helicase; Provisional 4e-09
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 2e-08
PRK11192 434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-07
smart0049082 smart00490, HELICc, helicase superfamily c-termina 5e-07
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 5e-07
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 5e-06
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 7e-06
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-05
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 7e-04
COG1202 830 COG1202, COG1202, Superfamily II helicase, archaea 0.001
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 0.003
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
 Score =  124 bits (313), Expect = 2e-34
 Identities = 42/136 (30%), Positives = 70/136 (51%), Gaps = 4/136 (2%)

Query: 2   LDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINL---MEELTLKGVTQYYAFV 58
           ++ ++  LP +RQ LL+SAT P  ++    ++L DP EI +     E TLK + Q+Y  V
Sbjct: 195 IEKILKALPPDRQTLLFSATMPDDIRELARRYLNDPVEIEVSVEKLERTLKKIKQFYLEV 254

Query: 59  -QERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNR 117
             E +K+  L  L       + I+F  + + VE LA+ + + G+    +H  + Q  R+R
Sbjct: 255 ESEEEKLELLLKLLKDEDEGRVIVFVRTKRLVEELAESLRKRGFKVAALHGDLPQEERDR 314

Query: 118 VFHDFRSGLCRNLVCS 133
               F+ G  R LV +
Sbjct: 315 ALEKFKDGELRVLVAT 330


Length = 513

>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 140
KOG0328|consensus400 100.0
KOG0326|consensus459 99.97
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.97
KOG0331|consensus 519 99.97
KOG0333|consensus673 99.96
KOG0330|consensus 476 99.96
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 99.96
KOG0332|consensus477 99.95
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.95
KOG0327|consensus397 99.95
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 99.94
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.94
PTZ00110 545 helicase; Provisional 99.94
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 99.94
KOG0338|consensus 691 99.93
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.93
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.93
KOG0343|consensus 758 99.92
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 99.92
PTZ00424401 helicase 45; Provisional 99.92
KOG0342|consensus 543 99.92
KOG0335|consensus482 99.91
KOG0345|consensus 567 99.91
KOG0340|consensus 442 99.9
KOG0336|consensus629 99.89
KOG0341|consensus 610 99.89
KOG4284|consensus 980 99.89
KOG0339|consensus 731 99.89
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.88
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.87
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.87
KOG0334|consensus 997 99.86
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.86
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.86
PRK10689 1147 transcription-repair coupling factor; Provisional 99.85
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.85
KOG0337|consensus 529 99.85
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.84
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.84
KOG0346|consensus 569 99.84
KOG0344|consensus 593 99.83
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.83
PRK09401 1176 reverse gyrase; Reviewed 99.82
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.82
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.81
PHA02653 675 RNA helicase NPH-II; Provisional 99.8
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.78
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.77
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.77
PRK13767 876 ATP-dependent helicase; Provisional 99.76
PRK14701 1638 reverse gyrase; Provisional 99.76
KOG0347|consensus 731 99.76
PRK00254 720 ski2-like helicase; Provisional 99.74
KOG0348|consensus 708 99.71
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 99.71
COG1202 830 Superfamily II helicase, archaea-specific [General 99.71
PRK02362 737 ski2-like helicase; Provisional 99.71
PRK01172 674 ski2-like helicase; Provisional 99.68
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.67
KOG0351|consensus 941 99.66
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 99.65
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 99.65
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.64
KOG0350|consensus 620 99.63
KOG0349|consensus 725 99.62
PRK09694 878 helicase Cas3; Provisional 99.56
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.55
PHA02558501 uvsW UvsW helicase; Provisional 99.54
COG1204 766 Superfamily II helicase [General function predicti 99.54
PRK04914 956 ATP-dependent helicase HepA; Validated 99.53
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.53
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.52
KOG0353|consensus 695 99.52
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 99.52
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 99.52
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.48
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.47
PRK05298 652 excinuclease ABC subunit B; Provisional 99.47
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.45
KOG0951|consensus 1674 99.44
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.41
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 99.4
COG1205 851 Distinct helicase family with a unique C-terminal 99.4
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.38
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.37
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.37
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.35
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.34
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.33
PRK13766 773 Hef nuclease; Provisional 99.31
KOG0329|consensus387 99.3
TIGR00595 505 priA primosomal protein N'. All proteins in this f 99.22
KOG0952|consensus 1230 99.21
KOG0354|consensus 746 99.21
KOG0352|consensus 641 99.17
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 99.17
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.14
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.13
PRK05580 679 primosome assembly protein PriA; Validated 99.11
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 99.07
KOG0950|consensus 1008 99.01
smart0049082 HELICc helicase superfamily c-terminal domain. 98.92
KOG0922|consensus 674 98.87
KOG0948|consensus 1041 98.8
KOG0947|consensus 1248 98.73
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 98.73
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 98.71
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 98.63
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 98.57
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 98.55
KOG4150|consensus 1034 98.48
KOG0953|consensus 700 98.46
KOG0923|consensus 902 98.34
KOG0920|consensus 924 98.34
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 98.33
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 98.24
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 98.22
KOG0924|consensus 1042 98.16
PRK12326 764 preprotein translocase subunit SecA; Reviewed 98.14
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 98.0
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 97.95
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 97.89
CHL00122 870 secA preprotein translocase subunit SecA; Validate 97.85
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 97.84
PRK14873 665 primosome assembly protein PriA; Provisional 97.83
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 97.76
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 97.76
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 97.76
TIGR00595 505 priA primosomal protein N'. All proteins in this f 97.74
KOG0925|consensus 699 97.73
PRK05580 679 primosome assembly protein PriA; Validated 97.69
COG1198 730 PriA Primosomal protein N' (replication factor Y) 97.67
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 97.64
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 97.61
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 97.56
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 97.5
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 97.49
KOG0392|consensus 1549 97.45
COG1198 730 PriA Primosomal protein N' (replication factor Y) 97.45
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 97.33
PRK14701 1638 reverse gyrase; Provisional 97.28
KOG1000|consensus 689 97.23
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.18
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 97.12
KOG0387|consensus 923 97.12
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 97.04
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 96.99
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 96.91
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 96.82
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 96.81
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 96.79
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 96.77
PRK10689 1147 transcription-repair coupling factor; Provisional 96.75
KOG0385|consensus 971 96.72
KOG0389|consensus941 96.65
KOG0384|consensus 1373 96.61
KOG0347|consensus 731 96.61
KOG0926|consensus 1172 96.43
KOG0388|consensus1185 96.43
KOG0389|consensus 941 96.38
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 96.32
KOG1002|consensus791 96.3
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 96.28
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 96.26
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 96.13
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 96.11
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 96.1
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 96.03
KOG0390|consensus 776 95.9
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 95.78
PRK09401 1176 reverse gyrase; Reviewed 95.71
KOG1123|consensus 776 95.66
KOG0330|consensus 476 95.64
KOG0391|consensus 1958 95.64
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 95.57
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 95.52
KOG0949|consensus 1330 95.51
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 95.46
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 95.4
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 95.36
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 95.34
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 95.17
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 94.94
KOG0331|consensus 519 94.9
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 94.83
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 94.81
KOG0338|consensus 691 94.77
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 94.65
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 94.59
KOG0334|consensus 997 94.52
PRK13766 773 Hef nuclease; Provisional 94.44
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 94.43
cd0152996 4RHOD_Repeats Member of the Rhodanese Homology Dom 94.42
smart00115 241 CASc Caspase, interleukin-1 beta converting enzyme 94.4
KOG0385|consensus 971 94.39
KOG0339|consensus 731 94.36
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 94.3
COG4096 875 HsdR Type I site-specific restriction-modification 94.09
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 94.01
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 93.93
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 93.77
PTZ00110 545 helicase; Provisional 93.68
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 93.56
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 93.52
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 93.22
PRK09200 790 preprotein translocase subunit SecA; Reviewed 93.19
cd01521110 RHOD_PspE2 Member of the Rhodanese Homology Domain 93.14
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs a 93.07
cd0015889 RHOD Rhodanese Homology Domain (RHOD); an alpha be 93.05
PRK05320257 rhodanese superfamily protein; Provisional 92.95
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 92.91
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 92.85
KOG0343|consensus 758 92.83
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 92.82
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 92.8
cd0153292 4RHOD_Repeat_1 Member of the Rhodanese Homology Do 92.77
cd00032 243 CASc Caspase, interleukin-1 beta converting enzyme 92.71
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 92.59
cd01525105 RHOD_Kc Member of the Rhodanese Homology Domain su 92.44
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 92.29
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 92.08
cd01447103 Polysulfide_ST Polysulfide-sulfurtransferase - Rho 91.9
KOG0329|consensus 387 91.75
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 91.5
PRK12904 830 preprotein translocase subunit SecA; Reviewed 91.41
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 91.33
smart00487201 DEXDc DEAD-like helicases superfamily. 91.07
KOG0342|consensus 543 91.06
PRK02362 737 ski2-like helicase; Provisional 90.73
KOG0350|consensus 620 90.66
cd01535145 4RHOD_Repeat_4 Member of the Rhodanese Homology Do 90.64
COG1205 851 Distinct helicase family with a unique C-terminal 90.58
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 90.35
smart00487201 DEXDc DEAD-like helicases superfamily. 90.31
PRK01415247 hypothetical protein; Validated 90.1
PRK13767 876 ATP-dependent helicase; Provisional 90.03
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 89.91
PF02602231 HEM4: Uroporphyrinogen-III synthase HemD; InterPro 89.91
KOG0340|consensus 442 89.89
PF01751100 Toprim: Toprim domain; InterPro: IPR006171 This is 89.87
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 89.71
KOG4439|consensus901 89.63
PF0214295 MGS: MGS-like domain This is a subfamily of this f 89.29
cd01445138 TST_Repeats Thiosulfate sulfurtransferases (TST) c 89.27
cd06578239 HemD Uroporphyrinogen-III synthase (HemD) catalyze 88.85
PRK10287104 thiosulfate:cyanide sulfurtransferase; Provisional 88.66
PRK00254 720 ski2-like helicase; Provisional 88.58
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 88.43
smart0085190 MGS MGS-like domain. This domain composes the whol 88.26
PRK05928249 hemD uroporphyrinogen-III synthase; Reviewed 88.24
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 88.15
PRK05298 652 excinuclease ABC subunit B; Provisional 88.13
KOG0345|consensus 567 88.05
PTZ00424 401 helicase 45; Provisional 87.95
KOG0335|consensus 482 87.87
KOG0348|consensus 708 87.81
PRK00162108 glpE thiosulfate sulfurtransferase; Validated 87.77
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 87.46
PLN02160136 thiosulfate sulfurtransferase 87.45
PRK05752255 uroporphyrinogen-III synthase; Validated 87.4
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 87.21
PRK00142314 putative rhodanese-related sulfurtransferase; Prov 87.15
KOG4284|consensus 980 87.14
TIGR00696177 wecB_tagA_cpsF bacterial polymer biosynthesis prot 87.14
cd01530121 Cdc25 Cdc25 phosphatases are members of the Rhodan 87.06
TIGR02981101 phageshock_pspE phage shock operon rhodanese PspE. 86.88
KOG0386|consensus 1157 86.51
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 86.49
KOG0951|consensus 1674 86.48
PF11019252 DUF2608: Protein of unknown function (DUF2608); In 86.43
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 86.22
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 86.16
PRK06827382 phosphoribosylpyrophosphate synthetase; Provisiona 86.14
KOG0352|consensus 641 86.12
KOG1015|consensus 1567 85.82
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 85.39
KOG0346|consensus 569 84.82
PLN02723320 3-mercaptopyruvate sulfurtransferase 84.64
PRK12326 764 preprotein translocase subunit SecA; Reviewed 84.46
smart00492141 HELICc3 helicase superfamily c-terminal domain. 84.43
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 84.15
PRK09189240 uroporphyrinogen-III synthase; Validated 84.09
KOG0351|consensus 941 84.02
cd06533171 Glyco_transf_WecG_TagA The glycosyltransferase Wec 83.89
smart0049376 TOPRIM topoisomerases, DnaG-type primases, OLD fam 83.49
PF03808172 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/Cp 83.47
cd01446132 DSP_MapKP N-terminal regulatory rhodanese domain o 83.32
KOG0341|consensus 610 82.83
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 82.26
COG1204 766 Superfamily II helicase [General function predicti 82.17
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 81.95
PRK15327 393 type III secretion system needle complex protein P 81.91
PRK09860 383 putative alcohol dehydrogenase; Provisional 81.84
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 81.63
PRK13958207 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 81.18
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 80.98
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 80.78
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 80.65
KOG0384|consensus 1373 80.15
TIGR03167 311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 80.13
>KOG0328|consensus Back     alignment and domain information
Probab=100.00  E-value=9.3e-33  Score=189.81  Aligned_cols=140  Identities=32%  Similarity=0.583  Sum_probs=133.3

Q ss_pred             CHHHHHhhCCCCCeEEEEEecCchhHHHHHHHhccCCcEEEcC-CcccCCCeEEEEEEcCc-cchHHHHHHHHhhCCCCc
Q psy13287          1 MLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLM-EELTLKGVTQYYAFVQE-RQKVHCLNTLFSKLQINQ   78 (140)
Q Consensus         1 ~l~~il~~~~~~~q~v~~SAT~~~~~~~~~~~~~~~~~~i~~~-~~~~~~~i~~~~~~~~~-~~k~~~l~~ll~~~~~~~   78 (140)
                      |+.+|.+++|++.|.+++|||+|..+.+....++.+|..+-++ ++...+.+.++|+.++. ++|.+.|+++...+...|
T Consensus       189 Qiydiyr~lp~~~Qvv~~SATlp~eilemt~kfmtdpvrilvkrdeltlEgIKqf~v~ve~EewKfdtLcdLYd~LtItQ  268 (400)
T KOG0328|consen  189 QIYDIYRYLPPGAQVVLVSATLPHEILEMTEKFMTDPVRILVKRDELTLEGIKQFFVAVEKEEWKFDTLCDLYDTLTITQ  268 (400)
T ss_pred             HHHHHHHhCCCCceEEEEeccCcHHHHHHHHHhcCCceeEEEecCCCchhhhhhheeeechhhhhHhHHHHHhhhhehhe
Confidence            5778999999999999999999999999999999999999888 56788889999999975 569999999999999999


Q ss_pred             EEEEeCchHHHHHHHHHHHhcCceEEEEecCCCHHHHHHHHHHhhcCCccEEEEecccCCCC
Q psy13287         79 SIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSGDSSAMM  140 (140)
Q Consensus        79 ~lIF~~t~~~~~~~~~~L~~~~~~v~~~h~~~~~~~R~~~~~~f~~g~~~vlv~T~~~~rGl  140 (140)
                      ++|||||++.++++.+.+++.++.|..+||+|++++|.+++++||.|+.+||+|||+-||||
T Consensus       269 avIFcnTk~kVdwLtekm~~~nftVssmHGDm~qkERd~im~dFRsg~SrvLitTDVwaRGi  330 (400)
T KOG0328|consen  269 AVIFCNTKRKVDWLTEKMREANFTVSSMHGDMEQKERDKIMNDFRSGKSRVLITTDVWARGI  330 (400)
T ss_pred             EEEEecccchhhHHHHHHHhhCceeeeccCCcchhHHHHHHHHhhcCCceEEEEechhhccC
Confidence            99999999999999999999999999999999999999999999999999999999999997



>KOG0326|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>smart00115 CASc Caspase, interleukin-1 beta converting enzyme (ICE) homologues Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 Back     alignment and domain information
>cd00032 CASc Caspase, interleukin-1 beta converting enzyme (ICE) homologues; Cysteine-dependent aspartate-directed proteases that mediate programmed cell death (apoptosis) Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02602 HEM4: Uroporphyrinogen-III synthase HemD; InterPro: IPR003754 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway [] Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PF01751 Toprim: Toprim domain; InterPro: IPR006171 This is a conserved region from DNA primase Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>PF02142 MGS: MGS-like domain This is a subfamily of this family; InterPro: IPR011607 This domain composes the whole protein of methylglyoxal synthetase and the domain is also found in carbamoyl phosphate synthetase (CPS) where it forms a regulatory domain that binds to the allosteric effector ornithine Back     alignment and domain information
>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain Back     alignment and domain information
>cd06578 HemD Uroporphyrinogen-III synthase (HemD) catalyzes the asymmetrical cyclization of tetrapyrrole (linear) to uroporphyrinogen-III, the fourth step in the biosynthesis of heme Back     alignment and domain information
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>smart00851 MGS MGS-like domain Back     alignment and domain information
>PRK05928 hemD uroporphyrinogen-III synthase; Reviewed Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>PRK00162 glpE thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>PRK05752 uroporphyrinogen-III synthase; Validated Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>TIGR00696 wecB_tagA_cpsF bacterial polymer biosynthesis proteins, WecB/TagA/CpsF family Back     alignment and domain information
>cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>PRK06827 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>PRK09189 uroporphyrinogen-III synthase; Validated Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>cd06533 Glyco_transf_WecG_TagA The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins Back     alignment and domain information
>smart00493 TOPRIM topoisomerases, DnaG-type primases, OLD family nucleases and RecR proteins Back     alignment and domain information
>PF03808 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/CpsF family; InterPro: IPR004629 The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in Enterobacterial common antigen (eca) synthesis in Escherichia coli Back     alignment and domain information
>cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK15327 type III secretion system needle complex protein PrgH; Provisional Back     alignment and domain information
>PRK09860 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 4e-57
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 1e-48
2vso_A395 Crystal Structure Of A Translation Initiation Compl 1e-18
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 3e-18
2hyi_C413 Structure Of The Human Exon Junction Complex With A 4e-18
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 4e-18
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 4e-18
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 4e-18
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 5e-18
1fuu_A394 Yeast Initiation Factor 4a Length = 394 7e-18
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 3e-16
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 4e-16
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 1e-14
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 2e-14
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 2e-14
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 2e-14
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 8e-13
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 9e-13
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 9e-13
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 9e-13
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 2e-11
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 7e-10
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 9e-10
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 1e-09
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 9e-07
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 2e-06
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 5e-06
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 7e-06
3i32_A 300 Dimeric Structure Of A Hera Helicase Fragment Inclu 9e-06
3eaq_A 212 Novel Dimerization Motif In The Dead Box Rna Helica 3e-05
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 6e-05
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 1e-04
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 1e-04
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 1e-04
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 3e-04
2jgn_A185 Ddx3 Helicase Domain Length = 185 3e-04
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 7e-04
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 7e-04
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure

Iteration: 1

Score = 216 bits (550), Expect = 4e-57, Method: Compositional matrix adjust. Identities = 100/133 (75%), Positives = 113/133 (84%) Query: 1 MLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQE 60 +++ ++S LP Q LL+SATFPLTVK FM KHL PYEINLMEELTLKG+TQYYAFV+E Sbjct: 183 IIEQILSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEINLMEELTLKGITQYYAFVEE 242 Query: 61 RQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFH 120 RQK+HCLNTLFSKLQINQ+IIFCNST RVELLAKKIT+LGY CYY HARM Q RN+VFH Sbjct: 243 RQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFH 302 Query: 121 DFRSGLCRNLVCS 133 +FR G R LVCS Sbjct: 303 EFRQGKVRTLVCS 315
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 9e-72
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 1e-63
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 1e-63
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 4e-62
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 5e-62
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 7e-54
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 6e-51
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 4e-42
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 1e-39
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 6e-39
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 9e-38
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 4e-35
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 5e-25
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 7e-25
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 3e-24
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 5e-24
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 1e-23
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 5e-20
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 4e-19
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 1e-16
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 2e-14
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 8e-14
3eaq_A 212 Heat resistant RNA dependent ATPase; DEAD box RNA 5e-13
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 1e-12
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-12
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 2e-12
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 1e-11
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 1e-10
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 5e-10
3bor_A237 Human initiation factor 4A-II; translation initiat 2e-09
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 6e-08
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 7e-08
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 2e-07
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 3e-07
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 3e-07
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 8e-07
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 1e-06
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 5e-06
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 1e-04
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 3e-04
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
 Score =  218 bits (559), Expect = 9e-72
 Identities = 102/141 (72%), Positives = 112/141 (79%), Gaps = 8/141 (5%)

Query: 1   MLD--------HVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVT 52
           ML          ++S LP   Q LL+SATFPLTVK FM KHL  PYEINLMEELTLKG+T
Sbjct: 175 MLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEINLMEELTLKGIT 234

Query: 53  QYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQ 112
           QYYAFV+ERQK+HCLNTLFSKLQINQ+IIFCNST RVELLAKKIT+LGY CYY HARM Q
Sbjct: 235 QYYAFVEERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQ 294

Query: 113 AHRNRVFHDFRSGLCRNLVCS 133
             RN+VFH+FR G  R LVCS
Sbjct: 295 QERNKVFHEFRQGKVRTLVCS 315


>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.94
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.92
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.92
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.92
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.92
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.92
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.91
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.91
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.89
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.88
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.88
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.88
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.88
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.87
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.87
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.87
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.87
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.87
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.86
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.85
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.85
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.85
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.83
3eaq_A 212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.82
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.82
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.67
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.79
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.77
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.75
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.74
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.74
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.72
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.72
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.72
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.7
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.7
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.7
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.69
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.69
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.69
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.67
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.66
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.66
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.66
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.65
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.64
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.63
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.63
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.63
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.63
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.62
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.61
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.59
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.58
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.58
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.58
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.57
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.55
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 99.53
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.52
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.52
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.48
3h1t_A590 Type I site-specific restriction-modification syst 99.47
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.47
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.47
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.43
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.23
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 99.14
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.04
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 98.95
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 98.12
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 97.96
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 97.89
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 97.87
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 97.87
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 97.63
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 97.63
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 97.49
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 97.41
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 97.3
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 97.22
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 97.22
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 97.11
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 97.05
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 96.73
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 96.65
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 96.63
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 96.33
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 96.31
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 96.08
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 96.05
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 95.94
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 95.75
3bor_A237 Human initiation factor 4A-II; translation initiat 95.72
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 95.7
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 95.7
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 95.67
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 95.56
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 95.51
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 95.41
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 95.38
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 95.36
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 95.36
3foj_A100 Uncharacterized protein; protein SSP1007, structur 95.24
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 95.2
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 95.13
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 95.07
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 95.03
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 94.92
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 94.92
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 94.77
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 94.7
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 94.68
3hgt_A 328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 94.67
2l82_A162 Designed protein OR32; structural genomics, northe 94.61
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 94.6
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 94.59
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 94.56
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 94.53
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 94.53
2jtq_A85 Phage shock protein E; solution structure rhodanes 94.47
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 94.38
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 94.29
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 94.2
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 93.91
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 93.89
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 93.81
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 93.77
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 93.48
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 93.45
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 93.36
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 93.35
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 93.33
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 93.1
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 92.95
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 92.93
4gl2_A 699 Interferon-induced helicase C domain-containing P; 92.9
1tq1_A129 AT5G66040, senescence-associated family protein; C 92.9
3b6e_A216 Interferon-induced helicase C domain-containing P; 92.9
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 92.58
3h11_B 271 Caspase-8; cell death, apoptosis, caspase, alterna 92.47
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 92.33
2h54_A178 Caspase-1; allosteric site, dimer interface, hydro 91.91
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 91.73
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 91.54
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 91.48
1vee_A134 Proline-rich protein family; hypothetical protein, 91.31
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 91.12
3e4c_A 302 Caspase-1; zymogen, inflammasome, ICE, IL-1B, inna 90.99
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 90.78
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 90.7
1qtn_A164 Caspase-8; apoptosis, dithiane-DIOL, caspase, cyst 90.66
3hjh_A 483 Transcription-repair-coupling factor; MFD, mutatio 90.47
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 90.46
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 90.12
1pyo_A167 Caspase-2; apoptosis, caspase, alpha-beta, thiol p 89.64
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 89.53
3h11_A 272 CAsp8 and FADD-like apoptosis regulator; cell deat 89.18
2dko_A146 Caspase-3; low barrier hydrogen bond, caspase, dru 89.05
3od5_A 278 Caspase-6; caspase domain, apoptotic protease, hyd 88.47
1m72_A 272 Caspase-1; caspase, cysteine protease, hydrolase-h 88.21
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 87.88
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 87.86
3sir_A 259 Caspase; hydrolase; 2.68A {Drosophila melanogaster 87.83
3p45_A179 Caspase-6; protease, huntington'S disease, physio 87.78
2j32_A 250 Caspase-3; Pro-caspase3, thiol protease, hydrolase 87.61
3tg1_B158 Dual specificity protein phosphatase 10; kinase/rh 87.61
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 86.68
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 86.58
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 86.38
1urh_A 280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 86.26
2fp3_A 316 Caspase NC; apoptosis, initiator caspase activatio 86.11
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 86.08
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 85.68
2ql9_A173 Caspase-7; cysteine protease, apoptosis, thiol pro 85.53
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 85.48
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 85.43
2nn3_C 310 Caspase-1; cysteine protease, hydrolase; 3.00A {Sp 85.36
4ehd_A 277 Caspase-3; caspase, apoptosis, allosteric inhibiti 85.33
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 85.31
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 85.16
3hzu_A 318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 84.96
1nw9_B 277 Caspase 9, apoptosis-related cysteine protease; XI 84.36
1e0c_A 271 Rhodanese, sulfurtransferase; sulfur metabolism, t 84.24
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 83.88
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 83.61
2eg4_A 230 Probable thiosulfate sulfurtransferase; structural 83.42
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 82.79
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 82.66
1uar_A 285 Rhodanese; sulfurtransferase, riken structural gen 82.3
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 82.15
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 82.14
2wlr_A 423 Putative thiosulfate sulfurtransferase YNJE; rhoda 81.95
1f1j_A 305 Caspase-7 protease; caspase-7, cysteine protease, 81.81
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 81.67
3aay_A 277 Putative thiosulfate sulfurtransferase; sulfurtran 81.16
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 80.29
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 80.15
2ouc_A142 Dual specificity protein phosphatase 10; rhodanese 80.09
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=99.94  E-value=2.4e-25  Score=164.83  Aligned_cols=138  Identities=22%  Similarity=0.310  Sum_probs=125.0

Q ss_pred             HHHHHhhC--CCCCeEEEEEecCchhHHHHHHHhccCCcEEEcC-CcccCCCeEEEEEEcCccchHHHHHHHHhhCCCCc
Q psy13287          2 LDHVISIL--PHERQILLYSATFPLTVKNFMEKHLKDPYEINLM-EELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQ   78 (140)
Q Consensus         2 l~~il~~~--~~~~q~v~~SAT~~~~~~~~~~~~~~~~~~i~~~-~~~~~~~i~~~~~~~~~~~k~~~l~~ll~~~~~~~   78 (140)
                      +.+|+..+  +++.|++++|||+|+.+..+...++.++..+.+. ......++.+.+..+....|...|.+++..... +
T Consensus       224 ~~~i~~~~~~~~~~q~l~~SAT~~~~~~~~~~~~l~~~~~i~~~~~~~~~~~i~~~~~~~~~~~k~~~l~~~l~~~~~-~  302 (434)
T 2db3_A          224 MRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQAD-G  302 (434)
T ss_dssp             HHHHHHCTTSCSSCEEEEEESCCCHHHHHHHHTTCSSCEEEEESSTTCCCTTEEEEEEECCGGGHHHHHHHHHHHCCT-T
T ss_pred             HHHHHHhcCCCCCceEEEEeccCCHHHHHHHHHhccCCEEEEeccccccccccceEEEEeCcHHHHHHHHHHHHhCCC-C
Confidence            45666664  5689999999999999999999999998888776 445678899999999999999999999988654 4


Q ss_pred             EEEEeCchHHHHHHHHHHHhcCceEEEEecCCCHHHHHHHHHHhhcCCccEEEEecccCCCC
Q psy13287         79 SIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSGDSSAMM  140 (140)
Q Consensus        79 ~lIF~~t~~~~~~~~~~L~~~~~~v~~~h~~~~~~~R~~~~~~f~~g~~~vlv~T~~~~rGl  140 (140)
                      +||||++++.++.+++.|++.++.+..+||++++.+|..++++|++|+.+||||||+++||+
T Consensus       303 ~lVF~~t~~~a~~l~~~L~~~~~~~~~lhg~~~~~~R~~~l~~F~~g~~~vLvaT~v~~rGl  364 (434)
T 2db3_A          303 TIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGL  364 (434)
T ss_dssp             EEEECSSHHHHHHHHHHHHHTTCCEEEESTTSCHHHHHHHHHHHHTSSCSEEEECGGGTSSC
T ss_pred             EEEEEeCcHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHHHcCCCcEEEEchhhhCCC
Confidence            99999999999999999999999999999999999999999999999999999999999996



>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>2l82_A Designed protein OR32; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} Back     alignment and structure
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3h11_B Caspase-8; cell death, apoptosis, caspase, alternative splicing, HOST- virus interaction, polymorphism, cytoplasm, disease mutation; 1.90A {Homo sapiens} SCOP: c.17.1.1 PDB: 2k7z_A 1i4e_B 2fun_B 2c2z_B* Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2h54_A Caspase-1; allosteric site, dimer interface, hydrolase; HET: PHQ; 1.80A {Homo sapiens} PDB: 1rwm_A* 1rwk_A* 1rwo_A* 1rwp_A* 1rwv_A* 1rww_A* 1rwn_A* 2h48_A* 2h4w_A* 1rwx_A* 2hbq_A* 2hby_A* 1ibc_A 3d6m_A* 2h4y_A* 2h51_A* 3d6f_A* 3d6h_A* 2hbz_A* 2hbr_A* ... Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Back     alignment and structure
>3e4c_A Caspase-1; zymogen, inflammasome, ICE, IL-1B, innate immunity, apoptosis, hydrolase, protease protease; 2.05A {Homo sapiens} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1qtn_A Caspase-8; apoptosis, dithiane-DIOL, caspase, cysteine-protease, hydrol hydrolase inhibitor complex; 1.20A {Homo sapiens} SCOP: c.17.1.1 PDB: 3kjn_A* 3kjq_A* 2y1l_A 2c2z_A 1qdu_A* 1f9e_A* Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1pyo_A Caspase-2; apoptosis, caspase, alpha-beta, thiol protease, hydrolase-HY inhibitor complex; 1.65A {Homo sapiens} SCOP: c.17.1.1 PDB: 3rjm_A* 2p2c_A 3r5j_A 3r6g_A 3r6l_A 3r7b_A 3r7n_A 3r7s_A Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3h11_A CAsp8 and FADD-like apoptosis regulator; cell death, apoptosis, caspase, alternative splicing, HOST- virus interaction, polymorphism, cytoplasm, disease mutation; 1.90A {Homo sapiens} PDB: 3h13_A Back     alignment and structure
>2dko_A Caspase-3; low barrier hydrogen bond, caspase, drug design, radiation D tetrahedral intermediate, protease; 1.06A {Homo sapiens} PDB: 1nme_A 2h5i_A 2h5j_A 2h65_A 2xyg_A* 2xyh_A 2xyp_A* 2xzd_A 2xzt_A 2y0b_A 3edq_A 1gfw_A 1re1_A* 1pau_A* 1rhk_A* 1rhm_A* 1rhq_A* 1rhr_A* 1rhu_A* 1rhj_A* ... Back     alignment and structure
>3od5_A Caspase-6; caspase domain, apoptotic protease, hydrolase-hydrolase INHI complex; 1.60A {Homo sapiens} SCOP: c.17.1.0 PDB: 3k7e_A 3s70_A 3v6m_A 3v6l_A 3nr2_A 4fxo_A 2wdp_A 3nkf_A 3s8e_A 4ejf_A 3qnw_A* 3p4u_A* 3p45_B 3qnw_B* 3p4u_B* Back     alignment and structure
>1m72_A Caspase-1; caspase, cysteine protease, hydrolase-hydrolase inhibitor CO; 2.30A {Spodoptera frugiperda} SCOP: c.17.1.1 PDB: 3sip_B Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3sir_A Caspase; hydrolase; 2.68A {Drosophila melanogaster} PDB: 3sip_A Back     alignment and structure
>3p45_A Caspase-6; protease, huntington'S disease, physio PH, competitive inhibition, hydrolase; 2.53A {Homo sapiens} Back     alignment and structure
>2j32_A Caspase-3; Pro-caspase3, thiol protease, hydrolase, hydrolase-hydrolase inhibitor complex; 1.30A {Homo sapiens} PDB: 2j30_A 3h0e_A* 2j33_A 3pd1_A 2j31_A 3pcx_A 1nms_A* 1nmq_A* 3deh_A* 3dei_A* 3dej_A* 3dek_A* 3pd0_A 3itn_A 1qx3_A Back     alignment and structure
>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>2fp3_A Caspase NC; apoptosis, initiator caspase activation, dimerization, active site conformation, hydrolysis/apoptosis complex; 2.50A {Drosophila melanogaster} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2ql9_A Caspase-7; cysteine protease, apoptosis, thiol protease, zymogen, hydro hydrolase inhibitor complex; HET: CIT; 2.14A {Homo sapiens} PDB: 2ql7_A* 2ql5_A* 2qlb_A* 2qlf_A 2qlj_A* 3edr_A 3ibc_A 3ibf_A 1i51_A Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>2nn3_C Caspase-1; cysteine protease, hydrolase; 3.00A {Spodoptera frugiperda} Back     alignment and structure
>4ehd_A Caspase-3; caspase, apoptosis, allosteric inhibition; 1.58A {Homo sapiens} PDB: 4ehk_A 4ehf_A 4ehn_A 1cp3_A 4ehh_A 4eha_A 4ehl_A 1i3o_A Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>1nw9_B Caspase 9, apoptosis-related cysteine protease; XIAP, caspase inhibition, caspase activation, dimerization; 2.40A {Homo sapiens} SCOP: c.17.1.1 PDB: 1jxq_A* 2ar9_A Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>1f1j_A Caspase-7 protease; caspase-7, cysteine protease, hydrolase, apoptosis, hydrolas hydrolase inhibitor complex; 2.35A {Homo sapiens} SCOP: c.17.1.1 PDB: 1kmc_A 3r5k_A 1i4o_A 1gqf_A 3h1p_A 1shj_A* 1k86_A 1k88_A 1shl_A* Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 140
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 4e-10
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 5e-10
d1s2ma2171 c.37.1.19 (A:252-422) Putative ATP-dependent RNA h 6e-10
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 8e-10
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 1e-08
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 2e-08
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 2e-08
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 3e-08
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 4e-08
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 5e-08
d1gkub2 248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 1e-07
d1a1va2 299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 2e-07
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 6e-07
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 3e-06
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 5e-06
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 5e-06
d1oywa3 200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 5e-05
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 3e-04
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 8e-04
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 0.001
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative ATP-dependent RNA helicase DHH1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 53.1 bits (126), Expect = 4e-10
 Identities = 28/42 (66%), Positives = 32/42 (76%)

Query: 3   DHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLME 44
           + ++S LP   Q LL+SATFPLTVK FM KHL  PYEINLME
Sbjct: 165 EQILSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEINLME 206


>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.91
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.9
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.9
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.9
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.89
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.89
d1oywa3 200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.85
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.83
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.82
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.69
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.63
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 99.61
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.54
d2eyqa5 211 Transcription-repair coupling factor, TRCF {Escher 99.51
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.44
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 99.43
d1gm5a4 206 RecG helicase domain {Thermotoga maritima [TaxId: 99.35
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.33
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.18
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.03
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.97
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.8
d1nkta4 219 Translocation ATPase SecA, nucleotide-binding doma 98.21
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 98.03
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 97.84
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 96.5
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 96.36
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 95.58
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 95.33
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 95.32
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 94.81
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 94.72
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 94.72
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 94.68
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 94.54
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 94.35
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 94.26
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 93.59
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 93.48
d2b2na1 308 Transcription-repair coupling factor, TRCF {Escher 93.13
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 92.98
d1yt8a1136 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 92.97
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 91.95
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 91.3
g1pyo.1 257 Caspase-2 {Human (Homo sapiens) [TaxId: 9606]} 91.3
d1yt8a2101 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 90.74
d1e0ca2136 Sulfurtransferase {Azotobacter vinelandii [TaxId: 90.66
g1qtn.1 242 Caspase-8 {Human (Homo sapiens) [TaxId: 9606]} 90.23
d2eyqa2117 Transcription-repair coupling factor, TRCF {Escher 89.92
d1okga1156 3-mercaptopyruvate sulfurtransferase {Leishmania m 88.62
d1m72a_ 256 Caspase-1 {Fall armyworm (Spodoptera frugiperda) [ 87.4
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 86.8
d1piia1198 N-(5'phosphoribosyl)antranilate isomerase, PRAI {E 86.7
g1nme.1 238 Apopain (caspase-3, cpp32) {Human (Homo sapiens) [ 86.48
d1yt8a3157 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 86.25
d1edoa_ 244 beta-keto acyl carrier protein reductase {Oil seed 86.15
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 86.03
d1uara2141 Sulfurtransferase {Thermus thermophilus [TaxId: 27 85.72
d1rrma_ 385 Lactaldehyde reductase FucO {Escherichia coli [Tax 85.59
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 85.41
d1urha1147 3-mercaptopyruvate sulfurtransferase {Escherichia 84.06
d2bd0a1 240 Bacterial sepiapterin reductase {Chlorobium tepidu 84.06
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 83.84
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 83.54
d1f1ja_ 245 Caspase-7 {Human (Homo sapiens) [TaxId: 9606]} 83.23
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 83.07
d1vlja_ 398 NADH-dependent butanol dehydrogenase A (TM0820) {T 82.87
d1byka_ 255 Trehalose repressor, C-terminal domain {Escherichi 82.18
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 81.45
d1u9ya2129 Phosphoribosylpyrophosphate synthetase {Methanocal 81.22
d1uara1143 Sulfurtransferase {Thermus thermophilus [TaxId: 27 81.2
d1nw9b_ 277 Caspase-9 {Human (Homo sapiens) [TaxId: 9606]} 80.65
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative ATP-dependent RNA helicase DHH1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.91  E-value=1.2e-23  Score=136.72  Aligned_cols=94  Identities=74%  Similarity=1.194  Sum_probs=91.1

Q ss_pred             cCCCeEEEEEEcCccchHHHHHHHHhhCCCCcEEEEeCchHHHHHHHHHHHhcCceEEEEecCCCHHHHHHHHHHhhcCC
Q psy13287         47 TLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGL  126 (140)
Q Consensus        47 ~~~~i~~~~~~~~~~~k~~~l~~ll~~~~~~~~lIF~~t~~~~~~~~~~L~~~~~~v~~~h~~~~~~~R~~~~~~f~~g~  126 (140)
                      ...++.|+|+.+++.+|...|.++++..+..++||||+|++.++.++..|+..|+.+..+||++++++|..++++|++|+
T Consensus         3 tl~~i~q~yi~v~~~~K~~~L~~ll~~~~~~k~iVF~~~~~~~~~l~~~L~~~g~~~~~~h~~~~~~~r~~~~~~f~~~~   82 (171)
T d1s2ma2           3 TLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGK   82 (171)
T ss_dssp             BCTTEEEEEEECCGGGHHHHHHHHHHHSCCSEEEEECSSHHHHHHHHHHHHHHTCCEEEECTTSCHHHHHHHHHHHHTTS
T ss_pred             CccceEEEEEEcCHHHHHHHHHHHHHhCCCCceEEEEeeeehhhHhHHhhhcccccccccccccchhhhhhhhhhcccCc
Confidence            56789999999999999999999999988899999999999999999999999999999999999999999999999999


Q ss_pred             ccEEEEecccCCCC
Q psy13287        127 CRNLVCSGDSSAMM  140 (140)
Q Consensus       127 ~~vlv~T~~~~rGl  140 (140)
                      .++|||||+++||+
T Consensus        83 ~~ilv~Td~~~~Gi   96 (171)
T d1s2ma2          83 VRTLVCSDLLTRGI   96 (171)
T ss_dssp             SSEEEESSCSSSSC
T ss_pred             cccccchhHhhhcc
Confidence            99999999999996



>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b2na1 c.37.1.19 (A:26-333) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2eyqa2 c.37.1.19 (A:349-465) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1m72a_ c.17.1.1 (A:) Caspase-1 {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1piia1 c.1.2.4 (A:255-452) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rrma_ e.22.1.2 (A:) Lactaldehyde reductase FucO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1f1ja_ c.17.1.1 (A:) Caspase-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vlja_ e.22.1.2 (A:) NADH-dependent butanol dehydrogenase A (TM0820) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u9ya2 c.61.1.2 (A:156-284) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nw9b_ c.17.1.1 (B:) Caspase-9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure