Psyllid ID: psy13287
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 140 | ||||||
| 156547575 | 445 | PREDICTED: putative ATP-dependent RNA he | 0.95 | 0.298 | 0.947 | 2e-71 | |
| 158299881 | 430 | AGAP009135-PA [Anopheles gambiae str. PE | 0.95 | 0.309 | 0.947 | 3e-70 | |
| 312377194 | 415 | hypothetical protein AND_11577 [Anophele | 0.95 | 0.320 | 0.947 | 3e-70 | |
| 332020362 | 444 | Putative ATP-dependent RNA helicase me31 | 0.95 | 0.299 | 0.939 | 4e-70 | |
| 340728954 | 444 | PREDICTED: putative ATP-dependent RNA he | 0.95 | 0.299 | 0.939 | 4e-70 | |
| 328783051 | 444 | PREDICTED: putative ATP-dependent RNA he | 0.95 | 0.299 | 0.939 | 4e-70 | |
| 383858347 | 444 | PREDICTED: putative ATP-dependent RNA he | 0.95 | 0.299 | 0.939 | 4e-70 | |
| 307168696 | 443 | Putative ATP-dependent RNA helicase me31 | 0.95 | 0.300 | 0.939 | 5e-70 | |
| 242014232 | 460 | DEAD box ATP-dependent RNA helicase, put | 0.95 | 0.289 | 0.932 | 6e-70 | |
| 307206923 | 435 | Putative ATP-dependent RNA helicase me31 | 0.95 | 0.305 | 0.939 | 6e-70 |
| >gi|156547575|ref|XP_001602897.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like isoform 1 [Nasonia vitripennis] gi|345485131|ref|XP_003425200.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 273 bits (698), Expect = 2e-71, Method: Compositional matrix adjust.
Identities = 126/133 (94%), Positives = 131/133 (98%)
Query: 1 MLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQE 60
MLDHVIS LPHERQILLYSATFPLTVK FMEKHL+DPYEINLMEELTLKGVTQYYAFVQE
Sbjct: 217 MLDHVISRLPHERQILLYSATFPLTVKQFMEKHLRDPYEINLMEELTLKGVTQYYAFVQE 276
Query: 61 RQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFH 120
RQKVHCLNTLFSKLQINQSIIFCN+TQRVELLAKKIT+LGYCCYYIHA+MAQAHRNRVFH
Sbjct: 277 RQKVHCLNTLFSKLQINQSIIFCNTTQRVELLAKKITDLGYCCYYIHAKMAQAHRNRVFH 336
Query: 121 DFRSGLCRNLVCS 133
DFR+GLCRNLVCS
Sbjct: 337 DFRAGLCRNLVCS 349
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|158299881|ref|XP_319893.3| AGAP009135-PA [Anopheles gambiae str. PEST] gi|157013731|gb|EAA14695.3| AGAP009135-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|312377194|gb|EFR24088.1| hypothetical protein AND_11577 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|332020362|gb|EGI60783.1| Putative ATP-dependent RNA helicase me31b [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|340728954|ref|XP_003402776.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like [Bombus terrestris] gi|350412268|ref|XP_003489590.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|328783051|ref|XP_624586.2| PREDICTED: putative ATP-dependent RNA helicase me31b-like isoform 1 [Apis mellifera] gi|380013249|ref|XP_003690677.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|383858347|ref|XP_003704663.1| PREDICTED: putative ATP-dependent RNA helicase me31b-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|307168696|gb|EFN61728.1| Putative ATP-dependent RNA helicase me31b [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|242014232|ref|XP_002427795.1| DEAD box ATP-dependent RNA helicase, putative [Pediculus humanus corporis] gi|212512264|gb|EEB15057.1| DEAD box ATP-dependent RNA helicase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|307206923|gb|EFN84769.1| Putative ATP-dependent RNA helicase me31b [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 140 | ||||||
| FB|FBgn0004419 | 459 | me31B "maternal expression at | 0.95 | 0.289 | 0.924 | 4.7e-64 | |
| WB|WBGene00000479 | 430 | cgh-1 [Caenorhabditis elegans | 0.95 | 0.309 | 0.812 | 1.2e-56 | |
| UNIPROTKB|Q95YF3 | 430 | cgh-1 "ATP-dependent RNA helic | 0.95 | 0.309 | 0.812 | 1.2e-56 | |
| ZFIN|ZDB-GENE-030131-6611 | 483 | wu:fk48d07 "wu:fk48d07" [Danio | 0.95 | 0.275 | 0.781 | 6.8e-56 | |
| ZFIN|ZDB-GENE-070912-83 | 485 | ddx6 "DEAD (Asp-Glu-Ala-Asp) b | 0.95 | 0.274 | 0.781 | 3.7e-55 | |
| UNIPROTKB|E1C8R1 | 483 | DDX6 "Probable ATP-dependent R | 0.95 | 0.275 | 0.781 | 6.1e-55 | |
| UNIPROTKB|Q5ZKB9 | 483 | DDX6 "Probable ATP-dependent R | 0.95 | 0.275 | 0.781 | 6.1e-55 | |
| UNIPROTKB|E1BDM8 | 483 | DDX6 "Uncharacterized protein" | 0.95 | 0.275 | 0.781 | 6.1e-55 | |
| UNIPROTKB|E2RR01 | 483 | DDX6 "Uncharacterized protein" | 0.95 | 0.275 | 0.781 | 6.1e-55 | |
| UNIPROTKB|P26196 | 483 | DDX6 "Probable ATP-dependent R | 0.95 | 0.275 | 0.781 | 6.1e-55 |
| FB|FBgn0004419 me31B "maternal expression at 31B" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 653 (234.9 bits), Expect = 4.7e-64, P = 4.7e-64
Identities = 123/133 (92%), Positives = 128/133 (96%)
Query: 1 MLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVTQYYAFVQE 60
MLDHVI LP + QILL+SATFPLTVKNFMEKHL++PYEINLMEELTLKGVTQYYAFVQE
Sbjct: 220 MLDHVILKLPKDPQILLFSATFPLTVKNFMEKHLREPYEINLMEELTLKGVTQYYAFVQE 279
Query: 61 RQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFH 120
RQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHA+MAQAHRNRVFH
Sbjct: 280 RQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHAKMAQAHRNRVFH 339
Query: 121 DFRSGLCRNLVCS 133
DFR GLCRNLVCS
Sbjct: 340 DFRQGLCRNLVCS 352
|
|
| WB|WBGene00000479 cgh-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q95YF3 cgh-1 "ATP-dependent RNA helicase cgh-1" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-6611 wu:fk48d07 "wu:fk48d07" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070912-83 ddx6 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 6" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C8R1 DDX6 "Probable ATP-dependent RNA helicase DDX6" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZKB9 DDX6 "Probable ATP-dependent RNA helicase DDX6" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BDM8 DDX6 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RR01 DDX6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P26196 DDX6 "Probable ATP-dependent RNA helicase DDX6" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 140 | |||
| COG0513 | 513 | COG0513, SrmB, Superfamily II DNA and RNA helicase | 2e-34 | |
| PTZ00424 | 401 | PTZ00424, PTZ00424, helicase 45; Provisional | 1e-22 | |
| PRK11776 | 460 | PRK11776, PRK11776, ATP-dependent RNA helicase Dbp | 1e-14 | |
| PRK10590 | 456 | PRK10590, PRK10590, ATP-dependent RNA helicase Rhl | 2e-14 | |
| cd00079 | 131 | cd00079, HELICc, Helicase superfamily c-terminal d | 8e-14 | |
| cd00268 | 203 | cd00268, DEADc, DEAD-box helicases | 5e-11 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 4e-09 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 2e-08 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 3e-07 | |
| smart00490 | 82 | smart00490, HELICc, helicase superfamily c-termina | 5e-07 | |
| PRK04537 | 572 | PRK04537, PRK04537, ATP-dependent RNA helicase Rhl | 5e-07 | |
| PRK11634 | 629 | PRK11634, PRK11634, ATP-dependent RNA helicase Dea | 5e-06 | |
| pfam00271 | 78 | pfam00271, Helicase_C, Helicase conserved C-termin | 7e-06 | |
| smart00487 | 201 | smart00487, DEXDc, DEAD-like helicases superfamily | 2e-05 | |
| PLN00206 | 518 | PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel | 7e-04 | |
| COG1202 | 830 | COG1202, COG1202, Superfamily II helicase, archaea | 0.001 | |
| COG0514 | 590 | COG0514, RecQ, Superfamily II DNA helicase [DNA re | 0.003 |
| >gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Score = 124 bits (313), Expect = 2e-34
Identities = 42/136 (30%), Positives = 70/136 (51%), Gaps = 4/136 (2%)
Query: 2 LDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINL---MEELTLKGVTQYYAFV 58
++ ++ LP +RQ LL+SAT P ++ ++L DP EI + E TLK + Q+Y V
Sbjct: 195 IEKILKALPPDRQTLLFSATMPDDIRELARRYLNDPVEIEVSVEKLERTLKKIKQFYLEV 254
Query: 59 -QERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNR 117
E +K+ L L + I+F + + VE LA+ + + G+ +H + Q R+R
Sbjct: 255 ESEEEKLELLLKLLKDEDEGRVIVFVRTKRLVEELAESLRKRGFKVAALHGDLPQEERDR 314
Query: 118 VFHDFRSGLCRNLVCS 133
F+ G R LV +
Sbjct: 315 ALEKFKDGELRVLVAT 330
|
Length = 513 |
| >gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process | Back alignment and domain information |
|---|
| >gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 140 | |||
| KOG0328|consensus | 400 | 100.0 | ||
| KOG0326|consensus | 459 | 99.97 | ||
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 99.97 | |
| KOG0331|consensus | 519 | 99.97 | ||
| KOG0333|consensus | 673 | 99.96 | ||
| KOG0330|consensus | 476 | 99.96 | ||
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 99.96 | |
| KOG0332|consensus | 477 | 99.95 | ||
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 99.95 | |
| KOG0327|consensus | 397 | 99.95 | ||
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 99.94 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 99.94 | |
| PTZ00110 | 545 | helicase; Provisional | 99.94 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 99.94 | |
| KOG0338|consensus | 691 | 99.93 | ||
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 99.93 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 99.93 | |
| KOG0343|consensus | 758 | 99.92 | ||
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 99.92 | |
| PTZ00424 | 401 | helicase 45; Provisional | 99.92 | |
| KOG0342|consensus | 543 | 99.92 | ||
| KOG0335|consensus | 482 | 99.91 | ||
| KOG0345|consensus | 567 | 99.91 | ||
| KOG0340|consensus | 442 | 99.9 | ||
| KOG0336|consensus | 629 | 99.89 | ||
| KOG0341|consensus | 610 | 99.89 | ||
| KOG4284|consensus | 980 | 99.89 | ||
| KOG0339|consensus | 731 | 99.89 | ||
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 99.88 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 99.87 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 99.87 | |
| KOG0334|consensus | 997 | 99.86 | ||
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 99.86 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 99.86 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 99.85 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 99.85 | |
| KOG0337|consensus | 529 | 99.85 | ||
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 99.84 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 99.84 | |
| KOG0346|consensus | 569 | 99.84 | ||
| KOG0344|consensus | 593 | 99.83 | ||
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 99.83 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 99.82 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 99.82 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 99.81 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 99.8 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 99.78 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 99.77 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 99.77 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 99.76 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 99.76 | |
| KOG0347|consensus | 731 | 99.76 | ||
| PRK00254 | 720 | ski2-like helicase; Provisional | 99.74 | |
| KOG0348|consensus | 708 | 99.71 | ||
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 99.71 | |
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 99.71 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 99.71 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 99.68 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 99.67 | |
| KOG0351|consensus | 941 | 99.66 | ||
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 99.65 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 99.65 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 99.64 | |
| KOG0350|consensus | 620 | 99.63 | ||
| KOG0349|consensus | 725 | 99.62 | ||
| PRK09694 | 878 | helicase Cas3; Provisional | 99.56 | |
| cd00079 | 131 | HELICc Helicase superfamily c-terminal domain; ass | 99.55 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 99.54 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 99.54 | |
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 99.53 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 99.53 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 99.52 | |
| KOG0353|consensus | 695 | 99.52 | ||
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 99.52 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 99.52 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 99.48 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 99.47 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 99.47 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 99.45 | |
| KOG0951|consensus | 1674 | 99.44 | ||
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 99.41 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 99.4 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 99.4 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 99.38 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 99.37 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 99.37 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 99.35 | |
| PRK12900 | 1025 | secA preprotein translocase subunit SecA; Reviewed | 99.34 | |
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 99.33 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 99.31 | |
| KOG0329|consensus | 387 | 99.3 | ||
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 99.22 | |
| KOG0952|consensus | 1230 | 99.21 | ||
| KOG0354|consensus | 746 | 99.21 | ||
| KOG0352|consensus | 641 | 99.17 | ||
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 99.17 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 99.14 | |
| PF00271 | 78 | Helicase_C: Helicase conserved C-terminal domain; | 99.13 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 99.11 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 99.07 | |
| KOG0950|consensus | 1008 | 99.01 | ||
| smart00490 | 82 | HELICc helicase superfamily c-terminal domain. | 98.92 | |
| KOG0922|consensus | 674 | 98.87 | ||
| KOG0948|consensus | 1041 | 98.8 | ||
| KOG0947|consensus | 1248 | 98.73 | ||
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 98.73 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 98.71 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 98.63 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 98.57 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 98.55 | |
| KOG4150|consensus | 1034 | 98.48 | ||
| KOG0953|consensus | 700 | 98.46 | ||
| KOG0923|consensus | 902 | 98.34 | ||
| KOG0920|consensus | 924 | 98.34 | ||
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 98.33 | |
| PF06862 | 442 | DUF1253: Protein of unknown function (DUF1253); In | 98.24 | |
| PRK12903 | 925 | secA preprotein translocase subunit SecA; Reviewed | 98.22 | |
| KOG0924|consensus | 1042 | 98.16 | ||
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 98.14 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 98.0 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 97.95 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 97.89 | |
| CHL00122 | 870 | secA preprotein translocase subunit SecA; Validate | 97.85 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 97.84 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 97.83 | |
| PRK12902 | 939 | secA preprotein translocase subunit SecA; Reviewed | 97.76 | |
| PRK12901 | 1112 | secA preprotein translocase subunit SecA; Reviewed | 97.76 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 97.76 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 97.74 | |
| KOG0925|consensus | 699 | 97.73 | ||
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 97.69 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 97.67 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 97.64 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 97.61 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 97.56 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 97.5 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 97.49 | |
| KOG0392|consensus | 1549 | 97.45 | ||
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 97.45 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 97.33 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 97.28 | |
| KOG1000|consensus | 689 | 97.23 | ||
| PF13307 | 167 | Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 | 97.18 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 97.12 | |
| KOG0387|consensus | 923 | 97.12 | ||
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 97.04 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 96.99 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 96.91 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 96.82 | |
| COG0553 | 866 | HepA Superfamily II DNA/RNA helicases, SNF2 family | 96.81 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 96.79 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 96.77 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 96.75 | |
| KOG0385|consensus | 971 | 96.72 | ||
| KOG0389|consensus | 941 | 96.65 | ||
| KOG0384|consensus | 1373 | 96.61 | ||
| KOG0347|consensus | 731 | 96.61 | ||
| KOG0926|consensus | 1172 | 96.43 | ||
| KOG0388|consensus | 1185 | 96.43 | ||
| KOG0389|consensus | 941 | 96.38 | ||
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 96.32 | |
| KOG1002|consensus | 791 | 96.3 | ||
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 96.28 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 96.26 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 96.13 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 96.11 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 96.1 | |
| COG0653 | 822 | SecA Preprotein translocase subunit SecA (ATPase, | 96.03 | |
| KOG0390|consensus | 776 | 95.9 | ||
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 95.78 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 95.71 | |
| KOG1123|consensus | 776 | 95.66 | ||
| KOG0330|consensus | 476 | 95.64 | ||
| KOG0391|consensus | 1958 | 95.64 | ||
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 95.57 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 95.52 | |
| KOG0949|consensus | 1330 | 95.51 | ||
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 95.46 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 95.4 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 95.36 | |
| cd01524 | 90 | RHOD_Pyr_redox Member of the Rhodanese Homology Do | 95.34 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 95.17 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 94.94 | |
| KOG0331|consensus | 519 | 94.9 | ||
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 94.83 | |
| cd01523 | 100 | RHOD_Lact_B Member of the Rhodanese Homology Domai | 94.81 | |
| KOG0338|consensus | 691 | 94.77 | ||
| smart00450 | 100 | RHOD Rhodanese Homology Domain. An alpha beta fold | 94.65 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 94.59 | |
| KOG0334|consensus | 997 | 94.52 | ||
| PRK13766 | 773 | Hef nuclease; Provisional | 94.44 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 94.43 | |
| cd01529 | 96 | 4RHOD_Repeats Member of the Rhodanese Homology Dom | 94.42 | |
| smart00115 | 241 | CASc Caspase, interleukin-1 beta converting enzyme | 94.4 | |
| KOG0385|consensus | 971 | 94.39 | ||
| KOG0339|consensus | 731 | 94.36 | ||
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 94.3 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 94.09 | |
| cd01518 | 101 | RHOD_YceA Member of the Rhodanese Homology Domain | 94.01 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 93.93 | |
| cd01534 | 95 | 4RHOD_Repeat_3 Member of the Rhodanese Homology Do | 93.77 | |
| PTZ00110 | 545 | helicase; Provisional | 93.68 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 93.56 | |
| cd01526 | 122 | RHOD_ThiF Member of the Rhodanese Homology Domain | 93.52 | |
| cd01527 | 99 | RHOD_YgaP Member of the Rhodanese Homology Domain | 93.22 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 93.19 | |
| cd01521 | 110 | RHOD_PspE2 Member of the Rhodanese Homology Domain | 93.14 | |
| cd01444 | 96 | GlpE_ST GlpE sulfurtransferase (ST) and homologs a | 93.07 | |
| cd00158 | 89 | RHOD Rhodanese Homology Domain (RHOD); an alpha be | 93.05 | |
| PRK05320 | 257 | rhodanese superfamily protein; Provisional | 92.95 | |
| cd01449 | 118 | TST_Repeat_2 Thiosulfate sulfurtransferase (TST), | 92.91 | |
| cd01520 | 128 | RHOD_YbbB Member of the Rhodanese Homology Domain | 92.85 | |
| KOG0343|consensus | 758 | 92.83 | ||
| cd01528 | 101 | RHOD_2 Member of the Rhodanese Homology Domain sup | 92.82 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 92.8 | |
| cd01532 | 92 | 4RHOD_Repeat_1 Member of the Rhodanese Homology Do | 92.77 | |
| cd00032 | 243 | CASc Caspase, interleukin-1 beta converting enzyme | 92.71 | |
| cd01533 | 109 | 4RHOD_Repeat_2 Member of the Rhodanese Homology Do | 92.59 | |
| cd01525 | 105 | RHOD_Kc Member of the Rhodanese Homology Domain su | 92.44 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 92.29 | |
| cd01519 | 106 | RHOD_HSP67B2 Member of the Rhodanese Homology Doma | 92.08 | |
| cd01447 | 103 | Polysulfide_ST Polysulfide-sulfurtransferase - Rho | 91.9 | |
| KOG0329|consensus | 387 | 91.75 | ||
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 91.5 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 91.41 | |
| cd01448 | 122 | TST_Repeat_1 Thiosulfate sulfurtransferase (TST), | 91.33 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 91.07 | |
| KOG0342|consensus | 543 | 91.06 | ||
| PRK02362 | 737 | ski2-like helicase; Provisional | 90.73 | |
| KOG0350|consensus | 620 | 90.66 | ||
| cd01535 | 145 | 4RHOD_Repeat_4 Member of the Rhodanese Homology Do | 90.64 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 90.58 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 90.35 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 90.31 | |
| PRK01415 | 247 | hypothetical protein; Validated | 90.1 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 90.03 | |
| COG2519 | 256 | GCD14 tRNA(1-methyladenosine) methyltransferase an | 89.91 | |
| PF02602 | 231 | HEM4: Uroporphyrinogen-III synthase HemD; InterPro | 89.91 | |
| KOG0340|consensus | 442 | 89.89 | ||
| PF01751 | 100 | Toprim: Toprim domain; InterPro: IPR006171 This is | 89.87 | |
| TIGR02562 | 1110 | cas3_yersinia CRISPR-associated helicase Cas3. The | 89.71 | |
| KOG4439|consensus | 901 | 89.63 | ||
| PF02142 | 95 | MGS: MGS-like domain This is a subfamily of this f | 89.29 | |
| cd01445 | 138 | TST_Repeats Thiosulfate sulfurtransferases (TST) c | 89.27 | |
| cd06578 | 239 | HemD Uroporphyrinogen-III synthase (HemD) catalyze | 88.85 | |
| PRK10287 | 104 | thiosulfate:cyanide sulfurtransferase; Provisional | 88.66 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 88.58 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 88.43 | |
| smart00851 | 90 | MGS MGS-like domain. This domain composes the whol | 88.26 | |
| PRK05928 | 249 | hemD uroporphyrinogen-III synthase; Reviewed | 88.24 | |
| cd01522 | 117 | RHOD_1 Member of the Rhodanese Homology Domain sup | 88.15 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 88.13 | |
| KOG0345|consensus | 567 | 88.05 | ||
| PTZ00424 | 401 | helicase 45; Provisional | 87.95 | |
| KOG0335|consensus | 482 | 87.87 | ||
| KOG0348|consensus | 708 | 87.81 | ||
| PRK00162 | 108 | glpE thiosulfate sulfurtransferase; Validated | 87.77 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 87.46 | |
| PLN02160 | 136 | thiosulfate sulfurtransferase | 87.45 | |
| PRK05752 | 255 | uroporphyrinogen-III synthase; Validated | 87.4 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 87.21 | |
| PRK00142 | 314 | putative rhodanese-related sulfurtransferase; Prov | 87.15 | |
| KOG4284|consensus | 980 | 87.14 | ||
| TIGR00696 | 177 | wecB_tagA_cpsF bacterial polymer biosynthesis prot | 87.14 | |
| cd01530 | 121 | Cdc25 Cdc25 phosphatases are members of the Rhodan | 87.06 | |
| TIGR02981 | 101 | phageshock_pspE phage shock operon rhodanese PspE. | 86.88 | |
| KOG0386|consensus | 1157 | 86.51 | ||
| TIGR00596 | 814 | rad1 DNA repair protein (rad1). This family is bas | 86.49 | |
| KOG0951|consensus | 1674 | 86.48 | ||
| PF11019 | 252 | DUF2608: Protein of unknown function (DUF2608); In | 86.43 | |
| PRK11493 | 281 | sseA 3-mercaptopyruvate sulfurtransferase; Provisi | 86.22 | |
| TIGR03865 | 162 | PQQ_CXXCW PQQ-dependent catabolism-associated CXXC | 86.16 | |
| PRK06827 | 382 | phosphoribosylpyrophosphate synthetase; Provisiona | 86.14 | |
| KOG0352|consensus | 641 | 86.12 | ||
| KOG1015|consensus | 1567 | 85.82 | ||
| PF14617 | 252 | CMS1: U3-containing 90S pre-ribosomal complex subu | 85.39 | |
| KOG0346|consensus | 569 | 84.82 | ||
| PLN02723 | 320 | 3-mercaptopyruvate sulfurtransferase | 84.64 | |
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 84.46 | |
| smart00492 | 141 | HELICc3 helicase superfamily c-terminal domain. | 84.43 | |
| PF00581 | 113 | Rhodanese: Rhodanese-like domain This Prosite entr | 84.15 | |
| PRK09189 | 240 | uroporphyrinogen-III synthase; Validated | 84.09 | |
| KOG0351|consensus | 941 | 84.02 | ||
| cd06533 | 171 | Glyco_transf_WecG_TagA The glycosyltransferase Wec | 83.89 | |
| smart00493 | 76 | TOPRIM topoisomerases, DnaG-type primases, OLD fam | 83.49 | |
| PF03808 | 172 | Glyco_tran_WecB: Glycosyl transferase WecB/TagA/Cp | 83.47 | |
| cd01446 | 132 | DSP_MapKP N-terminal regulatory rhodanese domain o | 83.32 | |
| KOG0341|consensus | 610 | 82.83 | ||
| COG0607 | 110 | PspE Rhodanese-related sulfurtransferase [Inorgani | 82.26 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 82.17 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 81.95 | |
| PRK15327 | 393 | type III secretion system needle complex protein P | 81.91 | |
| PRK09860 | 383 | putative alcohol dehydrogenase; Provisional | 81.84 | |
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 81.63 | |
| PRK13958 | 207 | N-(5'-phosphoribosyl)anthranilate isomerase; Provi | 81.18 | |
| PF08704 | 247 | GCD14: tRNA methyltransferase complex GCD14 subuni | 80.98 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 80.78 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 80.65 | |
| KOG0384|consensus | 1373 | 80.15 | ||
| TIGR03167 | 311 | tRNA_sel_U_synt tRNA 2-selenouridine synthase. The | 80.13 |
| >KOG0328|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.3e-33 Score=189.81 Aligned_cols=140 Identities=32% Similarity=0.583 Sum_probs=133.3
Q ss_pred CHHHHHhhCCCCCeEEEEEecCchhHHHHHHHhccCCcEEEcC-CcccCCCeEEEEEEcCc-cchHHHHHHHHhhCCCCc
Q psy13287 1 MLDHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLM-EELTLKGVTQYYAFVQE-RQKVHCLNTLFSKLQINQ 78 (140)
Q Consensus 1 ~l~~il~~~~~~~q~v~~SAT~~~~~~~~~~~~~~~~~~i~~~-~~~~~~~i~~~~~~~~~-~~k~~~l~~ll~~~~~~~ 78 (140)
|+.+|.+++|++.|.+++|||+|..+.+....++.+|..+-++ ++...+.+.++|+.++. ++|.+.|+++...+...|
T Consensus 189 Qiydiyr~lp~~~Qvv~~SATlp~eilemt~kfmtdpvrilvkrdeltlEgIKqf~v~ve~EewKfdtLcdLYd~LtItQ 268 (400)
T KOG0328|consen 189 QIYDIYRYLPPGAQVVLVSATLPHEILEMTEKFMTDPVRILVKRDELTLEGIKQFFVAVEKEEWKFDTLCDLYDTLTITQ 268 (400)
T ss_pred HHHHHHHhCCCCceEEEEeccCcHHHHHHHHHhcCCceeEEEecCCCchhhhhhheeeechhhhhHhHHHHHhhhhehhe
Confidence 5778999999999999999999999999999999999999888 56788889999999975 569999999999999999
Q ss_pred EEEEeCchHHHHHHHHHHHhcCceEEEEecCCCHHHHHHHHHHhhcCCccEEEEecccCCCC
Q psy13287 79 SIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSGDSSAMM 140 (140)
Q Consensus 79 ~lIF~~t~~~~~~~~~~L~~~~~~v~~~h~~~~~~~R~~~~~~f~~g~~~vlv~T~~~~rGl 140 (140)
++|||||++.++++.+.+++.++.|..+||+|++++|.+++++||.|+.+||+|||+-||||
T Consensus 269 avIFcnTk~kVdwLtekm~~~nftVssmHGDm~qkERd~im~dFRsg~SrvLitTDVwaRGi 330 (400)
T KOG0328|consen 269 AVIFCNTKRKVDWLTEKMREANFTVSSMHGDMEQKERDKIMNDFRSGKSRVLITTDVWARGI 330 (400)
T ss_pred EEEEecccchhhHHHHHHHhhCceeeeccCCcchhHHHHHHHHhhcCCceEEEEechhhccC
Confidence 99999999999999999999999999999999999999999999999999999999999997
|
|
| >KOG0326|consensus | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0331|consensus | Back alignment and domain information |
|---|
| >KOG0333|consensus | Back alignment and domain information |
|---|
| >KOG0330|consensus | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0332|consensus | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >KOG0327|consensus | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0338|consensus | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0343|consensus | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >KOG0342|consensus | Back alignment and domain information |
|---|
| >KOG0335|consensus | Back alignment and domain information |
|---|
| >KOG0345|consensus | Back alignment and domain information |
|---|
| >KOG0340|consensus | Back alignment and domain information |
|---|
| >KOG0336|consensus | Back alignment and domain information |
|---|
| >KOG0341|consensus | Back alignment and domain information |
|---|
| >KOG4284|consensus | Back alignment and domain information |
|---|
| >KOG0339|consensus | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >KOG0334|consensus | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >KOG0337|consensus | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0346|consensus | Back alignment and domain information |
|---|
| >KOG0344|consensus | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >KOG0347|consensus | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0348|consensus | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0351|consensus | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >KOG0350|consensus | Back alignment and domain information |
|---|
| >KOG0349|consensus | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >KOG0353|consensus | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0951|consensus | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK12900 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >KOG0329|consensus | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >KOG0952|consensus | Back alignment and domain information |
|---|
| >KOG0354|consensus | Back alignment and domain information |
|---|
| >KOG0352|consensus | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >KOG0950|consensus | Back alignment and domain information |
|---|
| >smart00490 HELICc helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >KOG0922|consensus | Back alignment and domain information |
|---|
| >KOG0948|consensus | Back alignment and domain information |
|---|
| >KOG0947|consensus | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG4150|consensus | Back alignment and domain information |
|---|
| >KOG0953|consensus | Back alignment and domain information |
|---|
| >KOG0923|consensus | Back alignment and domain information |
|---|
| >KOG0920|consensus | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] | Back alignment and domain information |
|---|
| >PRK12903 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0924|consensus | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >CHL00122 secA preprotein translocase subunit SecA; Validated | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >PRK12902 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK12901 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >KOG0925|consensus | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >KOG0392|consensus | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >KOG1000|consensus | Back alignment and domain information |
|---|
| >PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0387|consensus | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >KOG0385|consensus | Back alignment and domain information |
|---|
| >KOG0389|consensus | Back alignment and domain information |
|---|
| >KOG0384|consensus | Back alignment and domain information |
|---|
| >KOG0347|consensus | Back alignment and domain information |
|---|
| >KOG0926|consensus | Back alignment and domain information |
|---|
| >KOG0388|consensus | Back alignment and domain information |
|---|
| >KOG0389|consensus | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0390|consensus | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >KOG1123|consensus | Back alignment and domain information |
|---|
| >KOG0330|consensus | Back alignment and domain information |
|---|
| >KOG0391|consensus | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >KOG0949|consensus | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >KOG0331|consensus | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >KOG0338|consensus | Back alignment and domain information |
|---|
| >smart00450 RHOD Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0334|consensus | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >smart00115 CASc Caspase, interleukin-1 beta converting enzyme (ICE) homologues | Back alignment and domain information |
|---|
| >KOG0385|consensus | Back alignment and domain information |
|---|
| >KOG0339|consensus | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein | Back alignment and domain information |
|---|
| >PRK05320 rhodanese superfamily protein; Provisional | Back alignment and domain information |
|---|
| >cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain | Back alignment and domain information |
|---|
| >cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >KOG0343|consensus | Back alignment and domain information |
|---|
| >cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 | Back alignment and domain information |
|---|
| >cd00032 CASc Caspase, interleukin-1 beta converting enzyme (ICE) homologues; Cysteine-dependent aspartate-directed proteases that mediate programmed cell death (apoptosis) | Back alignment and domain information |
|---|
| >cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 | Back alignment and domain information |
|---|
| >cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >KOG0329|consensus | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >KOG0342|consensus | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0350|consensus | Back alignment and domain information |
|---|
| >cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK01415 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF02602 HEM4: Uroporphyrinogen-III synthase HemD; InterPro: IPR003754 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway [] | Back alignment and domain information |
|---|
| >KOG0340|consensus | Back alignment and domain information |
|---|
| >PF01751 Toprim: Toprim domain; InterPro: IPR006171 This is a conserved region from DNA primase | Back alignment and domain information |
|---|
| >TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >KOG4439|consensus | Back alignment and domain information |
|---|
| >PF02142 MGS: MGS-like domain This is a subfamily of this family; InterPro: IPR011607 This domain composes the whole protein of methylglyoxal synthetase and the domain is also found in carbamoyl phosphate synthetase (CPS) where it forms a regulatory domain that binds to the allosteric effector ornithine | Back alignment and domain information |
|---|
| >cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >cd06578 HemD Uroporphyrinogen-III synthase (HemD) catalyzes the asymmetrical cyclization of tetrapyrrole (linear) to uroporphyrinogen-III, the fourth step in the biosynthesis of heme | Back alignment and domain information |
|---|
| >PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >smart00851 MGS MGS-like domain | Back alignment and domain information |
|---|
| >PRK05928 hemD uroporphyrinogen-III synthase; Reviewed | Back alignment and domain information |
|---|
| >cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >KOG0345|consensus | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >KOG0335|consensus | Back alignment and domain information |
|---|
| >KOG0348|consensus | Back alignment and domain information |
|---|
| >PRK00162 glpE thiosulfate sulfurtransferase; Validated | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >PLN02160 thiosulfate sulfurtransferase | Back alignment and domain information |
|---|
| >PRK05752 uroporphyrinogen-III synthase; Validated | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >PRK00142 putative rhodanese-related sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >KOG4284|consensus | Back alignment and domain information |
|---|
| >TIGR00696 wecB_tagA_cpsF bacterial polymer biosynthesis proteins, WecB/TagA/CpsF family | Back alignment and domain information |
|---|
| >cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >TIGR02981 phageshock_pspE phage shock operon rhodanese PspE | Back alignment and domain information |
|---|
| >KOG0386|consensus | Back alignment and domain information |
|---|
| >TIGR00596 rad1 DNA repair protein (rad1) | Back alignment and domain information |
|---|
| >KOG0951|consensus | Back alignment and domain information |
|---|
| >PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria | Back alignment and domain information |
|---|
| >PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein | Back alignment and domain information |
|---|
| >PRK06827 phosphoribosylpyrophosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG0352|consensus | Back alignment and domain information |
|---|
| >KOG1015|consensus | Back alignment and domain information |
|---|
| >PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit | Back alignment and domain information |
|---|
| >KOG0346|consensus | Back alignment and domain information |
|---|
| >PLN02723 3-mercaptopyruvate sulfurtransferase | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >smart00492 HELICc3 helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family | Back alignment and domain information |
|---|
| >PRK09189 uroporphyrinogen-III synthase; Validated | Back alignment and domain information |
|---|
| >KOG0351|consensus | Back alignment and domain information |
|---|
| >cd06533 Glyco_transf_WecG_TagA The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins | Back alignment and domain information |
|---|
| >smart00493 TOPRIM topoisomerases, DnaG-type primases, OLD family nucleases and RecR proteins | Back alignment and domain information |
|---|
| >PF03808 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/CpsF family; InterPro: IPR004629 The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in Enterobacterial common antigen (eca) synthesis in Escherichia coli | Back alignment and domain information |
|---|
| >cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase | Back alignment and domain information |
|---|
| >KOG0341|consensus | Back alignment and domain information |
|---|
| >COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PRK15327 type III secretion system needle complex protein PrgH; Provisional | Back alignment and domain information |
|---|
| >PRK09860 putative alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >KOG0384|consensus | Back alignment and domain information |
|---|
| >TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 140 | ||||
| 1s2m_A | 400 | Crystal Structure Of The Dead Box Protein Dhh1p Len | 4e-57 | ||
| 2wax_A | 193 | Structure Of The Human Ddx6 C-Terminal Domain In Co | 1e-48 | ||
| 2vso_A | 395 | Crystal Structure Of A Translation Initiation Compl | 1e-18 | ||
| 2j0u_B | 374 | The Crystal Structure Of Eif4aiii-Barentsz Complex | 3e-18 | ||
| 2hyi_C | 413 | Structure Of The Human Exon Junction Complex With A | 4e-18 | ||
| 2j0q_A | 410 | The Crystal Structure Of The Exon Junction Complex | 4e-18 | ||
| 2xb2_A | 411 | Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar | 4e-18 | ||
| 2hxy_A | 391 | Crystal Structure Of Human Apo-Eif4aiii Length = 39 | 4e-18 | ||
| 2j0u_A | 374 | The Crystal Structure Of Eif4aiii-Barentsz Complex | 5e-18 | ||
| 1fuu_A | 394 | Yeast Initiation Factor 4a Length = 394 | 7e-18 | ||
| 3eiq_A | 414 | Crystal Structure Of Pdcd4-eif4a Length = 414 | 3e-16 | ||
| 2zu6_A | 388 | Crystal Structure Of The Eif4a-Pdcd4 Complex Length | 4e-16 | ||
| 3fho_B | 508 | Structure Of S. Pombe Dbp5 Length = 508 | 1e-14 | ||
| 1xtk_A | 390 | Structure Of Decd To Dead Mutation Of Human Uap56 L | 2e-14 | ||
| 1xtj_A | 386 | Structure Of Human Uap56 In Complex With Adp Length | 2e-14 | ||
| 1xti_A | 391 | Structure Of Wildtype Human Uap56 Length = 391 | 2e-14 | ||
| 3fmp_B | 479 | Crystal Structure Of The Nucleoporin Nup214 In Comp | 8e-13 | ||
| 3g0h_A | 424 | Human Dead-box Rna Helicase Ddx19, In Complex With | 9e-13 | ||
| 3ews_A | 445 | Human Dead-Box Rna-Helicase Ddx19 In Complex With A | 9e-13 | ||
| 3fht_A | 412 | Crystal Structure Of Human Dbp5 In Complex With Amp | 9e-13 | ||
| 1fuk_A | 165 | Crystal Structure Of The Carboxy Terminal Domain Of | 2e-11 | ||
| 3pew_A | 395 | S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 | 7e-10 | ||
| 3pey_A | 395 | S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length | 9e-10 | ||
| 1vec_A | 206 | Crystal Structure Of The N-Terminal Domain Of RckP5 | 1e-09 | ||
| 1hv8_A | 367 | Crystal Structure Of A Dead Box Protein From The Hy | 9e-07 | ||
| 2hjv_A | 163 | Structure Of The Second Domain (Residues 207-368) O | 2e-06 | ||
| 2i4i_A | 417 | Crystal Structure Of Human Dead-Box Rna Helicase Dd | 5e-06 | ||
| 1t5i_A | 172 | Crystal Structure Of The C-Terminal Domain Of Uap56 | 7e-06 | ||
| 3i32_A | 300 | Dimeric Structure Of A Hera Helicase Fragment Inclu | 9e-06 | ||
| 3eaq_A | 212 | Novel Dimerization Motif In The Dead Box Rna Helica | 3e-05 | ||
| 2kbf_A | 187 | Solution Structure Of Carboxyl-Terminal Domain Of D | 6e-05 | ||
| 3peu_A | 188 | S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To | 1e-04 | ||
| 2rb4_A | 175 | Crystal Structure Of The Helicase Domain Of Human D | 1e-04 | ||
| 3gfp_A | 189 | Structure Of The C-Terminal Domain Of The Dead-Box | 1e-04 | ||
| 2db3_A | 434 | Structural Basis For Rna Unwinding By The Dead-Box | 3e-04 | ||
| 2jgn_A | 185 | Ddx3 Helicase Domain Length = 185 | 3e-04 | ||
| 2gxq_A | 207 | Hera N-Terminal Domain In Complex With Amp, Crystal | 7e-04 | ||
| 3mwj_A | 207 | Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap | 7e-04 |
| >pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 | Back alignment and structure |
|
| >pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 | Back alignment and structure |
| >pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 | Back alignment and structure |
| >pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 | Back alignment and structure |
| >pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 | Back alignment and structure |
| >pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 | Back alignment and structure |
| >pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 | Back alignment and structure |
| >pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 | Back alignment and structure |
| >pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 | Back alignment and structure |
| >pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 | Back alignment and structure |
| >pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 | Back alignment and structure |
| >pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 | Back alignment and structure |
| >pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 | Back alignment and structure |
| >pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 | Back alignment and structure |
| >pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 | Back alignment and structure |
| >pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 | Back alignment and structure |
| >pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 | Back alignment and structure |
| >pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 | Back alignment and structure |
| >pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 | Back alignment and structure |
| >pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 | Back alignment and structure |
| >pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 | Back alignment and structure |
| >pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 | Back alignment and structure |
| >pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 | Back alignment and structure |
| >pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 | Back alignment and structure |
| >pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 | Back alignment and structure |
| >pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 | Back alignment and structure |
| >pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 | Back alignment and structure |
| >pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 | Back alignment and structure |
| >pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 | Back alignment and structure |
| >pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 | Back alignment and structure |
| >pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 | Back alignment and structure |
| >pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 | Back alignment and structure |
| >pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 | Back alignment and structure |
| >pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 | Back alignment and structure |
| >pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 | Back alignment and structure |
| >pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 | Back alignment and structure |
| >pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 140 | |||
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 9e-72 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 1e-63 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 1e-63 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 4e-62 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 5e-62 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 7e-54 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 6e-51 | |
| 1t5i_A | 172 | C_terminal domain of A probable ATP-dependent RNA | 4e-42 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 1e-39 | |
| 2rb4_A | 175 | ATP-dependent RNA helicase DDX25; rossmann fold, s | 6e-39 | |
| 1fuk_A | 165 | Eukaryotic initiation factor 4A; helicase, DEAD-bo | 9e-38 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 4e-35 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 5e-25 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 7e-25 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 3e-24 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 5e-24 | |
| 2hjv_A | 163 | ATP-dependent RNA helicase DBPA; parallel alpha-be | 1e-23 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 5e-20 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 4e-19 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 1e-16 | |
| 2yjt_D | 170 | ATP-dependent RNA helicase SRMB, regulator of ribo | 2e-14 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 8e-14 | |
| 3eaq_A | 212 | Heat resistant RNA dependent ATPase; DEAD box RNA | 5e-13 | |
| 3i32_A | 300 | Heat resistant RNA dependent ATPase; RNA helicase, | 1e-12 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 2e-12 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 2e-12 | |
| 2p6n_A | 191 | ATP-dependent RNA helicase DDX41; DEAD, structural | 1e-11 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 1e-10 | |
| 2jgn_A | 185 | DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp | 5e-10 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 2e-09 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 6e-08 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 7e-08 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 2e-07 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 3e-07 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 3e-07 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 8e-07 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 1e-06 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 5e-06 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 1e-04 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 3e-04 |
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 | Back alignment and structure |
|---|
Score = 218 bits (559), Expect = 9e-72
Identities = 102/141 (72%), Positives = 112/141 (79%), Gaps = 8/141 (5%)
Query: 1 MLD--------HVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLMEELTLKGVT 52
ML ++S LP Q LL+SATFPLTVK FM KHL PYEINLMEELTLKG+T
Sbjct: 175 MLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEINLMEELTLKGIT 234
Query: 53 QYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQ 112
QYYAFV+ERQK+HCLNTLFSKLQINQ+IIFCNST RVELLAKKIT+LGY CYY HARM Q
Sbjct: 235 QYYAFVEERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQ 294
Query: 113 AHRNRVFHDFRSGLCRNLVCS 133
RN+VFH+FR G R LVCS
Sbjct: 295 QERNKVFHEFRQGKVRTLVCS 315
|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 | Back alignment and structure |
|---|
| >1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 | Back alignment and structure |
|---|
| >2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 | Back alignment and structure |
|---|
| >1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 | Back alignment and structure |
|---|
| >2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 | Back alignment and structure |
|---|
| >2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 | Back alignment and structure |
|---|
| >3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 | Back alignment and structure |
|---|
| >3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 | Back alignment and structure |
|---|
| >2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 | Back alignment and structure |
|---|
| >2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591 | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 140 | |||
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 99.94 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 99.92 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 99.92 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 99.92 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 99.92 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 99.92 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 99.91 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 99.91 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.89 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 99.88 | |
| 2hjv_A | 163 | ATP-dependent RNA helicase DBPA; parallel alpha-be | 99.88 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 99.88 | |
| 1t5i_A | 172 | C_terminal domain of A probable ATP-dependent RNA | 99.88 | |
| 2p6n_A | 191 | ATP-dependent RNA helicase DDX41; DEAD, structural | 99.87 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 99.87 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 99.87 | |
| 2rb4_A | 175 | ATP-dependent RNA helicase DDX25; rossmann fold, s | 99.87 | |
| 1fuk_A | 165 | Eukaryotic initiation factor 4A; helicase, DEAD-bo | 99.87 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 99.86 | |
| 2jgn_A | 185 | DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp | 99.85 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 99.85 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 99.85 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 99.83 | |
| 3eaq_A | 212 | Heat resistant RNA dependent ATPase; DEAD box RNA | 99.82 | |
| 3i32_A | 300 | Heat resistant RNA dependent ATPase; RNA helicase, | 99.82 | |
| 2yjt_D | 170 | ATP-dependent RNA helicase SRMB, regulator of ribo | 99.67 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 99.79 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 99.77 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 99.75 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 99.74 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 99.74 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 99.72 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 99.72 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 99.72 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 99.7 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 99.7 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 99.7 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 99.69 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 99.69 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 99.69 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.67 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 99.66 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 99.66 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 99.66 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.65 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 99.64 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.63 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 99.63 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 99.63 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 99.63 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 99.62 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 99.61 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 99.59 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 99.58 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 99.58 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 99.58 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 99.57 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.55 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 99.53 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 99.52 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 99.52 | |
| 1z5z_A | 271 | Helicase of the SNF2/RAD54 family; hydrolase, reco | 99.48 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 99.47 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 99.47 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 99.47 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.43 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 99.23 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 99.14 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 99.04 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 98.95 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 98.12 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 97.96 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 97.89 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 97.87 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 97.87 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 97.63 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 97.63 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 97.49 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 97.41 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 97.3 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 97.22 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 97.22 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 97.11 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 97.05 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 96.73 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 96.65 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 96.63 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 96.33 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 96.31 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 96.08 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 96.05 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 95.94 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 95.75 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 95.72 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 95.7 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 95.7 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 95.67 | |
| 3gk5_A | 108 | Uncharacterized rhodanese-related protein TVG08686 | 95.56 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 95.51 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 95.41 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 95.38 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 95.36 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 95.36 | |
| 3foj_A | 100 | Uncharacterized protein; protein SSP1007, structur | 95.24 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 95.2 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 95.13 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 95.07 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 95.03 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 94.92 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 94.92 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 94.77 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 94.7 | |
| 3eme_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 94.68 | |
| 3hgt_A | 328 | HDA1 complex subunit 3; RECA-like domain, SWI2/SNF | 94.67 | |
| 2l82_A | 162 | Designed protein OR32; structural genomics, northe | 94.61 | |
| 3iwh_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 94.6 | |
| 3g5j_A | 134 | Putative ATP/GTP binding protein; N-terminal domai | 94.59 | |
| 1wv9_A | 94 | Rhodanese homolog TT1651; CDC25, phosphatase, sulf | 94.56 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 94.53 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 94.53 | |
| 2jtq_A | 85 | Phage shock protein E; solution structure rhodanes | 94.47 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 94.38 | |
| 3flh_A | 124 | Uncharacterized protein LP_1913; alpha-beta protei | 94.29 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 94.2 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 93.91 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 93.89 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 93.81 | |
| 1gmx_A | 108 | GLPE protein; transferase, rhodanese, sulfurtransf | 93.77 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 93.48 | |
| 3hix_A | 106 | ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q | 93.45 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 93.36 | |
| 3nhv_A | 144 | BH2092 protein; alpha-beta protein, structural gen | 93.35 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 93.33 | |
| 1qxn_A | 137 | SUD, sulfide dehydrogenase; polysulfide-sulfur tra | 93.1 | |
| 2k0z_A | 110 | Uncharacterized protein HP1203; A/B domain, struct | 92.95 | |
| 2fsx_A | 148 | RV0390, COG0607: rhodanese-related sulfurtransfera | 92.93 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 92.9 | |
| 1tq1_A | 129 | AT5G66040, senescence-associated family protein; C | 92.9 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 92.9 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 92.58 | |
| 3h11_B | 271 | Caspase-8; cell death, apoptosis, caspase, alterna | 92.47 | |
| 2hhg_A | 139 | Hypothetical protein RPA3614; MCSG, structural gen | 92.33 | |
| 2h54_A | 178 | Caspase-1; allosteric site, dimer interface, hydro | 91.91 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 91.73 | |
| 3d1p_A | 139 | Putative thiosulfate sulfurtransferase YOR285W; at | 91.54 | |
| 3ilm_A | 141 | ALR3790 protein; rhodanese-like, NSR437H, NESG, st | 91.48 | |
| 1vee_A | 134 | Proline-rich protein family; hypothetical protein, | 91.31 | |
| 4f67_A | 265 | UPF0176 protein LPG2838; structural genomics, PSI- | 91.12 | |
| 3e4c_A | 302 | Caspase-1; zymogen, inflammasome, ICE, IL-1B, inna | 90.99 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 90.78 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 90.7 | |
| 1qtn_A | 164 | Caspase-8; apoptosis, dithiane-DIOL, caspase, cyst | 90.66 | |
| 3hjh_A | 483 | Transcription-repair-coupling factor; MFD, mutatio | 90.47 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 90.46 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 90.12 | |
| 1pyo_A | 167 | Caspase-2; apoptosis, caspase, alpha-beta, thiol p | 89.64 | |
| 1urh_A | 280 | 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 | 89.53 | |
| 3h11_A | 272 | CAsp8 and FADD-like apoptosis regulator; cell deat | 89.18 | |
| 2dko_A | 146 | Caspase-3; low barrier hydrogen bond, caspase, dru | 89.05 | |
| 3od5_A | 278 | Caspase-6; caspase domain, apoptotic protease, hyd | 88.47 | |
| 1m72_A | 272 | Caspase-1; caspase, cysteine protease, hydrolase-h | 88.21 | |
| 1uar_A | 285 | Rhodanese; sulfurtransferase, riken structural gen | 87.88 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 87.86 | |
| 3sir_A | 259 | Caspase; hydrolase; 2.68A {Drosophila melanogaster | 87.83 | |
| 3p45_A | 179 | Caspase-6; protease, huntington'S disease, physio | 87.78 | |
| 2j32_A | 250 | Caspase-3; Pro-caspase3, thiol protease, hydrolase | 87.61 | |
| 3tg1_B | 158 | Dual specificity protein phosphatase 10; kinase/rh | 87.61 | |
| 3i2v_A | 127 | Adenylyltransferase and sulfurtransferase MOCS3; r | 86.68 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 86.58 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 86.38 | |
| 1urh_A | 280 | 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 | 86.26 | |
| 2fp3_A | 316 | Caspase NC; apoptosis, initiator caspase activatio | 86.11 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 86.08 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 85.68 | |
| 2ql9_A | 173 | Caspase-7; cysteine protease, apoptosis, thiol pro | 85.53 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 85.48 | |
| 1e0c_A | 271 | Rhodanese, sulfurtransferase; sulfur metabolism, t | 85.43 | |
| 2nn3_C | 310 | Caspase-1; cysteine protease, hydrolase; 3.00A {Sp | 85.36 | |
| 4ehd_A | 277 | Caspase-3; caspase, apoptosis, allosteric inhibiti | 85.33 | |
| 2eg4_A | 230 | Probable thiosulfate sulfurtransferase; structural | 85.31 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 85.16 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 84.96 | |
| 1nw9_B | 277 | Caspase 9, apoptosis-related cysteine protease; XI | 84.36 | |
| 1e0c_A | 271 | Rhodanese, sulfurtransferase; sulfur metabolism, t | 84.24 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 83.88 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 83.61 | |
| 2eg4_A | 230 | Probable thiosulfate sulfurtransferase; structural | 83.42 | |
| 3aay_A | 277 | Putative thiosulfate sulfurtransferase; sulfurtran | 82.79 | |
| 2j6p_A | 152 | SB(V)-AS(V) reductase; arsenate reductase, antimon | 82.66 | |
| 1uar_A | 285 | Rhodanese; sulfurtransferase, riken structural gen | 82.3 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 82.15 | |
| 1rhs_A | 296 | Sulfur-substituted rhodanese; transferase, sulfurt | 82.14 | |
| 2wlr_A | 423 | Putative thiosulfate sulfurtransferase YNJE; rhoda | 81.95 | |
| 1f1j_A | 305 | Caspase-7 protease; caspase-7, cysteine protease, | 81.81 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 81.67 | |
| 3aay_A | 277 | Putative thiosulfate sulfurtransferase; sulfurtran | 81.16 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 80.29 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 80.15 | |
| 2ouc_A | 142 | Dual specificity protein phosphatase 10; rhodanese | 80.09 |
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
Probab=99.94 E-value=2.4e-25 Score=164.83 Aligned_cols=138 Identities=22% Similarity=0.310 Sum_probs=125.0
Q ss_pred HHHHHhhC--CCCCeEEEEEecCchhHHHHHHHhccCCcEEEcC-CcccCCCeEEEEEEcCccchHHHHHHHHhhCCCCc
Q psy13287 2 LDHVISIL--PHERQILLYSATFPLTVKNFMEKHLKDPYEINLM-EELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQ 78 (140)
Q Consensus 2 l~~il~~~--~~~~q~v~~SAT~~~~~~~~~~~~~~~~~~i~~~-~~~~~~~i~~~~~~~~~~~k~~~l~~ll~~~~~~~ 78 (140)
+.+|+..+ +++.|++++|||+|+.+..+...++.++..+.+. ......++.+.+..+....|...|.+++..... +
T Consensus 224 ~~~i~~~~~~~~~~q~l~~SAT~~~~~~~~~~~~l~~~~~i~~~~~~~~~~~i~~~~~~~~~~~k~~~l~~~l~~~~~-~ 302 (434)
T 2db3_A 224 MRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQAD-G 302 (434)
T ss_dssp HHHHHHCTTSCSSCEEEEEESCCCHHHHHHHHTTCSSCEEEEESSTTCCCTTEEEEEEECCGGGHHHHHHHHHHHCCT-T
T ss_pred HHHHHHhcCCCCCceEEEEeccCCHHHHHHHHHhccCCEEEEeccccccccccceEEEEeCcHHHHHHHHHHHHhCCC-C
Confidence 45666664 5689999999999999999999999998888776 445678899999999999999999999988654 4
Q ss_pred EEEEeCchHHHHHHHHHHHhcCceEEEEecCCCHHHHHHHHHHhhcCCccEEEEecccCCCC
Q psy13287 79 SIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGLCRNLVCSGDSSAMM 140 (140)
Q Consensus 79 ~lIF~~t~~~~~~~~~~L~~~~~~v~~~h~~~~~~~R~~~~~~f~~g~~~vlv~T~~~~rGl 140 (140)
+||||++++.++.+++.|++.++.+..+||++++.+|..++++|++|+.+||||||+++||+
T Consensus 303 ~lVF~~t~~~a~~l~~~L~~~~~~~~~lhg~~~~~~R~~~l~~F~~g~~~vLvaT~v~~rGl 364 (434)
T 2db3_A 303 TIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGL 364 (434)
T ss_dssp EEEECSSHHHHHHHHHHHHHTTCCEEEESTTSCHHHHHHHHHHHHTSSCSEEEECGGGTSSC
T ss_pred EEEEEeCcHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHHHcCCCcEEEEchhhhCCC
Confidence 99999999999999999999999999999999999999999999999999999999999996
|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A | Back alignment and structure |
|---|
| >3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A | Back alignment and structure |
|---|
| >2l82_A Designed protein OR32; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} | Back alignment and structure |
|---|
| >3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A | Back alignment and structure |
|---|
| >3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} | Back alignment and structure |
|---|
| >1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >3h11_B Caspase-8; cell death, apoptosis, caspase, alternative splicing, HOST- virus interaction, polymorphism, cytoplasm, disease mutation; 1.90A {Homo sapiens} SCOP: c.17.1.1 PDB: 2k7z_A 1i4e_B 2fun_B 2c2z_B* | Back alignment and structure |
|---|
| >2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2h54_A Caspase-1; allosteric site, dimer interface, hydrolase; HET: PHQ; 1.80A {Homo sapiens} PDB: 1rwm_A* 1rwk_A* 1rwo_A* 1rwp_A* 1rwv_A* 1rww_A* 1rwn_A* 2h48_A* 2h4w_A* 1rwx_A* 2hbq_A* 2hby_A* 1ibc_A 3d6m_A* 2h4y_A* 2h51_A* 3d6f_A* 3d6h_A* 2hbz_A* 2hbr_A* ... | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A | Back alignment and structure |
|---|
| >1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A | Back alignment and structure |
|---|
| >4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3e4c_A Caspase-1; zymogen, inflammasome, ICE, IL-1B, innate immunity, apoptosis, hydrolase, protease protease; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1qtn_A Caspase-8; apoptosis, dithiane-DIOL, caspase, cysteine-protease, hydrol hydrolase inhibitor complex; 1.20A {Homo sapiens} SCOP: c.17.1.1 PDB: 3kjn_A* 3kjq_A* 2y1l_A 2c2z_A 1qdu_A* 1f9e_A* | Back alignment and structure |
|---|
| >3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1pyo_A Caspase-2; apoptosis, caspase, alpha-beta, thiol protease, hydrolase-HY inhibitor complex; 1.65A {Homo sapiens} SCOP: c.17.1.1 PDB: 3rjm_A* 2p2c_A 3r5j_A 3r6g_A 3r6l_A 3r7b_A 3r7n_A 3r7s_A | Back alignment and structure |
|---|
| >1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >3h11_A CAsp8 and FADD-like apoptosis regulator; cell death, apoptosis, caspase, alternative splicing, HOST- virus interaction, polymorphism, cytoplasm, disease mutation; 1.90A {Homo sapiens} PDB: 3h13_A | Back alignment and structure |
|---|
| >2dko_A Caspase-3; low barrier hydrogen bond, caspase, drug design, radiation D tetrahedral intermediate, protease; 1.06A {Homo sapiens} PDB: 1nme_A 2h5i_A 2h5j_A 2h65_A 2xyg_A* 2xyh_A 2xyp_A* 2xzd_A 2xzt_A 2y0b_A 3edq_A 1gfw_A 1re1_A* 1pau_A* 1rhk_A* 1rhm_A* 1rhq_A* 1rhr_A* 1rhu_A* 1rhj_A* ... | Back alignment and structure |
|---|
| >3od5_A Caspase-6; caspase domain, apoptotic protease, hydrolase-hydrolase INHI complex; 1.60A {Homo sapiens} SCOP: c.17.1.0 PDB: 3k7e_A 3s70_A 3v6m_A 3v6l_A 3nr2_A 4fxo_A 2wdp_A 3nkf_A 3s8e_A 4ejf_A 3qnw_A* 3p4u_A* 3p45_B 3qnw_B* 3p4u_B* | Back alignment and structure |
|---|
| >1m72_A Caspase-1; caspase, cysteine protease, hydrolase-hydrolase inhibitor CO; 2.30A {Spodoptera frugiperda} SCOP: c.17.1.1 PDB: 3sip_B | Back alignment and structure |
|---|
| >1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >3sir_A Caspase; hydrolase; 2.68A {Drosophila melanogaster} PDB: 3sip_A | Back alignment and structure |
|---|
| >3p45_A Caspase-6; protease, huntington'S disease, physio PH, competitive inhibition, hydrolase; 2.53A {Homo sapiens} | Back alignment and structure |
|---|
| >2j32_A Caspase-3; Pro-caspase3, thiol protease, hydrolase, hydrolase-hydrolase inhibitor complex; 1.30A {Homo sapiens} PDB: 2j30_A 3h0e_A* 2j33_A 3pd1_A 2j31_A 3pcx_A 1nms_A* 1nmq_A* 3deh_A* 3dei_A* 3dej_A* 3dek_A* 3pd0_A 3itn_A 1qx3_A | Back alignment and structure |
|---|
| >3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} | Back alignment and structure |
|---|
| >3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >2fp3_A Caspase NC; apoptosis, initiator caspase activation, dimerization, active site conformation, hydrolysis/apoptosis complex; 2.50A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >2ql9_A Caspase-7; cysteine protease, apoptosis, thiol protease, zymogen, hydro hydrolase inhibitor complex; HET: CIT; 2.14A {Homo sapiens} PDB: 2ql7_A* 2ql5_A* 2qlb_A* 2qlf_A 2qlj_A* 3edr_A 3ibc_A 3ibf_A 1i51_A | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X | Back alignment and structure |
|---|
| >2nn3_C Caspase-1; cysteine protease, hydrolase; 3.00A {Spodoptera frugiperda} | Back alignment and structure |
|---|
| >4ehd_A Caspase-3; caspase, apoptosis, allosteric inhibition; 1.58A {Homo sapiens} PDB: 4ehk_A 4ehf_A 4ehn_A 1cp3_A 4ehh_A 4eha_A 4ehl_A 1i3o_A | Back alignment and structure |
|---|
| >2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A | Back alignment and structure |
|---|
| >1nw9_B Caspase 9, apoptosis-related cysteine protease; XIAP, caspase inhibition, caspase activation, dimerization; 2.40A {Homo sapiens} SCOP: c.17.1.1 PDB: 1jxq_A* 2ar9_A | Back alignment and structure |
|---|
| >1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A | Back alignment and structure |
|---|
| >3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A | Back alignment and structure |
|---|
| >2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} | Back alignment and structure |
|---|
| >1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A | Back alignment and structure |
|---|
| >2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A | Back alignment and structure |
|---|
| >1f1j_A Caspase-7 protease; caspase-7, cysteine protease, hydrolase, apoptosis, hydrolas hydrolase inhibitor complex; 2.35A {Homo sapiens} SCOP: c.17.1.1 PDB: 1kmc_A 3r5k_A 1i4o_A 1gqf_A 3h1p_A 1shj_A* 1k86_A 1k88_A 1shl_A* | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 140 | ||||
| d1s2ma1 | 206 | c.37.1.19 (A:46-251) Putative ATP-dependent RNA he | 4e-10 | |
| d2j0sa2 | 168 | c.37.1.19 (A:244-411) Probable ATP-dependent RNA h | 5e-10 | |
| d1s2ma2 | 171 | c.37.1.19 (A:252-422) Putative ATP-dependent RNA h | 6e-10 | |
| d1veca_ | 206 | c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma | 8e-10 | |
| d1t6na_ | 207 | c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 | 1e-08 | |
| d2j0sa1 | 222 | c.37.1.19 (A:22-243) Probable ATP-dependent RNA he | 2e-08 | |
| d1qdea_ | 212 | c.37.1.19 (A:) Initiation factor 4a {Baker's yeast | 2e-08 | |
| d2rb4a1 | 168 | c.37.1.19 (A:307-474) ATP-dependent RNA helicase D | 3e-08 | |
| d1q0ua_ | 209 | c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR | 4e-08 | |
| d2g9na1 | 218 | c.37.1.19 (A:21-238) Initiation factor 4a {Human ( | 5e-08 | |
| d1gkub2 | 248 | c.37.1.16 (B:251-498) Helicase-like "domain" of re | 1e-07 | |
| d1a1va2 | 299 | c.37.1.14 (A:326-624) HCV helicase domain {Human h | 2e-07 | |
| d1hv8a1 | 208 | c.37.1.19 (A:3-210) Putative DEAD box RNA helicase | 6e-07 | |
| d1wrba1 | 238 | c.37.1.19 (A:164-401) putative ATP-dependent RNA h | 3e-06 | |
| d1t5ia_ | 168 | c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 | 5e-06 | |
| d2bmfa2 | 305 | c.37.1.14 (A:178-482) Dengue virus helicase {Dengu | 5e-06 | |
| d1oywa3 | 200 | c.37.1.19 (A:207-406) RecQ helicase domain {Escher | 5e-05 | |
| d1hv8a2 | 155 | c.37.1.19 (A:211-365) Putative DEAD box RNA helica | 3e-04 | |
| d1jr6a_ | 138 | c.37.1.14 (A:) HCV helicase domain {Human hepatiti | 8e-04 | |
| d1c4oa2 | 174 | c.37.1.19 (A:410-583) Nucleotide excision repair e | 0.001 |
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Putative ATP-dependent RNA helicase DHH1 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 53.1 bits (126), Expect = 4e-10
Identities = 28/42 (66%), Positives = 32/42 (76%)
Query: 3 DHVISILPHERQILLYSATFPLTVKNFMEKHLKDPYEINLME 44
+ ++S LP Q LL+SATFPLTVK FM KHL PYEINLME
Sbjct: 165 EQILSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEINLME 206
|
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 | Back information, alignment and structure |
|---|
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 | Back information, alignment and structure |
|---|
| >d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 | Back information, alignment and structure |
|---|
| >d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 | Back information, alignment and structure |
|---|
| >d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 140 | |||
| d1s2ma2 | 171 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 99.91 | |
| d1t5ia_ | 168 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 99.9 | |
| d2j0sa2 | 168 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 99.9 | |
| d1fuka_ | 162 | Initiation factor 4a {Baker's yeast (Saccharomyces | 99.9 | |
| d2rb4a1 | 168 | ATP-dependent RNA helicase DDX25 {Human (Homo sapi | 99.89 | |
| d1hv8a2 | 155 | Putative DEAD box RNA helicase {Archaeon Methanoco | 99.89 | |
| d1oywa3 | 200 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 99.85 | |
| d1c4oa2 | 174 | Nucleotide excision repair enzyme UvrB {Thermus th | 99.83 | |
| d1t5la2 | 181 | Nucleotide excision repair enzyme UvrB {Bacillus c | 99.82 | |
| d1jr6a_ | 138 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.69 | |
| d2p6ra4 | 201 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.63 | |
| d1gkub2 | 248 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.61 | |
| d1wp9a2 | 286 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 99.54 | |
| d2eyqa5 | 211 | Transcription-repair coupling factor, TRCF {Escher | 99.51 | |
| d2fwra1 | 200 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 99.44 | |
| d1a1va2 | 299 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.43 | |
| d1gm5a4 | 206 | RecG helicase domain {Thermotoga maritima [TaxId: | 99.35 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 99.33 | |
| d1yksa2 | 299 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 99.18 | |
| d1z5za1 | 244 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 99.03 | |
| d1z3ix1 | 346 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 98.97 | |
| d1tf5a4 | 175 | Translocation ATPase SecA, nucleotide-binding doma | 98.8 | |
| d1nkta4 | 219 | Translocation ATPase SecA, nucleotide-binding doma | 98.21 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 98.03 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 97.84 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 96.5 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 96.36 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 95.58 | |
| d1yt8a4 | 130 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 95.33 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 95.32 | |
| d1gmxa_ | 108 | Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 | 94.81 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 94.72 | |
| d1tq1a_ | 119 | Thiosulfate sulfurtransferase/Senescence-associate | 94.72 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 94.68 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 94.54 | |
| d1qxna_ | 137 | Polysulfide-sulfur transferase (sulfide dehydrogen | 94.35 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 94.26 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 93.59 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 93.48 | |
| d2b2na1 | 308 | Transcription-repair coupling factor, TRCF {Escher | 93.13 | |
| d1urha2 | 120 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 92.98 | |
| d1yt8a1 | 136 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 92.97 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 91.95 | |
| d1wmaa1 | 275 | Carbonyl reductase/20beta-hydroxysteroid dehydroge | 91.3 | |
| g1pyo.1 | 257 | Caspase-2 {Human (Homo sapiens) [TaxId: 9606]} | 91.3 | |
| d1yt8a2 | 101 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 90.74 | |
| d1e0ca2 | 136 | Sulfurtransferase {Azotobacter vinelandii [TaxId: | 90.66 | |
| g1qtn.1 | 242 | Caspase-8 {Human (Homo sapiens) [TaxId: 9606]} | 90.23 | |
| d2eyqa2 | 117 | Transcription-repair coupling factor, TRCF {Escher | 89.92 | |
| d1okga1 | 156 | 3-mercaptopyruvate sulfurtransferase {Leishmania m | 88.62 | |
| d1m72a_ | 256 | Caspase-1 {Fall armyworm (Spodoptera frugiperda) [ | 87.4 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 86.8 | |
| d1piia1 | 198 | N-(5'phosphoribosyl)antranilate isomerase, PRAI {E | 86.7 | |
| g1nme.1 | 238 | Apopain (caspase-3, cpp32) {Human (Homo sapiens) [ | 86.48 | |
| d1yt8a3 | 157 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 86.25 | |
| d1edoa_ | 244 | beta-keto acyl carrier protein reductase {Oil seed | 86.15 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 86.03 | |
| d1uara2 | 141 | Sulfurtransferase {Thermus thermophilus [TaxId: 27 | 85.72 | |
| d1rrma_ | 385 | Lactaldehyde reductase FucO {Escherichia coli [Tax | 85.59 | |
| d1rhsa2 | 144 | Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | 85.41 | |
| d1urha1 | 147 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 84.06 | |
| d2bd0a1 | 240 | Bacterial sepiapterin reductase {Chlorobium tepidu | 84.06 | |
| d1tf5a3 | 273 | Translocation ATPase SecA, nucleotide-binding doma | 83.84 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 83.54 | |
| d1f1ja_ | 245 | Caspase-7 {Human (Homo sapiens) [TaxId: 9606]} | 83.23 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 83.07 | |
| d1vlja_ | 398 | NADH-dependent butanol dehydrogenase A (TM0820) {T | 82.87 | |
| d1byka_ | 255 | Trehalose repressor, C-terminal domain {Escherichi | 82.18 | |
| d1yl7a1 | 135 | Dihydrodipicolinate reductase {Mycobacterium tuber | 81.45 | |
| d1u9ya2 | 129 | Phosphoribosylpyrophosphate synthetase {Methanocal | 81.22 | |
| d1uara1 | 143 | Sulfurtransferase {Thermus thermophilus [TaxId: 27 | 81.2 | |
| d1nw9b_ | 277 | Caspase-9 {Human (Homo sapiens) [TaxId: 9606]} | 80.65 |
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Putative ATP-dependent RNA helicase DHH1 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.91 E-value=1.2e-23 Score=136.72 Aligned_cols=94 Identities=74% Similarity=1.194 Sum_probs=91.1
Q ss_pred cCCCeEEEEEEcCccchHHHHHHHHhhCCCCcEEEEeCchHHHHHHHHHHHhcCceEEEEecCCCHHHHHHHHHHhhcCC
Q psy13287 47 TLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRSGL 126 (140)
Q Consensus 47 ~~~~i~~~~~~~~~~~k~~~l~~ll~~~~~~~~lIF~~t~~~~~~~~~~L~~~~~~v~~~h~~~~~~~R~~~~~~f~~g~ 126 (140)
...++.|+|+.+++.+|...|.++++..+..++||||+|++.++.++..|+..|+.+..+||++++++|..++++|++|+
T Consensus 3 tl~~i~q~yi~v~~~~K~~~L~~ll~~~~~~k~iVF~~~~~~~~~l~~~L~~~g~~~~~~h~~~~~~~r~~~~~~f~~~~ 82 (171)
T d1s2ma2 3 TLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGK 82 (171)
T ss_dssp BCTTEEEEEEECCGGGHHHHHHHHHHHSCCSEEEEECSSHHHHHHHHHHHHHHTCCEEEECTTSCHHHHHHHHHHHHTTS
T ss_pred CccceEEEEEEcCHHHHHHHHHHHHHhCCCCceEEEEeeeehhhHhHHhhhcccccccccccccchhhhhhhhhhcccCc
Confidence 56789999999999999999999999988899999999999999999999999999999999999999999999999999
Q ss_pred ccEEEEecccCCCC
Q psy13287 127 CRNLVCSGDSSAMM 140 (140)
Q Consensus 127 ~~vlv~T~~~~rGl 140 (140)
.++|||||+++||+
T Consensus 83 ~~ilv~Td~~~~Gi 96 (171)
T d1s2ma2 83 VRTLVCSDLLTRGI 96 (171)
T ss_dssp SSEEEESSCSSSSC
T ss_pred cccccchhHhhhcc
Confidence 99999999999996
|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b2na1 c.37.1.19 (A:26-333) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2eyqa2 c.37.1.19 (A:349-465) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1m72a_ c.17.1.1 (A:) Caspase-1 {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1piia1 c.1.2.4 (A:255-452) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1rrma_ e.22.1.2 (A:) Lactaldehyde reductase FucO {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1f1ja_ c.17.1.1 (A:) Caspase-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1vlja_ e.22.1.2 (A:) NADH-dependent butanol dehydrogenase A (TM0820) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1u9ya2 c.61.1.2 (A:156-284) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nw9b_ c.17.1.1 (B:) Caspase-9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|