Psyllid ID: psy13372

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270---

MAAPSFKLAANLTLLFNDLAANYLDKYRVAAELGFRYIESWFPPVGVTLEQLVAAQTRHGLKQVLINTEVDENFGYAAVKGKESEFRASLEKTIQYACALNIPAIHIMSGKTESSRTQPIASEDPYTTLKENLIYACAELERHSLTALIEPVNQHSVPGYYLSSFRVAERLIRELRAHGISNVQLQFDFFNAQRICGDLTHTFGACRDLIGHVQIAQAPDRQEPHARGEIDYAYVFELLAREGYEGYVGLEYKPQGNTKEGLEEFLKTFDLKL

ccccccccccccccccccccccHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHcccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccHHHHHHHHHHHHHcccccEEEEHHHHHHHHHcccHHHHHHHHcccccEEEEccccccccccccccccHHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHHccccc

cccccHHHHHHHHHHHccccHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHcccEEEEEEccccccccEEEccccHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccEcccHHHHHHHHHHHHHcccccEEEEEEEEEHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHccc

MAAPSFKLAANLTLLFNDLAANYLDKYRVAAELGFRYieswfppvgVTLEQLVAAQTRHGLKQVLINTEVDENFGYAAVKGKESEFRASLEKTIQYACAlnipaihimsgktessrtqpiasedpyttlKENLIYACAELERHSLTAliepvnqhsvpgyylsSFRVAERLIRELRAHGISNVQLQFDFFNAQRICGDLTHTFGACRDLIGHvqiaqapdrqephargeiDYAYVFELLAREgyegyvgleykpqgntkEGLEEFLKTFDLKL

*****FKLAANLTLLFNDLAANYLDKYRVAAELGFRYIESWFPPVGVTLEQLVAAQTRHGLKQVLINTEVDENFGYAAVKGKESEFRASLEKTIQYACALNIPAIHIM*****************YTTLKENLIYACAELERHSLTALIEPVNQHSVPGYYLSSFRVAERLIRELRAHGISNVQLQFDFFNAQRICGDLTHTFGACRDLIGHVQIAQA*******ARGEIDYAYVFELLAREGYEGYVGLEYKP*******************

***PSFKLAANLTLLFNDLAANYLDKYRVAAELGFRYIESWFPPVGVTLEQLVAAQTRHGLKQVLINTEVDENFGYAAVKGKESEFRASLEKTIQYACALNIPAIHIMSGKTESSRTQPIASEDPYTTLKENLIYACAELERHSLTALIEPVNQHSVPGYYLSSFRVAERLIRELRAHGISNVQLQFDFFNAQRICGDLTHTFGACRDLIGHVQIAQAPDRQEPHARGEIDYAYVFELLAREGYEGYVGLEYKPQGNTKEGLEEFLKTFDLKL

MAAPSFKLAANLTLLFNDLAANYLDKYRVAAELGFRYIESWFPPVGVTLEQLVAAQTRHGLKQVLINTEVDENFGYAAVKGKESEFRASLEKTIQYACALNIPAIHIMS**********IASEDPYTTLKENLIYACAELERHSLTALIEPVNQHSVPGYYLSSFRVAERLIRELRAHGISNVQLQFDFFNAQRICGDLTHTFGACRDLIGHVQIAQAPDRQEPHARGEIDYAYVFELLAREGYEGYVGLEYKPQGNTKEGLEEFLKTFDLKL

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		273	2.2.26 [Sep-21-2011]
Q8R1F5		277	Putative hydroxypyruvate	yes	N/A	0.956	0.942	0.355	3e-41
Q7T3H9		276	Putative hydroxypyruvate	yes	N/A	0.945	0.934	0.359	6e-41
P36951		264	Putative hydroxypyruvate	yes	N/A	0.904	0.935	0.363	1e-39
P30147		258	Hydroxypyruvate isomerase	N/A	N/A	0.901	0.953	0.367	5e-39
Q5T013		277	Putative hydroxypyruvate	yes	N/A	0.956	0.942	0.355	6e-39
Q6NUD4		275	Putative hydroxypyruvate	N/A	N/A	0.945	0.938	0.352	8e-38
Q57151		258	Putative hydroxypyruvate	yes	N/A	0.901	0.953	0.353	2e-36
Q11185		262	Putative hydroxypyruvate	yes	N/A	0.901	0.938	0.342	2e-34
Q46891		258	Putative hydroxypyruvate	N/A	N/A	0.897	0.949	0.334	7e-30
Q44015		260	Putative hydroxypyruvate	no	N/A	0.904	0.95	0.324	7e-28

>sp\|Q8R1F5\|HYI_MOUSE Putative hydroxypyruvate isomerase OS=Mus musculus GN=Hyi PE=1 SV=2	Back alignment and function desciption

 Score =  168 bits (426), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 97/273 (35%), Positives = 153/273 (56%), Gaps = 12/273 (4%)

Query: 6   FKLAANLTLLFNDLAANYLDKYRVAAELGFRYIE-SWFPPVGVTLEQLVAAQTRHGLKQV 64
            + +AN++ LF +L     ++   A   GF+  E +W  P   + + L +A    GL+ V
Sbjct: 4   LRFSANVSWLFPELPG-LPERLHAAGRAGFKAAEVAW--PYTESPQALASAAQTAGLRLV 60

Query: 65  LINTEVDEN----FGYAAVKGKESEFRASLEKTIQYACALNIPAIHIMSGKTESSRTQPI 120
           LINT   ++     G  AV G+++ FR  LE+ + YA AL  P IH+M+G+      +  
Sbjct: 61  LINTPRGDHEKGEMGLGAVPGRQAAFREGLEQAVLYAKALGCPRIHLMAGRVPQGADRAA 120

Query: 121 ASEDPYTTLKENLIYACAELERHSLTALIEPVNQH-SVPGYYLSSFRVAERLIRELRAHG 179
              +  T   ENL +A   L + +L  L+EP+N   + P Y+L + R A  +++++   G
Sbjct: 121 VKGEMETVFVENLKHAAGVLAQENLVGLLEPINTRITDPQYFLDTPRQAAAILQKV---G 177

Query: 180 ISNVQLQFDFFNAQRICGDLTHTFGACRDLIGHVQIAQAPDRQEPHARGEIDYAYVFELL 239
             N+QLQ D F+ Q + G+LT         +GHVQ+AQ PDR EP + GE+D+ Y+F+LL
Sbjct: 178 RPNLQLQMDIFHWQIMDGNLTGNIREFLPTVGHVQVAQVPDRGEPGSSGELDFTYLFQLL 237

Query: 240 AREGYEGYVGLEYKPQGNTKEGLEEFLKTFDLK 272
             EGY+G+VG EY+P+G+T EGL      +D +
Sbjct: 238 EDEGYQGFVGCEYRPRGDTVEGLSWLRSYWDRR 270

Mus musculus (taxid: 10090)
EC: 5EC: .EC: 3EC: .EC: 1EC: .EC: 2EC: 2

>sp\|Q7T3H9\|HYI_DANRE Putative hydroxypyruvate isomerase OS=Danio rerio GN=hyi PE=2 SV=2	Back alignment and function description

>sp\|P36951\|HYI_DROME Putative hydroxypyruvate isomerase OS=Drosophila melanogaster GN=Gip PE=1 SV=1	Back alignment and function description

>sp\|P30147\|HYI_ECOLI Hydroxypyruvate isomerase OS=Escherichia coli (strain K12) GN=hyi PE=1 SV=1	Back alignment and function description

>sp\|Q5T013\|HYI_HUMAN Putative hydroxypyruvate isomerase OS=Homo sapiens GN=HYI PE=1 SV=2	Back alignment and function description

>sp\|Q6NUD4\|HYI_XENLA Putative hydroxypyruvate isomerase OS=Xenopus laevis GN=hyi PE=2 SV=2	Back alignment and function description

>sp\|Q57151\|Y1013_HAEIN Putative hydroxypyruvate isomerase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1013 PE=3 SV=1	Back alignment and function description

>sp\|Q11185\|HYI_CAEEL Putative hydroxypyruvate isomerase OS=Caenorhabditis elegans GN=C05D11.5 PE=3 SV=1	Back alignment and function description

>sp\|Q46891\|YGBM_ECOLI Putative hydroxypyruvate isomerase YgbM OS=Escherichia coli (strain K12) GN=ygbM PE=1 SV=1	Back alignment and function description

>sp\|Q44015\|YGB4_CUPNE Putative hydroxypyruvate isomerase OS=Cupriavidus necator PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		273
307183094		262	Putative hydroxypyruvate isomerase [Camp	0.904	0.942	0.404	8e-52
350412064		262	PREDICTED: putative hydroxypyruvate isom	0.904	0.942	0.408	1e-51
307213499		262	Putative hydroxypyruvate isomerase [Harp	0.908	0.946	0.387	7e-51
170042214		265	hydroxypyruvate isomerase [Culex quinque	0.945	0.973	0.413	1e-50
357604475		260	hydroxypyruvate isomerase [Danaus plexip	0.937	0.984	0.400	2e-50
164459610		260	hydroxypyruvate isomerase [Bombyx mori]	0.901	0.946	0.421	3e-50
156551944		264	PREDICTED: putative hydroxypyruvate isom	0.948	0.981	0.395	5e-50
114052328		260	hydroxypyruvate isomerase [Bombyx mori]	0.901	0.946	0.417	5e-50
322799508		262	hypothetical protein SINV_08134 [Solenop	0.904	0.942	0.393	1e-49
340727616		263	PREDICTED: putative hydroxypyruvate isom	0.904	0.939	0.406	2e-49

>gi\|307183094\|gb\|EFN70011.1\| Putative hydroxypyruvate isomerase [Camponotus floridanus]	Back alignment and taxonomy information

 Score =  209 bits (533), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 106/262 (40%), Positives = 162/262 (61%), Gaps = 15/262 (5%)

Query: 5   SFKLAANLTLLFNDLAANYLDKYRVAAELGFRYIESWFPPVGVTLEQLVAAQTRHGLKQV 64
           + K A NL+ +F + A N +D+Y++A + GF+ +ES FP  G +++Q+  A+ +  + Q+
Sbjct: 2   ALKFACNLSFMFTE-APNIIDRYQLAKQAGFKAVESGFP-FGFSVQQVATAKKKADVNQI 59

Query: 65  LINTEVDE----NFGYAAVKGKESEFRASLEKTIQYACALNIPAIHIMSGKTESSRTQPI 120
           L+N    +      G+AA+ G+E  F+ S+EKTI+YA AL+   IH+MSGK ES  T   
Sbjct: 60  LLNVFTGDVTKGELGFAAIPGEEENFKKSIEKTIEYAKALDCKMIHVMSGKVESPTT--- 116

Query: 121 ASEDPYTTLKENLIYACAELERHSLTALIEPVNQHSVPGYYLSSFRVAERLIRELRAHGI 180
              D     ++NL+YA  + +   +  +IEP+N +SVP YY+++F+    L++++ +   
Sbjct: 117 ---DNDIVYEKNLLYAIEKCKSEDIVVVIEPINNYSVPNYYMNNFQKGLNLVKKINS--- 170

Query: 181 SNVQLQFDFFNAQRICGDLTHTFGACRDLIGHVQIAQAPDRQEPHARGEIDYAYVFELLA 240
           ++ +LQ D F+ Q  CG++T         +GHVQIAQ PDR EP   GEIDY YVF LL 
Sbjct: 171 AHFKLQMDIFHLQHCCGNITKCIQEFLPYVGHVQIAQVPDRHEPDTPGEIDYKYVFSLLE 230

Query: 241 REGYEGYVGLEYKPQGNTKEGL 262
           R GY GY+GLEY P+  T EGL
Sbjct: 231 RIGYTGYIGLEYWPKSLTTEGL 252

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|350412064\|ref\|XP_003489534.1\| PREDICTED: putative hydroxypyruvate isomerase-like [Bombus impatiens]	Back alignment and taxonomy information

>gi\|307213499\|gb\|EFN88908.1\| Putative hydroxypyruvate isomerase [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|170042214\|ref\|XP_001848829.1\| hydroxypyruvate isomerase [Culex quinquefasciatus] gi\|167865736\|gb\|EDS29119.1\| hydroxypyruvate isomerase [Culex quinquefasciatus]	Back alignment and taxonomy information

>gi\|357604475\|gb\|EHJ64208.1\| hydroxypyruvate isomerase [Danaus plexippus]	Back alignment and taxonomy information

>gi\|164459610\|gb\|ABY57912.1\| hydroxypyruvate isomerase [Bombyx mori]	Back alignment and taxonomy information

>gi\|156551944\|ref\|XP_001607821.1\| PREDICTED: putative hydroxypyruvate isomerase-like [Nasonia vitripennis]	Back alignment and taxonomy information

>gi\|114052328\|ref\|NP_001040471.1\| hydroxypyruvate isomerase [Bombyx mori] gi\|95103034\|gb\|ABF51458.1\| hydroxypyruvate isomerase [Bombyx mori]	Back alignment and taxonomy information

>gi\|322799508\|gb\|EFZ20816.1\| hypothetical protein SINV_08134 [Solenopsis invicta]	Back alignment and taxonomy information

>gi\|340727616\|ref\|XP_003402136.1\| PREDICTED: putative hydroxypyruvate isomerase-like [Bombus terrestris]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		273
ZFIN\|ZDB-GENE-040426-1273		276	hyi "hydroxypyruvate isomerase	0.930	0.920	0.370	1.6e-40
MGI\|MGI:1915430		277	Hyi "hydroxypyruvate isomerase	0.948	0.935	0.362	8.7e-40
UNIPROTKB\|Q5T013		277	HYI "Putative hydroxypyruvate	0.948	0.935	0.362	2.9e-39
UNIPROTKB\|F1S325		277	HYI "Hydroxypyruvate isomerase	0.937	0.924	0.364	6.1e-39
FB\|FBgn0011770		264	Gip "GIP-like" [Drosophila mel	0.904	0.935	0.363	7.8e-39
UNIPROTKB\|P30147		258	hyi "Hyi" [Escherichia coli K-	0.897	0.949	0.369	3.4e-38
UNIPROTKB\|Q4KBD6		260	hyi_2 "Hydroxypyruvate isomera	0.893	0.938	0.353	1.1e-37
UNIPROTKB\|E7EWH8		276	HYI "Hydroxypyruvate isomerase	0.904	0.894	0.361	4.9e-37
UNIPROTKB\|F6UJY1		302	HYI "Hydroxypyruvate isomerase	0.630	0.569	0.350	4.4e-36
UNIPROTKB\|E1BAZ4		282	E1BAZ4 "Hydroxypyruvate isomer	0.945	0.914	0.365	4e-35

ZFIN\|ZDB-GENE-040426-1273 hyi "hydroxypyruvate isomerase" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

 Score = 431 (156.8 bits), Expect = 1.6e-40, P = 1.6e-40
 Identities = 99/267 (37%), Positives = 152/267 (56%)

Query:     3 APSFKLAANLTLLFNDLAANYLDKYRVAAELGFRYIES-WFPPVGVTLEQLVAAQTRHGL 61
             AP  K  AN++ LF +L   +  + R AA  GFR +E+ W       L++L  A+   GL
Sbjct:     2 AP-LKFCANISWLFTELP-EFPQRMRAAASAGFRAVEAAWL--YNTDLKELKTAKEETGL 57

Query:    62 KQVLINTEVDE----NFGYAAVKGKESEFRASLEKTIQYACALNIPAIHIMSGKTESSRT 117
             + VLINT   +    + G AAV G+E EFR  L+  +QYA AL+   IH+M+G+  +   
Sbjct:    58 EFVLINTPPGDASAGDLGLAAVPGREQEFRQGLDLAVQYAKALDCTRIHLMAGRVPAGSE 117

Query:   118 QPIASEDPYTTLKENLIYACAELERHSLTALIEPVNQHSV-PGYYLSSFRVAERLIRELR 176
             +   +     T   NL +A   L++  L  LIEP+N     P Y+L S   A  +++ + 
Sbjct:   118 RCALALQMEDTFVHNLKHAAGVLDKEGLLGLIEPINSRITDPRYFLHSPHQAAEILQRVD 177

Query:   177 AHGISNVQLQFDFFNAQRICGDLTHTFGACRDLIGHVQIAQAPDRQEPHARGEIDYAYVF 236
              H   ++++Q D F+ Q + G+LTH       + GH+QIAQ PDR EP + GE++++++F
Sbjct:   178 -H--PSIKMQMDIFHWQIMDGNLTHNIRRYLPMTGHIQIAQVPDRHEPDSPGELNFSFIF 234

Query:   237 ELLAREGYEGYVGLEYKPQGNTKEGLE 263
              LL    Y+G++G EYKPQG+T+ GLE
Sbjct:   235 RLLEELDYQGFIGCEYKPQGSTEAGLE 261

GO:0008903 "hydroxypyruvate isomerase activity" evidence=IEA

GO:0016853 "isomerase activity" evidence=IEA

MGI\|MGI:1915430 Hyi "hydroxypyruvate isomerase homolog (E. coli)" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5T013 HYI "Putative hydroxypyruvate isomerase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1S325 HYI "Hydroxypyruvate isomerase" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

FB\|FBgn0011770 Gip "GIP-like" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

UNIPROTKB\|P30147 hyi "Hyi" [Escherichia coli K-12 (taxid:83333)]	Back alignment and assigned GO terms

UNIPROTKB\|Q4KBD6 hyi_2 "Hydroxypyruvate isomerase" [Pseudomonas protegens Pf-5 (taxid:220664)]	Back alignment and assigned GO terms

UNIPROTKB\|E7EWH8 HYI "Hydroxypyruvate isomerase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F6UJY1 HYI "Hydroxypyruvate isomerase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BAZ4 E1BAZ4 "Hydroxypyruvate isomerase" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9Z596	Y6206_STRCO	No assigned EC number	0.2929	0.8681	0.8494	yes	N/A
Q8R1F5	HYI_MOUSE	5, ., 3, ., 1, ., 2, 2	0.3553	0.9560	0.9422	yes	N/A
Q5T013	HYI_HUMAN	5, ., 3, ., 1, ., 2, 2	0.3553	0.9560	0.9422	yes	N/A
Q7T3H9	HYI_DANRE	5, ., 3, ., 1, ., 2, 2	0.3592	0.9450	0.9347	yes	N/A
Q57151	Y1013_HAEIN	No assigned EC number	0.3531	0.9010	0.9534	yes	N/A
Q11185	HYI_CAEEL	5, ., 3, ., 1, ., 2, 2	0.3422	0.9010	0.9389	yes	N/A
P36951	HYI_DROME	5, ., 3, ., 1, ., 2, 2	0.3636	0.9047	0.9356	yes	N/A

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	5.1.3.22	LOW CONFIDENCE prediction!
3rd Layer	5.1.3	LOW CONFIDENCE prediction!
3rd Layer	5.3.1.5	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		273
COG3622		260	COG3622, Hfi, Hydroxypyruvate isomerase [Carbohydr	3e-73
TIGR03234		254	TIGR03234, OH-pyruv-isom, hydroxypyruvate isomeras	3e-70
PRK09997		258	PRK09997, PRK09997, hydroxypyruvate isomerase; Pro	1e-51
PRK09989		258	PRK09989, PRK09989, hypothetical protein; Provisio	4e-40
pfam01261		202	pfam01261, AP_endonuc_2, Xylose isomerase-like TIM	1e-22
COG1082		274	COG1082, IolE, Sugar phosphate isomerases/epimeras	6e-16

>gnl\|CDD\|226149 COG3622, Hfi, Hydroxypyruvate isomerase [Carbohydrate transport and metabolism]	Back alignment and domain information

 Score =  224 bits (573), Expect = 3e-73
 Identities = 101/269 (37%), Positives = 146/269 (54%), Gaps = 15/269 (5%)

Query: 6   FKLAANLTLLFNDLAANYLDKYRVAAELGFRYIESWFPPVGVTLEQLVAAQTRHGLKQVL 65
            + AANL++LF ++   +L+++  AA+ GFR +E +  P     E+L A    +GL QVL
Sbjct: 2   PRFAANLSMLFTEVP--FLERFAAAAKAGFRGVE-FLFPYDYDAEELKARLDFNGLTQVL 58

Query: 66  INTEVDE----NFGYAAVKGKESEFRASLEKTIQYACALNIPAIHIMSGKTESSRTQPIA 121
            N    +      G AA+ G+E EFR  +   I+YA AL    +H ++G         + 
Sbjct: 59  FNLPAGDWAAGERGIAALPGREEEFRLGVALAIEYATALGCKQVHCLAGIPPEG----VD 114

Query: 122 SEDPYTTLKENLIYACAELERHSLTALIEPVNQHSVPGYYLSSFRVAERLIRELRAHGIS 181
           +E  + T  ENL YA   L    +  LIEP+N   +PGY+L+S   A  LI E+   G  
Sbjct: 115 TEAMWATFVENLRYAADLLAAEGIRLLIEPLNLRDMPGYFLTSQEQALALIDEV---GRP 171

Query: 182 NVQLQFDFFNAQRICGDLTHTFGACRDLIGHVQIAQAPDRQEPHARGEIDYAYVFELLAR 241
           N+ LQ D ++AQ + G+LT         IGHVQIA  P R EP   GEI+Y Y+F+ L  
Sbjct: 172 NLFLQLDLYHAQIMEGNLTRLLREYLPKIGHVQIADVPGRHEP-GTGEINYPYLFKALDA 230

Query: 242 EGYEGYVGLEYKPQGNTKEGLEEFLKTFD 270
            GY+G++G EYKP+G+T+ GL  F     
Sbjct: 231 MGYDGWIGCEYKPRGDTEAGLGWFRPYRT 259

Length = 260

>gnl\|CDD\|163190 TIGR03234, OH-pyruv-isom, hydroxypyruvate isomerase	Back alignment and domain information

>gnl\|CDD\|182188 PRK09997, PRK09997, hydroxypyruvate isomerase; Provisional	Back alignment and domain information

>gnl\|CDD\|182185 PRK09989, PRK09989, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|216395 pfam01261, AP_endonuc_2, Xylose isomerase-like TIM barrel	Back alignment and domain information

>gnl\|CDD\|224007 COG1082, IolE, Sugar phosphate isomerases/epimerases [Carbohydrate transport and metabolism]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		273
COG3622		260	Hfi Hydroxypyruvate isomerase [Carbohydrate transp	100.0
PRK09989		258	hypothetical protein; Provisional	100.0
PRK09997		258	hydroxypyruvate isomerase; Provisional	100.0
TIGR03234		254	OH-pyruv-isom hydroxypyruvate isomerase. This enzy	100.0
PRK09856		275	fructoselysine 3-epimerase; Provisional	100.0
TIGR00542		279	hxl6Piso_put hexulose-6-phosphate isomerase, putat	100.0
PRK13210		284	putative L-xylulose 5-phosphate 3-epimerase; Revie	100.0
KOG4518\|consensus		264		100.0
PRK13209		283	L-xylulose 5-phosphate 3-epimerase; Reviewed	100.0
TIGR02631		382	xylA_Arthro xylose isomerase, Arthrobacter type. T	100.0
PRK01060		281	endonuclease IV; Provisional	100.0
cd00019		279	AP2Ec AP endonuclease family 2; These endonuclease	100.0
PRK12677		384	xylose isomerase; Provisional	100.0
COG1082		274	IolE Sugar phosphate isomerases/epimerases [Carboh	100.0
smart00518		273	AP2Ec AP endonuclease family 2. These endonuclease	100.0
TIGR00587		274	nfo apurinic endonuclease (APN1). All proteins in	99.96
COG3623		287	SgaU Putative L-xylulose-5-phosphate 3-epimerase [	99.96
PF01261		213	AP_endonuc_2: Xylose isomerase-like TIM barrel; In	99.95
PTZ00372		413	endonuclease 4-like protein; Provisional	99.94
PRK03906		385	mannonate dehydratase; Provisional	99.9
COG4130		272	Predicted sugar epimerase [Carbohydrate transport	99.89
COG0648		280	Nfo Endonuclease IV [DNA replication, recombinatio	99.86
TIGR02635		378	RhaI_grampos L-rhamnose isomerase, Streptomyces su	99.84
TIGR02630		434	xylose_isom_A xylose isomerase. Members of this fa	99.78
PRK05474		437	xylose isomerase; Provisional	99.78
TIGR00695		394	uxuA mannonate dehydratase. This Fe2+-requiring en	99.69
PRK02308		303	uvsE putative UV damage endonuclease; Provisional	99.65
PRK12465		445	xylose isomerase; Provisional	99.63
PF03786		351	UxuA: D-mannonate dehydratase (UxuA); InterPro: IP	99.63
TIGR02629		412	L_rham_iso_rhiz L-rhamnose catabolism isomerase, P	99.63
COG1312		362	UxuA D-mannonate dehydratase [Carbohydrate transpo	99.48
KOG3997\|consensus		281		99.41
PLN02923		478	xylose isomerase	99.35
TIGR00629		312	uvde UV damage endonuclease UvdE. This family is b	99.03
PF03851		275	UvdE: UV-endonuclease UvdE; InterPro: IPR004601 Sc	98.5
TIGR01748		414	rhaA L-rhamnose isomerase. This enzyme interconver	98.39
PRK01076		419	L-rhamnose isomerase; Provisional	98.35
PF07582		55	AP_endonuc_2_N: AP endonuclease family 2 C terminu	98.33
PRK05409		281	hypothetical protein; Provisional	98.19
PF05114		274	DUF692: Protein of unknown function (DUF692); Inte	98.09
COG2115		438	XylA Xylose isomerase [Carbohydrate transport and	98.03
COG4294		347	Uve UV damage repair endonuclease [DNA replication	97.89
COG4952		430	Predicted sugar isomerase [Cell envelope biogenesi	97.75
PF00682		237	HMGL-like: HMGL-like of this family is not conserv	97.72
COG3220		282	Uncharacterized protein conserved in bacteria [Fun	97.72
PRK11858		378	aksA trans-homoaconitate synthase; Reviewed	97.69
cd03174		265	DRE_TIM_metallolyase DRE-TIM metallolyase superfam	97.51
cd07937		275	DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar	97.47
cd07939		259	DRE_TIM_NifV Streptomyces rubellomurinus FrbC and	97.46
PRK12331		448	oxaloacetate decarboxylase; Provisional	97.42
PRK05265		239	pyridoxine 5'-phosphate synthase; Provisional	97.38
PLN02746		347	hydroxymethylglutaryl-CoA lyase	97.25
cd07948		262	DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s	97.23
cd07945		280	DRE_TIM_CMS Leptospira interrogans citramalate syn	97.21
cd07941		273	DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3	97.16
PRK05692		287	hydroxymethylglutaryl-CoA lyase; Provisional	97.12
TIGR00977		526	LeuA_rel 2-isopropylmalate synthase/homocitrate sy	97.09
TIGR02660		365	nifV_homocitr homocitrate synthase NifV. This fami	97.09
TIGR02090		363	LEU1_arch isopropylmalate/citramalate/homocitrate	97.07
cd07943		263	DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te	97.06
cd07940		268	DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-	97.03
TIGR03217		333	4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase.	97.01
PRK09282		592	pyruvate carboxylase subunit B; Validated	96.99
COG0821		361	gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphat	96.95
cd07938		274	DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase,	96.95
PRK00915		513	2-isopropylmalate synthase; Validated	96.93
PRK08195		337	4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac	96.9
cd07944		266	DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-	96.9
TIGR00970		564	leuA_yeast 2-isopropylmalate synthase, yeast type.	96.81
PRK14041		467	oxaloacetate decarboxylase; Provisional	96.78
PRK12344		524	putative alpha-isopropylmalate/homocitrate synthas	96.72
PRK09389		488	(R)-citramalate synthase; Provisional	96.69
PF06134		417	RhaA: L-rhamnose isomerase (RhaA); InterPro: IPR00	96.57
PRK12330		499	oxaloacetate decarboxylase; Provisional	96.54
cd07942		284	DRE_TIM_LeuA Mycobacterium tuberculosis LeuA3 and	96.54
PRK12581		468	oxaloacetate decarboxylase; Provisional	96.51
TIGR01108		582	oadA oxaloacetate decarboxylase alpha subunit. Thi	96.51
TIGR00559		237	pdxJ pyridoxine 5'-phosphate synthase. PdxJ is req	96.36
PLN02321		632	2-isopropylmalate synthase	96.33
PRK14042		596	pyruvate carboxylase subunit B; Provisional	96.31
cd07947		279	DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synt	96.31
TIGR00973		494	leuA_bact 2-isopropylmalate synthase, bacterial ty	96.23
PRK14040		593	oxaloacetate decarboxylase; Provisional	96.11
PRK14847		333	hypothetical protein; Provisional	96.09
PRK12999		1146	pyruvate carboxylase; Reviewed	96.05
PRK02048		611	4-hydroxy-3-methylbut-2-en-1-yl diphosphate syntha	96.01
COG5016		472	Pyruvate/oxaloacetate carboxyltransferase [Energy	95.95
TIGR03849		237	arch_ComA phosphosulfolactate synthase. This model	95.94
PLN03228		503	methylthioalkylmalate synthase; Provisional	95.85
PF02126		308	PTE: Phosphotriesterase family; InterPro: IPR00155	95.77
PRK03739		552	2-isopropylmalate synthase; Validated	95.59
TIGR00612		346	ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-dipho	95.55
PF02679		244	ComA: (2R)-phospho-3-sulfolactate synthase (ComA);	95.31
cd00003		234	PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase	95.28
PLN02925		733	4-hydroxy-3-methylbut-2-en-1-yl diphosphate syntha	95.26
PRK00366		360	ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate s	95.18
PF10566		273	Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro:	95.06
PF03932		201	CutC: CutC family; InterPro: IPR005627 Copper tran	94.97
COG0119		409	LeuA Isopropylmalate/homocitrate/citramalate synth	94.67
PRK00694		606	4-hydroxy-3-methylbut-2-en-1-yl diphosphate syntha	94.55
COG0854		243	PdxJ Pyridoxal phosphate biosynthesis protein [Coe	94.48
COG1830		265	FbaB DhnA-type fructose-1,6-bisphosphate aldolase	94.27
PF04551		359	GcpE: GcpE protein; InterPro: IPR004588 This prote	94.14
COG3142		241	CutC Uncharacterized protein involved in copper re	94.12
PRK05474		437	xylose isomerase; Provisional	93.85
KOG0622\|consensus		448		93.82
TIGR02630		434	xylose_isom_A xylose isomerase. Members of this fa	93.81
TIGR01235		1143	pyruv_carbox pyruvate carboxylase. This enzyme pla	93.7
PF09370		268	TIM-br_sig_trns: TIM-barrel signal transduction pr	93.46
PF02784		251	Orn_Arg_deC_N: Pyridoxal-dependent decarboxylase,	93.34
PF03851		275	UvdE: UV-endonuclease UvdE; InterPro: IPR004601 Sc	93.28
COG0854		243	PdxJ Pyridoxal phosphate biosynthesis protein [Coe	93.16
TIGR01496		257	DHPS dihydropteroate synthase. This model represen	93.01
PRK09250		348	fructose-bisphosphate aldolase; Provisional	92.98
cd00945		201	Aldolase_Class_I Class I aldolases. The class I al	92.8
PRK09875		292	putative hydrolase; Provisional	92.77
PRK11572		248	copper homeostasis protein CutC; Provisional	92.57
PLN02681		455	proline dehydrogenase	92.57
PRK12465		445	xylose isomerase; Provisional	92.46
COG0036		220	Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate	92.4
PF03740		239	PdxJ: Pyridoxal phosphate biosynthesis protein Pdx	92.31
KOG2367\|consensus		560		92.04
PLN02923		478	xylose isomerase	91.44
TIGR00695		394	uxuA mannonate dehydratase. This Fe2+-requiring en	91.34
COG1964		475	Predicted Fe-S oxidoreductases [General function p	91.22
PF03740		239	PdxJ: Pyridoxal phosphate biosynthesis protein Pdx	91.01
PTZ00170		228	D-ribulose-5-phosphate 3-epimerase; Provisional	90.99
cd00959		203	DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of	90.78
cd02803		327	OYE_like_FMN_family Old yellow enzyme (OYE)-like F	90.52
cd06831		394	PLPDE_III_ODC_like_AZI Type III Pyridoxal 5-phosph	90.47
PRK08005		210	epimerase; Validated	89.84
cd02932		336	OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN	89.78
PRK06552		213	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	89.73
PF01791		236	DeoC: DeoC/LacD family aldolase; InterPro: IPR0029	89.64
PRK10812		265	putative DNAse; Provisional	89.61
COG0134		254	TrpC Indole-3-glycerol phosphate synthase [Amino a	89.52
TIGR00126		211	deoC deoxyribose-phosphate aldolase. Deoxyribose-p	89.14
PF00834		201	Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam	88.99
PRK12331		448	oxaloacetate decarboxylase; Provisional	88.98
cd06564		326	GH20_DspB_LnbB-like Glycosyl hydrolase family 20 (	88.63
PRK08208		430	coproporphyrinogen III oxidase; Validated	88.49
PRK12858		340	tagatose 1,6-diphosphate aldolase; Reviewed	88.47
TIGR00629		312	uvde UV damage endonuclease UvdE. This family is b	88.27
PRK08227		264	autoinducer 2 aldolase; Validated	88.27
cd07937		275	DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar	88.09
cd06562		348	GH20_HexA_HexB-like Beta-N-acetylhexosaminidases c	87.86
PRK11449		258	putative deoxyribonuclease YjjV; Provisional	87.68
PF10566		273	Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro:	87.55
PLN02540		565	methylenetetrahydrofolate reductase	87.48
PRK11613		282	folP dihydropteroate synthase; Provisional	87.46
PRK14040		593	oxaloacetate decarboxylase; Provisional	87.23
PRK07535		261	methyltetrahydrofolate:corrinoid/iron-sulfur prote	87.23
PRK03906		385	mannonate dehydratase; Provisional	87.11
PRK14041		467	oxaloacetate decarboxylase; Provisional	87.05
PRK11858		378	aksA trans-homoaconitate synthase; Reviewed	87.04
PF05913		357	DUF871: Bacterial protein of unknown function (DUF	87.04
cd07944		266	DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-	86.8
TIGR03128		206	RuMP_HxlA 3-hexulose-6-phosphate synthase. at the	86.64
COG0329		299	DapA Dihydrodipicolinate synthase/N-acetylneuramin	86.62
PRK07998		283	gatY putative fructose-1,6-bisphosphate aldolase;	86.59
PRK05692		287	hydroxymethylglutaryl-CoA lyase; Provisional	86.4
cd00475		221	CIS_IPPS Cis (Z)-Isoprenyl Diphosphate Synthases (	86.39
PRK12399		324	tagatose 1,6-diphosphate aldolase; Reviewed	86.24
cd07945		280	DRE_TIM_CMS Leptospira interrogans citramalate syn	86.02
cd00959		203	DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of	85.99
PLN02591		250	tryptophan synthase	85.98
PRK14837		230	undecaprenyl pyrophosphate synthase; Provisional	85.95
PF01791		236	DeoC: DeoC/LacD family aldolase; InterPro: IPR0029	85.88
PRK12581		468	oxaloacetate decarboxylase; Provisional	85.84
PF07071		218	DUF1341: Protein of unknown function (DUF1341); In	85.72
TIGR00055		226	uppS undecaprenyl diphosphate synthase. Alternate	85.68
cd03174		265	DRE_TIM_metallolyase DRE-TIM metallolyase superfam	85.6
PRK08745		223	ribulose-phosphate 3-epimerase; Provisional	85.58
cd06565		301	GH20_GcnA-like Glycosyl hydrolase family 20 (GH20)	85.56
PRK14842		241	undecaprenyl pyrophosphate synthase; Provisional	85.55
PF01026		255	TatD_DNase: TatD related DNase The Pfam entry find	85.48
cd04735		353	OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN	85.44
cd00003		234	PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase	85.35
cd00739		257	DHPS DHPS subgroup of Pterin binding enzymes. DHPS	85.34
COG1060		370	ThiH Thiamine biosynthesis enzyme ThiH and related	85.0
cd04733		338	OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN	84.88
PRK09282		592	pyruvate carboxylase subunit B; Validated	84.85
cd03557		484	L-arabinose_isomerase L-Arabinose isomerase (AI) c	84.83
TIGR01108		582	oadA oxaloacetate decarboxylase alpha subunit. Thi	84.71
PRK14042		596	pyruvate carboxylase subunit B; Provisional	84.69
cd00408		281	DHDPS-like Dihydrodipicolinate synthase family. A	84.66
cd02933		338	OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind	84.44
COG2896		322	MoaA Molybdenum cofactor biosynthesis enzyme [Coen	84.29
PRK06852		304	aldolase; Validated	84.19
PRK00507		221	deoxyribose-phosphate aldolase; Provisional	84.18
TIGR03217		333	4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase.	84.03
cd07939		259	DRE_TIM_NifV Streptomyces rubellomurinus FrbC and	84.02
PF00682		237	HMGL-like: HMGL-like of this family is not conserv	83.85
COG3142		241	CutC Uncharacterized protein involved in copper re	83.72
PF00290		259	Trp_syntA: Tryptophan synthase alpha chain; InterP	83.46
PRK14833		233	undecaprenyl pyrophosphate synthase; Provisional	83.44
PRK05581		220	ribulose-phosphate 3-epimerase; Validated	83.38
cd00953		279	KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolas	83.14
PRK14836		253	undecaprenyl pyrophosphate synthase; Provisional	83.13
PRK14841		233	undecaprenyl pyrophosphate synthase; Provisional	83.11
PRK14840		250	undecaprenyl pyrophosphate synthase; Provisional	83.08
cd01297		415	D-aminoacylase D-aminoacylases (N-acyl-D-Amino aci	82.73
PRK14839		239	undecaprenyl pyrophosphate synthase; Provisional	82.71
cd06563		357	GH20_chitobiase-like The chitobiase of Serratia ma	82.47
PRK14830		251	undecaprenyl pyrophosphate synthase; Provisional	82.46
PRK04161		329	tagatose 1,6-diphosphate aldolase; Reviewed	82.44
cd07943		263	DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te	82.36
PRK00278		260	trpC indole-3-glycerol-phosphate synthase; Reviewe	82.33
PRK10425		258	DNase TatD; Provisional	82.23
PRK10240		229	undecaprenyl pyrophosphate synthase; Provisional	82.2
cd07938		274	DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase,	82.2
PF00218		254	IGPS: Indole-3-glycerol phosphate synthase; InterP	82.17
COG5016		472	Pyruvate/oxaloacetate carboxyltransferase [Energy	82.17
TIGR01858		282	tag_bisphos_ald class II aldolase, tagatose bispho	82.15
cd06568		329	GH20_SpHex_like A subgroup of the Glycosyl hydrola	82.13
PRK14829		243	undecaprenyl pyrophosphate synthase; Provisional	82.06
TIGR00676		272	fadh2 5,10-methylenetetrahydrofolate reductase, pr	81.84
PLN02746		347	hydroxymethylglutaryl-CoA lyase	81.61
PRK08195		337	4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac	81.58
COG1831		285	Predicted metal-dependent hydrolase (urease superf	81.48
PF06180		262	CbiK: Cobalt chelatase (CbiK); InterPro: IPR010388	81.47
PRK12999		1146	pyruvate carboxylase; Reviewed	81.36
PRK14834		249	undecaprenyl pyrophosphate synthase; Provisional	81.32
cd02801		231	DUS_like_FMN Dihydrouridine synthase-like (DUS-lik	81.19
PF01116		287	F_bP_aldolase: Fructose-bisphosphate aldolase clas	81.11
PRK07709		285	fructose-bisphosphate aldolase; Provisional	81.09
PRK02261		137	methylaspartate mutase subunit S; Provisional	81.07
COG1902		363	NemA NADH:flavin oxidoreductases, Old Yellow Enzym	80.96
PRK06015		201	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	80.88
TIGR01235		1143	pyruv_carbox pyruvate carboxylase. This enzyme pla	80.86
PF01116		287	F_bP_aldolase: Fructose-bisphosphate aldolase clas	80.76
TIGR01163		210	rpe ribulose-phosphate 3-epimerase. This family co	80.62
PLN02537		410	diaminopimelate decarboxylase	80.52
TIGR01232		325	lacD tagatose 1,6-diphosphate aldolase. This famil	80.5
PRK08255		765	salicylyl-CoA 5-hydroxylase; Reviewed	80.47
PLN02623		581	pyruvate kinase	80.46
PRK14831		249	undecaprenyl pyrophosphate synthase; Provisional	80.46
PRK13753		279	dihydropteroate synthase; Provisional	80.3
PRK08599		377	coproporphyrinogen III oxidase; Provisional	80.25
PRK08207		488	coproporphyrinogen III oxidase; Provisional	80.18
CHL00200		263	trpA tryptophan synthase alpha subunit; Provisiona	80.12
PRK14827		296	undecaprenyl pyrophosphate synthase; Provisional	80.04

>COG3622 Hfi Hydroxypyruvate isomerase [Carbohydrate transport and metabolism]	Back alignment and domain information

Probab=100.00  E-value=1.4e-48  Score=312.86  Aligned_cols=253  Identities=40%  Similarity=0.669  Sum_probs=240.4

Q ss_pred             cccccccccccccccccCHHHHHHHHHHcCCCeEEecCCCCCCCHHHHHHHHHHcCCeeEEEecCCc----cccCCCCCc
Q psy13372          5 SFKLAANLTLLFNDLAANYLDKYRVAAELGFRYIESWFPPVGVTLEQLVAAQTRHGLKQVLINTEVD----ENFGYAAVK   80 (273)
Q Consensus         5 ~~k~~~~~~~~~~~~~~~~~~~l~~~~~~G~~~vEl~~~~~~~~~~~~~~~l~~~gL~i~~~~~~~~----~~~~~~~~~   80 (273)
                      |.||+.|++|+|++.  ++.+.++.++++||.+||+.+||+ .+.+.+++.++++||+...++.+.+    +++|.+..|
T Consensus         1 mprfAAnlsMlf~e~--pFl~Rf~aaa~aGF~~ve~lfPyd-~~~~~i~~~l~~~~L~~~Lfn~pagDw~~gErg~aalp   77 (260)
T COG3622           1 MPRFAANLSMLFTEV--PFLERFAAAAKAGFRGVEFLFPYD-YDAEELKARLDFNGLTQVLFNLPAGDWAAGERGIAALP   77 (260)
T ss_pred             CccchhhHHhhhccC--cHHHHHHHHHHcCCceEEEcCCCc-ccHHHHHHHHHHcCCceeeeCCCCcchhhhhcchhcCC
Confidence            559999999999999  999999999999999999999998 8899999999999999999998776    567777788


Q ss_pred             hhHHHHHHHHHHHHHHHHHcCCCeEEecCCCCCCCCCCCCCCcchHHHHHHHHHHHHHHHhhCCcEEEEccCCCCCCCCc
Q psy13372         81 GKESEFRASLEKTIQYACALNIPAIHIMSGKTESSRTQPIASEDPYTTLKENLIYACAELERHSLTALIEPVNQHSVPGY  160 (273)
Q Consensus        81 ~~~~~~~~~~~~~i~~a~~lG~~~i~~~~G~~~~~~~~~~~~~~~~~~~~~~l~~l~~~a~~~gv~i~lE~~~~~~~~~~  160 (273)
                      .+.+.....+.++++.|..||++.|++.+|..+.+.+    .+..+..+++.|+..++.++++||++.|||+++.++|+.
T Consensus        78 ~r~~~fr~~v~~a~~ya~aLg~~~vh~mag~~p~~~~----~~~~~~t~venLr~aAd~l~~~gi~~liEplN~~d~PG~  153 (260)
T COG3622          78 GREEEFRLGVALAIEYATALGCKQVHCLAGIPPEGVD----TEAMWATFVENLRYAADLLAAEGIRLLIEPLNLRDMPGY  153 (260)
T ss_pred             CchHHHHhHHHHHHHHHHHhCCCceeeeecCCCCCcc----HHHHHHHHHHHHHHHHHHHHhcCCEEEEecCCCCCCCCc
Confidence            8888889999999999999999999999998866543    788899999999999999999999999999999989999


Q ss_pred             ccCCHHHHHHHHHHHhhcCCCceeEeeecccccccCCChHHHHHhcCCcceeEEeccCCCCCCCCCCCcccHHHHHHHHH
Q psy13372        161 YLSSFRVAERLIRELRAHGISNVQLQFDFFNAQRICGDLTHTFGACRDLIGHVQIAQAPDRQEPHARGEIDYAYVFELLA  240 (273)
Q Consensus       161 ~~~~~~~~~~li~~~~~~~~~~~g~~~D~~h~~~~~~~~~~~i~~~~~~i~~vHi~d~~~~~~~g~~G~id~~~i~~~L~  240 (273)
                      ++.+..++..++   +++++||+.+.+|++|+|..++++...++++.++|.||+|.|+|+|++||+ |+|||.-+++.|.
T Consensus       154 ~l~~~~~al~li---~~V~~~Nl~lq~D~YH~Q~~eGnL~~~lr~~~~~ighvQiAdvP~RhEPgt-GEINY~~lf~~l~  229 (260)
T COG3622         154 FLTSQEQALALI---DEVGRPNLFLQLDLYHAQIMEGNLTRLLREYLPKIGHVQIADVPGRHEPGT-GEINYPYLFKALD  229 (260)
T ss_pred             ccccHHHHHHHH---HHhCCCCeEeehhHHHHHHhccHHHHHHHHhhhhhceeeecCCCCCCCCCC-CccccHHHHHHHH
Confidence            999999999999   999999999999999999999999999999999999999999999999999 9999999999999


Q ss_pred             HcCCCceEEEeeecCCChHHHHHHHHHhh
Q psy13372        241 REGYEGYVGLEYKPQGNTKEGLEEFLKTF  269 (273)
Q Consensus       241 ~~gy~g~~~lE~~~~~~~~~~~~~~~~~~  269 (273)
                      +.||+||+..|++|.+++.+++. |++.+
T Consensus       230 ~~GY~GwIGcEy~p~g~T~~gL~-wf~~~  257 (260)
T COG3622         230 AMGYDGWIGCEYKPRGDTEAGLG-WFRPY  257 (260)
T ss_pred             HcCCCCceeeeeccCCCchHHHH-HHHHh
Confidence            99999999999999999999999 99875

>PRK09989 hypothetical protein; Provisional	Back alignment and domain information

>PRK09997 hydroxypyruvate isomerase; Provisional	Back alignment and domain information

>TIGR03234 OH-pyruv-isom hydroxypyruvate isomerase	Back alignment and domain information

>PRK09856 fructoselysine 3-epimerase; Provisional	Back alignment and domain information

>TIGR00542 hxl6Piso_put hexulose-6-phosphate isomerase, putative	Back alignment and domain information

>PRK13210 putative L-xylulose 5-phosphate 3-epimerase; Reviewed	Back alignment and domain information

>KOG4518\|consensus	Back alignment and domain information

>PRK13209 L-xylulose 5-phosphate 3-epimerase; Reviewed	Back alignment and domain information

>TIGR02631 xylA_Arthro xylose isomerase, Arthrobacter type	Back alignment and domain information

>PRK01060 endonuclease IV; Provisional	Back alignment and domain information

>cd00019 AP2Ec AP endonuclease family 2; These endonucleases play a role in DNA repair	Back alignment and domain information

>PRK12677 xylose isomerase; Provisional	Back alignment and domain information

>COG1082 IolE Sugar phosphate isomerases/epimerases [Carbohydrate transport and metabolism]	Back alignment and domain information

>smart00518 AP2Ec AP endonuclease family 2	Back alignment and domain information

>TIGR00587 nfo apurinic endonuclease (APN1)	Back alignment and domain information

>COG3623 SgaU Putative L-xylulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF01261 AP_endonuc_2: Xylose isomerase-like TIM barrel; InterPro: IPR012307 This TIM alpha/beta barrel structure is found in xylose isomerase (P19148 from SWISSPROT) and in endonuclease IV (P12638 from SWISSPROT, 3	Back alignment and domain information

>PTZ00372 endonuclease 4-like protein; Provisional	Back alignment and domain information

>PRK03906 mannonate dehydratase; Provisional	Back alignment and domain information

>COG4130 Predicted sugar epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG0648 Nfo Endonuclease IV [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02635 RhaI_grampos L-rhamnose isomerase, Streptomyces subtype	Back alignment and domain information

>TIGR02630 xylose_isom_A xylose isomerase	Back alignment and domain information

>PRK05474 xylose isomerase; Provisional	Back alignment and domain information

>TIGR00695 uxuA mannonate dehydratase	Back alignment and domain information

>PRK02308 uvsE putative UV damage endonuclease; Provisional	Back alignment and domain information

>PRK12465 xylose isomerase; Provisional	Back alignment and domain information

>PF03786 UxuA: D-mannonate dehydratase (UxuA); InterPro: IPR004628 This Fe2+-requiring enzyme plays a role in D-glucuronate catabolism in Escherichia coli	Back alignment and domain information

>TIGR02629 L_rham_iso_rhiz L-rhamnose catabolism isomerase, Pseudomonas stutzeri subtype	Back alignment and domain information

>COG1312 UxuA D-mannonate dehydratase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG3997\|consensus	Back alignment and domain information

>PLN02923 xylose isomerase	Back alignment and domain information

>TIGR00629 uvde UV damage endonuclease UvdE	Back alignment and domain information

>PF03851 UvdE: UV-endonuclease UvdE; InterPro: IPR004601 Schizosaccharomyces pombe ultraviolet damage endonuclease (UVDE or Uve1p) performs the initial step in an alternative excision repair pathway for UV-induced DNA damage	Back alignment and domain information

>TIGR01748 rhaA L-rhamnose isomerase	Back alignment and domain information

>PRK01076 L-rhamnose isomerase; Provisional	Back alignment and domain information

>PF07582 AP_endonuc_2_N: AP endonuclease family 2 C terminus; InterPro: IPR011418 DNA damaging agents such as the anti-tumour drugs bleomycin and neocarzinostatin or those that generate oxygen radicals produce a variety of lesions in DNA	Back alignment and domain information

>PRK05409 hypothetical protein; Provisional	Back alignment and domain information

>PF05114 DUF692: Protein of unknown function (DUF692); InterPro: IPR007801 The proteins in this entry are functionally uncharacterised	Back alignment and domain information

>COG2115 XylA Xylose isomerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG4294 Uve UV damage repair endonuclease [DNA replication, recombination, and repair]	Back alignment and domain information

>COG4952 Predicted sugar isomerase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members	Back alignment and domain information

>COG3220 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK11858 aksA trans-homoaconitate synthase; Reviewed	Back alignment and domain information

>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily	Back alignment and domain information

>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain	Back alignment and domain information

>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain	Back alignment and domain information

>PRK12331 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>PRK05265 pyridoxine 5'-phosphate synthase; Provisional	Back alignment and domain information

>PLN02746 hydroxymethylglutaryl-CoA lyase	Back alignment and domain information

>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain	Back alignment and domain information

>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional	Back alignment and domain information

>TIGR00977 LeuA_rel 2-isopropylmalate synthase/homocitrate synthase family protein	Back alignment and domain information

>TIGR02660 nifV_homocitr homocitrate synthase NifV	Back alignment and domain information

>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases	Back alignment and domain information

>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain	Back alignment and domain information

>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase	Back alignment and domain information

>PRK09282 pyruvate carboxylase subunit B; Validated	Back alignment and domain information

>COG0821 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Lipid metabolism]	Back alignment and domain information

>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain	Back alignment and domain information

>PRK00915 2-isopropylmalate synthase; Validated	Back alignment and domain information

>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated	Back alignment and domain information

>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>TIGR00970 leuA_yeast 2-isopropylmalate synthase, yeast type	Back alignment and domain information

>PRK14041 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional	Back alignment and domain information

>PRK09389 (R)-citramalate synthase; Provisional	Back alignment and domain information

>PF06134 RhaA: L-rhamnose isomerase (RhaA); InterPro: IPR009308 This family consists of several bacterial L-rhamnose isomerase proteins (5	Back alignment and domain information

>PRK12330 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>cd07942 DRE_TIM_LeuA Mycobacterium tuberculosis LeuA3 and related proteins, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PRK12581 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit	Back alignment and domain information

>TIGR00559 pdxJ pyridoxine 5'-phosphate synthase	Back alignment and domain information

>PLN02321 2-isopropylmalate synthase	Back alignment and domain information

>PRK14042 pyruvate carboxylase subunit B; Provisional	Back alignment and domain information

>cd07947 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synthase and related proteins, catalytic TIM barrel domain	Back alignment and domain information

>TIGR00973 leuA_bact 2-isopropylmalate synthase, bacterial type	Back alignment and domain information

>PRK14040 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>PRK14847 hypothetical protein; Provisional	Back alignment and domain information

>PRK12999 pyruvate carboxylase; Reviewed	Back alignment and domain information

>PRK02048 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Provisional	Back alignment and domain information

>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion]	Back alignment and domain information

>TIGR03849 arch_ComA phosphosulfolactate synthase	Back alignment and domain information

>PLN03228 methylthioalkylmalate synthase; Provisional	Back alignment and domain information

>PF02126 PTE: Phosphotriesterase family; InterPro: IPR001559 Synonym(s): Paraoxonase, A-esterase, Aryltriphosphatase, Phosphotriesterase, Paraoxon hydrolase Bacteria such as Brevundimonas diminuta (Pseudomonas diminuta) harbour a plasmid that carries the gene for Aryldialkylphosphatase (3	Back alignment and domain information

>PRK03739 2-isopropylmalate synthase; Validated	Back alignment and domain information

>TIGR00612 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase	Back alignment and domain information

>PF02679 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); InterPro: IPR003830 Methanogenic archaea produce methane via the anaerobic reduction of acetate or single carbon compounds []	Back alignment and domain information

>cd00003 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism	Back alignment and domain information

>PLN02925 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase	Back alignment and domain information

>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed	Back alignment and domain information

>PF10566 Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: IPR019563 O-Glycosyl hydrolases 3	Back alignment and domain information

>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF	Back alignment and domain information

>COG0119 LeuA Isopropylmalate/homocitrate/citramalate synthases [Amino acid transport and metabolism]	Back alignment and domain information

>PRK00694 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Validated	Back alignment and domain information

>COG0854 PdxJ Pyridoxal phosphate biosynthesis protein [Coenzyme metabolism]	Back alignment and domain information

>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF04551 GcpE: GcpE protein; InterPro: IPR004588 This protein previously of unknown biochemical function is essential in Escherichia coli	Back alignment and domain information

>COG3142 CutC Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK05474 xylose isomerase; Provisional	Back alignment and domain information

>KOG0622\|consensus	Back alignment and domain information

>TIGR02630 xylose_isom_A xylose isomerase	Back alignment and domain information

>TIGR01235 pyruv_carbox pyruvate carboxylase	Back alignment and domain information

>PF09370 TIM-br_sig_trns: TIM-barrel signal transduction protein; InterPro: IPR009215 Members of this family are predicted to have a TIM barrel fold, based on PSI-BLAST analysis (iteration 4) and on SCOP prediction (using SMART)	Back alignment and domain information

>PF02784 Orn_Arg_deC_N: Pyridoxal-dependent decarboxylase, pyridoxal binding domain; InterPro: IPR022644 These enzymes are collectively known as group IV decarboxylases []	Back alignment and domain information

>PF03851 UvdE: UV-endonuclease UvdE; InterPro: IPR004601 Schizosaccharomyces pombe ultraviolet damage endonuclease (UVDE or Uve1p) performs the initial step in an alternative excision repair pathway for UV-induced DNA damage	Back alignment and domain information

>COG0854 PdxJ Pyridoxal phosphate biosynthesis protein [Coenzyme metabolism]	Back alignment and domain information

>TIGR01496 DHPS dihydropteroate synthase	Back alignment and domain information

>PRK09250 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>cd00945 Aldolase_Class_I Class I aldolases	Back alignment and domain information

>PRK09875 putative hydrolase; Provisional	Back alignment and domain information

>PRK11572 copper homeostasis protein CutC; Provisional	Back alignment and domain information

>PLN02681 proline dehydrogenase	Back alignment and domain information

>PRK12465 xylose isomerase; Provisional	Back alignment and domain information

>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF03740 PdxJ: Pyridoxal phosphate biosynthesis protein PdxJ; InterPro: IPR004569 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal)	Back alignment and domain information

>KOG2367\|consensus	Back alignment and domain information

>PLN02923 xylose isomerase	Back alignment and domain information

>TIGR00695 uxuA mannonate dehydratase	Back alignment and domain information

>COG1964 Predicted Fe-S oxidoreductases [General function prediction only]	Back alignment and domain information

>PF03740 PdxJ: Pyridoxal phosphate biosynthesis protein PdxJ; InterPro: IPR004569 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal)	Back alignment and domain information

>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional	Back alignment and domain information

>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family	Back alignment and domain information

>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain	Back alignment and domain information

>cd06831 PLPDE_III_ODC_like_AZI Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Ornithine Decarboxylase-like Antizyme Inhibitor	Back alignment and domain information

>PRK08005 epimerase; Validated	Back alignment and domain information

>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain	Back alignment and domain information

>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism	Back alignment and domain information

>PRK10812 putative DNAse; Provisional	Back alignment and domain information

>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR00126 deoC deoxyribose-phosphate aldolase	Back alignment and domain information

>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5	Back alignment and domain information

>PRK12331 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>cd06564 GH20_DspB_LnbB-like Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins	Back alignment and domain information

>PRK08208 coproporphyrinogen III oxidase; Validated	Back alignment and domain information

>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed	Back alignment and domain information

>TIGR00629 uvde UV damage endonuclease UvdE	Back alignment and domain information

>PRK08227 autoinducer 2 aldolase; Validated	Back alignment and domain information

>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain	Back alignment and domain information

>cd06562 GH20_HexA_HexB-like Beta-N-acetylhexosaminidases catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides	Back alignment and domain information

>PRK11449 putative deoxyribonuclease YjjV; Provisional	Back alignment and domain information

>PF10566 Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: IPR019563 O-Glycosyl hydrolases 3	Back alignment and domain information

>PLN02540 methylenetetrahydrofolate reductase	Back alignment and domain information

>PRK11613 folP dihydropteroate synthase; Provisional	Back alignment and domain information

>PRK14040 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>PRK07535 methyltetrahydrofolate:corrinoid/iron-sulfur protein methyltransferase; Validated	Back alignment and domain information

>PRK03906 mannonate dehydratase; Provisional	Back alignment and domain information

>PRK14041 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>PRK11858 aksA trans-homoaconitate synthase; Reviewed	Back alignment and domain information

>PF05913 DUF871: Bacterial protein of unknown function (DUF871); InterPro: IPR008589 This family consists of several conserved hypothetical proteins from bacteria and archaea	Back alignment and domain information

>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase	Back alignment and domain information

>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed	Back alignment and domain information

>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional	Back alignment and domain information

>cd00475 CIS_IPPS Cis (Z)-Isoprenyl Diphosphate Synthases (cis-IPPS); homodimers which catalyze the successive 1'-4 condensation of the isopentenyl diphosphate (IPP) molecule to trans,trans-farnesyl diphosphate (FPP) or to cis,trans-FPP to form long-chain polyprenyl diphosphates	Back alignment and domain information

>PRK12399 tagatose 1,6-diphosphate aldolase; Reviewed	Back alignment and domain information

>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family	Back alignment and domain information

>PLN02591 tryptophan synthase	Back alignment and domain information

>PRK14837 undecaprenyl pyrophosphate synthase; Provisional	Back alignment and domain information

>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism	Back alignment and domain information

>PRK12581 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>PF07071 DUF1341: Protein of unknown function (DUF1341); InterPro: IPR010763 Members of this family of relatively uncommon proteins are found in both Gram-positive (e	Back alignment and domain information

>TIGR00055 uppS undecaprenyl diphosphate synthase	Back alignment and domain information

>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily	Back alignment and domain information

>PRK08745 ribulose-phosphate 3-epimerase; Provisional	Back alignment and domain information

>cd06565 GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins	Back alignment and domain information

>PRK14842 undecaprenyl pyrophosphate synthase; Provisional	Back alignment and domain information

>PF01026 TatD_DNase: TatD related DNase The Pfam entry finds members not in the Prosite definition	Back alignment and domain information

>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4	Back alignment and domain information

>cd00003 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism	Back alignment and domain information

>cd00739 DHPS DHPS subgroup of Pterin binding enzymes	Back alignment and domain information

>COG1060 ThiH Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only]	Back alignment and domain information

>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2	Back alignment and domain information

>PRK09282 pyruvate carboxylase subunit B; Validated	Back alignment and domain information

>cd03557 L-arabinose_isomerase L-Arabinose isomerase (AI) catalyzes the isomerization of L-arabinose to L-ribulose, the first reaction in its conversion into D-xylulose-5-phosphate, an intermediate in the pentose phosphate pathway, which allows L-arabinose to be used as a carbon source	Back alignment and domain information

>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit	Back alignment and domain information

>PRK14042 pyruvate carboxylase subunit B; Provisional	Back alignment and domain information

>cd00408 DHDPS-like Dihydrodipicolinate synthase family	Back alignment and domain information

>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain	Back alignment and domain information

>COG2896 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme metabolism]	Back alignment and domain information

>PRK06852 aldolase; Validated	Back alignment and domain information

>PRK00507 deoxyribose-phosphate aldolase; Provisional	Back alignment and domain information

>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase	Back alignment and domain information

>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain	Back alignment and domain information

>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members	Back alignment and domain information

>COG3142 CutC Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4	Back alignment and domain information

>PRK14833 undecaprenyl pyrophosphate synthase; Provisional	Back alignment and domain information

>PRK05581 ribulose-phosphate 3-epimerase; Validated	Back alignment and domain information

>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea	Back alignment and domain information

>PRK14836 undecaprenyl pyrophosphate synthase; Provisional	Back alignment and domain information

>PRK14841 undecaprenyl pyrophosphate synthase; Provisional	Back alignment and domain information

>PRK14840 undecaprenyl pyrophosphate synthase; Provisional	Back alignment and domain information

>cd01297 D-aminoacylase D-aminoacylases (N-acyl-D-Amino acid amidohydrolases) catalyze the hydrolysis of N-acyl-D-amino acids to produce the corresponding D-amino acids, which are used as intermediates in the synthesis of pesticides, bioactive peptides, and antibiotics	Back alignment and domain information

>PRK14839 undecaprenyl pyrophosphate synthase; Provisional	Back alignment and domain information

>cd06563 GH20_chitobiase-like The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin	Back alignment and domain information

>PRK14830 undecaprenyl pyrophosphate synthase; Provisional	Back alignment and domain information

>PRK04161 tagatose 1,6-diphosphate aldolase; Reviewed	Back alignment and domain information

>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed	Back alignment and domain information

>PRK10425 DNase TatD; Provisional	Back alignment and domain information

>PRK10240 undecaprenyl pyrophosphate synthase; Provisional	Back alignment and domain information

>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain	Back alignment and domain information

>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4	Back alignment and domain information

>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion]	Back alignment and domain information

>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family	Back alignment and domain information

>cd06568 GH20_SpHex_like A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex)	Back alignment and domain information

>PRK14829 undecaprenyl pyrophosphate synthase; Provisional	Back alignment and domain information

>TIGR00676 fadh2 5,10-methylenetetrahydrofolate reductase, prokaryotic form	Back alignment and domain information

>PLN02746 hydroxymethylglutaryl-CoA lyase	Back alignment and domain information

>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated	Back alignment and domain information

>COG1831 Predicted metal-dependent hydrolase (urease superfamily) [General function prediction only]	Back alignment and domain information

>PF06180 CbiK: Cobalt chelatase (CbiK); InterPro: IPR010388 This group, typified by Salmonella typhimurium CbiK, contains anaerobic cobalt chelatases that act in the anaerobic cobalamin biosynthesis pathway [, ]	Back alignment and domain information

>PRK12999 pyruvate carboxylase; Reviewed	Back alignment and domain information

>PRK14834 undecaprenyl pyrophosphate synthase; Provisional	Back alignment and domain information

>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain	Back alignment and domain information

>PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate	Back alignment and domain information

>PRK07709 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>PRK02261 methylaspartate mutase subunit S; Provisional	Back alignment and domain information

>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion]	Back alignment and domain information

>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>TIGR01235 pyruv_carbox pyruvate carboxylase	Back alignment and domain information

>PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate	Back alignment and domain information

>TIGR01163 rpe ribulose-phosphate 3-epimerase	Back alignment and domain information

>PLN02537 diaminopimelate decarboxylase	Back alignment and domain information

>TIGR01232 lacD tagatose 1,6-diphosphate aldolase	Back alignment and domain information

>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed	Back alignment and domain information

>PLN02623 pyruvate kinase	Back alignment and domain information

>PRK14831 undecaprenyl pyrophosphate synthase; Provisional	Back alignment and domain information

>PRK13753 dihydropteroate synthase; Provisional	Back alignment and domain information

>PRK08599 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK08207 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>CHL00200 trpA tryptophan synthase alpha subunit; Provisional	Back alignment and domain information

>PRK14827 undecaprenyl pyrophosphate synthase; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		273
3ngf_A		269	Crystal Structure Of Ap Endonuclease, Family 2 From		2e-40
1k77_A		260	Crystal Structure Of Ec1530, A Putative Oxygenase F		2e-29

>pdb|3NGF|A Chain A, Crystal Structure Of Ap Endonuclease, Family 2 From Brucella Melitensis Length = 269

Back alignment and structure

Iteration: 1

Score = 162 bits (410), Expect = 2e-40, Method: Compositional matrix adjust. Identities = 98/263 (37%), Positives = 145/263 (55%), Gaps = 16/263 (6%) Query: 7 KLAANLTLLFNDLAANYLDKYRVAAELGFRYIESWFPPVGVTLEQLVAAQTRHGLKQVLI 66 + AANL+ +FN++ +L+++R+AAE GF +E FP + + +H L QVL Sbjct: 11 RFAANLSTMFNEVP--FLERFRLAAEAGFGGVEFLFP-YDFDADVIARELKQHNLTQVLF 67 Query: 67 NTEVDE----NFGYAAVKGKESEFRASLEKTIQYACALNIPAIHIMSGKTESSRTQPIAS 122 N + G AA+ G+E EFR +++ + YA AL+ +H MSG TE + A Sbjct: 68 NMPPGDWAAGERGMAAISGREQEFRDNVDIALHYALALDCRTLHAMSGITEGLDRK--AC 125 Query: 123 EDPYTTLKENLIYACAELERHSLTALIEPVNQHSVPGYYLSSFRVAERLIRELRAHGISN 182 E+ T EN YA +L H +T L+EP+N ++PGY++ A L++ + N Sbjct: 126 EE---TFIENFRYAADKLAPHGITVLVEPLNTRNMPGYFIVHQLEAVGLVKRVNR---PN 179 Query: 183 VQLQFDFFNAQRICGDLTHTFGACRDLIGHVQIAQAPDRQEPHARGEIDYAYVFELLARE 242 V +Q D ++AQ + GDLT HVQIA PDR EP GE++Y Y+F +L Sbjct: 180 VAVQLDLYHAQIMDGDLTRLIEKMNGAFSHVQIASVPDRHEPD-EGELNYPYLFSVLESV 238 Query: 243 GYEGYVGLEYKPQGNTKEGLEEF 265 GY G+VG EY P+G T+ GL F Sbjct: 239 GYRGWVGCEYNPRGKTESGLAWF 261

PyMOL of 3ngf

>pdb|1K77|A Chain A, Crystal Structure Of Ec1530, A Putative Oxygenase From Escherichia Coli Length = 260

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		273
3ngf_A		269	AP endonuclease, family 2; structural genomics, se	1e-73
1k77_A		260	EC1530, hypothetical protein YGBM; TIM barrel, str	2e-72
3kws_A		287	Putative sugar isomerase; structural genomics, joi	4e-67
2zvr_A		290	Uncharacterized protein TM_0416; hyperthermophIle,	2e-57
3vni_A		294	Xylose isomerase domain protein TIM barrel; D-psic	1e-52
2qul_A		290	D-tagatose 3-epimerase; beta/alpha barrel, isomera	9e-50
2hk0_A		309	D-psicose 3-epimerase; TIM-barrel, isomerase; 2.00	3e-46
1i60_A		278	IOLI protein; beta barrel, structural genomics, PS	1e-31
3u0h_A		281	Xylose isomerase domain protein; structural genomi	3e-28
3qc0_A		275	Sugar isomerase; TIM barrel, structural genomics,	3e-27
2qw5_A		335	Xylose isomerase-like TIM barrel; putative sugar p	1e-25
3cqj_A		295	L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barre	5e-23
2g0w_A		296	LMO2234 protein; putative sugar isomerase, structu	3e-22
2q02_A		272	Putative cytoplasmic protein; structural genomics,	2e-21
3dx5_A		286	Uncharacterized protein ASBF; beta-alpha barrel, p	5e-21
3tva_A		290	Xylose isomerase domain protein TIM barrel; struct	7e-17
3qxb_A		316	Putative xylose isomerase; structural genomics, jo	2e-15
2zds_A		340	Putative DNA-binding protein; TIM-barrel fold, str	1e-08
3l23_A		303	Sugar phosphate isomerase/epimerase; structural ge	5e-08
3obe_A		305	Sugar phosphate isomerase/epimerase; structural ge	9e-07
3cny_A		301	Inositol catabolism protein IOLE; xylose isomerase	3e-06
3p6l_A		262	Sugar phosphate isomerase/epimerase; TIM barrel, s	1e-04
1muw_A		386	Xylose isomerase; atomic resolution, disorder; 0.8	7e-04

>3ngf_A AP endonuclease, family 2; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 1.80A {Brucella melitensis biovar abortus} Length = 269	Back alignment and structure

 Score =  225 bits (575), Expect = 1e-73
 Identities = 96/261 (36%), Positives = 143/261 (54%), Gaps = 16/261 (6%)

Query: 7   KLAANLTLLFNDLAANYLDKYRVAAELGFRYIESWFPPVGVTLEQLVAAQTRHGLKQVLI 66
           + AANL+ +FN++   +L+++R+AAE GF  +E  FP      + +     +H L QVL 
Sbjct: 11  RFAANLSTMFNEVP--FLERFRLAAEAGFGGVEFLFPY-DFDADVIARELKQHNLTQVLF 67

Query: 67  NTE----VDENFGYAAVKGKESEFRASLEKTIQYACALNIPAIHIMSGKTESSRTQPIAS 122
           N           G AA+ G+E EFR +++  + YA AL+   +H MSG TE    +  A 
Sbjct: 68  NMPPGDWAAGERGMAAISGREQEFRDNVDIALHYALALDCRTLHAMSGITEGLDRK--AC 125

Query: 123 EDPYTTLKENLIYACAELERHSLTALIEPVNQHSVPGYYLSSFRVAERLIRELRAHGISN 182
           E+ +    EN  YA  +L  H +T L+EP+N  ++PGY++     A  L++ +      N
Sbjct: 126 EETFI---ENFRYAADKLAPHGITVLVEPLNTRNMPGYFIVHQLEAVGLVKRV---NRPN 179

Query: 183 VQLQFDFFNAQRICGDLTHTFGACRDLIGHVQIAQAPDRQEPHARGEIDYAYVFELLARE 242
           V +Q D ++AQ + GDLT           HVQIA  PDR EP   GE++Y Y+F +L   
Sbjct: 180 VAVQLDLYHAQIMDGDLTRLIEKMNGAFSHVQIASVPDRHEPD-EGELNYPYLFSVLESV 238

Query: 243 GYEGYVGLEYKPQGNTKEGLE 263
           GY G+VG EY P+G T+ GL 
Sbjct: 239 GYRGWVGCEYNPRGKTESGLA 259

PyMOL of 3ngf

>1k77_A EC1530, hypothetical protein YGBM; TIM barrel, structural genomics, PSI, structure initiative; 1.63A {Escherichia coli} SCOP: c.1.15.5 Length = 260	Back alignment and structure

>3kws_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 1.68A {Parabacteroides distasonis atcc 8503} Length = 287	Back alignment and structure

>2zvr_A Uncharacterized protein TM_0416; hyperthermophIle, ketohexose 3-epimeras tagatose 3-epimerase, isomerase; 2.20A {Thermotoga maritima} Length = 290	Back alignment and structure

>3vni_A Xylose isomerase domain protein TIM barrel; D-psicose 3-epimerase, ketohexose; 1.98A {Clostridium cellulolyticum} PDB: 3vnj_A* 3vnl_A* 3vnk_A* 3vnm_A* Length = 294	Back alignment and structure

>2qul_A D-tagatose 3-epimerase; beta/alpha barrel, isomerase; 1.79A {Pseudomonas cichorii} PDB: 2ou4_A 2qum_A* 2qun_A* Length = 290	Back alignment and structure

>2hk0_A D-psicose 3-epimerase; TIM-barrel, isomerase; 2.00A {Agrobacterium tumefaciens} PDB: 2hk1_A* Length = 309	Back alignment and structure

>1i60_A IOLI protein; beta barrel, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: c.1.15.4 PDB: 1i6n_A Length = 278	Back alignment and structure

>3u0h_A Xylose isomerase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel; 2.30A {Alicyclobacillus acidocaldarius subsp} Length = 281	Back alignment and structure

>3qc0_A Sugar isomerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-biology,; HET: UNL PG4; 1.45A {Sinorhizobium meliloti} PDB: 3ju2_A Length = 275	Back alignment and structure

>2qw5_A Xylose isomerase-like TIM barrel; putative sugar phosphate isomerase/epimerase; 1.78A {Anabaena variabilis atcc 29413} Length = 335	Back alignment and structure

>3cqj_A L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barrel, isomerase, phosphate-binding motif; 2.04A {Escherichia coli} PDB: 3cqi_A 3cqh_A 3cqk_A Length = 295	Back alignment and structure

>2g0w_A LMO2234 protein; putative sugar isomerase, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE PG4; 1.70A {Listeria monocytogenes} SCOP: c.1.15.4 Length = 296	Back alignment and structure

>2q02_A Putative cytoplasmic protein; structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.40A {Salmonella typhimurium LT2} SCOP: c.1.15.4 Length = 272	Back alignment and structure

>3dx5_A Uncharacterized protein ASBF; beta-alpha barrel, petrobactin synthesis, ASB locus, structu genomics, PSI-2, protein structure initiative; HET: MSE DHB TRS; 2.12A {Bacillus anthracis} Length = 286	Back alignment and structure

>3tva_A Xylose isomerase domain protein TIM barrel; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.15A {Planctomyces limnophilus} Length = 290	Back alignment and structure

>3qxb_A Putative xylose isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 1.90A {Rhodospirillum rubrum} Length = 316	Back alignment and structure

>2zds_A Putative DNA-binding protein; TIM-barrel fold, structural genomics, NPPSFA; 2.30A {Streptomyces coelicolor} Length = 340	Back alignment and structure

>3l23_A Sugar phosphate isomerase/epimerase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.70A {Parabacteroides distasonis} Length = 303	Back alignment and structure

>3obe_A Sugar phosphate isomerase/epimerase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.70A {Parabacteroides distasonis} Length = 305	Back alignment and structure

>3cny_A Inositol catabolism protein IOLE; xylose isomerase-like TIM barrel, structural genomics, joint for structural genomics, JCSG; 1.85A {Lactobacillus plantarum WCFS1} Length = 301	Back alignment and structure

>3p6l_A Sugar phosphate isomerase/epimerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.85A {Parabacteroides distasonis} Length = 262	Back alignment and structure

>1muw_A Xylose isomerase; atomic resolution, disorder; 0.86A {Streptomyces olivochromogenes} SCOP: c.1.15.3 PDB: 1s5m_A* 1s5n_A* 2gyi_A* 1xyb_A* 1xyc_A* 1xya_A* 1xyl_A 1xym_A* 1dxi_A 3gnx_A* 1gw9_A* 1xib_A 1xic_A* 1xid_A* 1xie_A* 1xif_A* 1xig_A* 1xih_A* 1xii_A* 1xij_A ... Length = 386	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		273
3ngf_A		269	AP endonuclease, family 2; structural genomics, se	100.0
1k77_A		260	EC1530, hypothetical protein YGBM; TIM barrel, str	100.0
3kws_A		287	Putative sugar isomerase; structural genomics, joi	100.0
3vni_A		294	Xylose isomerase domain protein TIM barrel; D-psic	100.0
3qc0_A		275	Sugar isomerase; TIM barrel, structural genomics,	100.0
2qul_A		290	D-tagatose 3-epimerase; beta/alpha barrel, isomera	100.0
1i60_A		278	IOLI protein; beta barrel, structural genomics, PS	100.0
3u0h_A		281	Xylose isomerase domain protein; structural genomi	100.0
2hk0_A		309	D-psicose 3-epimerase; TIM-barrel, isomerase; 2.00	100.0
3obe_A		305	Sugar phosphate isomerase/epimerase; structural ge	100.0
3dx5_A		286	Uncharacterized protein ASBF; beta-alpha barrel, p	100.0
3cqj_A		295	L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barre	100.0
3l23_A		303	Sugar phosphate isomerase/epimerase; structural ge	100.0
3qxb_A		316	Putative xylose isomerase; structural genomics, jo	100.0
2zvr_A		290	Uncharacterized protein TM_0416; hyperthermophIle,	100.0
3aal_A		303	Probable endonuclease 4; endoiv, DNA repair, base	100.0
3cny_A		301	Inositol catabolism protein IOLE; xylose isomerase	100.0
2qw5_A		335	Xylose isomerase-like TIM barrel; putative sugar p	100.0
3tva_A		290	Xylose isomerase domain protein TIM barrel; struct	100.0
2q02_A		272	Putative cytoplasmic protein; structural genomics,	100.0
1qtw_A		285	Endonuclease IV; DNA repair enzyme, TIM barrel, tr	100.0
2g0w_A		296	LMO2234 protein; putative sugar isomerase, structu	100.0
2zds_A		340	Putative DNA-binding protein; TIM-barrel fold, str	100.0
3lmz_A		257	Putative sugar isomerase; structural genomics, joi	100.0
3aam_A		270	Endonuclease IV, endoiv; DNA repair, base excision	100.0
2x7v_A		287	Probable endonuclease 4; DNA repair protein, metal	100.0
1xla_A		394	D-xylose isomerase; isomerase(intramolecular oxido	100.0
3ktc_A		333	Xylose isomerase; putative sugar isomerase, struct	100.0
1muw_A		386	Xylose isomerase; atomic resolution, disorder; 0.8	100.0
3p6l_A		262	Sugar phosphate isomerase/epimerase; TIM barrel, s	100.0
1bxb_A		387	Xylose isomerase; xylose metabolism; 2.20A {Thermu	100.0
1xim_A		393	D-xylose isomerase; isomerase(intramolecular oxido	100.0
1a0c_A		438	Xylose isomerase; ketolisomerase, xylose metabolis	100.0
1yx1_A		264	Hypothetical protein PA2260; structural genomics,	100.0
3bdk_A		386	D-mannonate dehydratase; xylose isomerase-like TIM	99.97
1tz9_A		367	Mannonate dehydratase; alpha-beta protein, structu	99.97
3ayv_A		254	Putative uncharacterized protein TTHB071; structur	99.97
3m0m_A		438	L-rhamnose isomerase; beta/alpha barrel, HOMO-tetr	99.9
2j6v_A		301	UV endonuclease, UVDE; plasmid, TIM barrel, DNA re	99.84
3p14_A		424	L-rhamnose isomerase; TIM barrel; 2.51A {Bacillus	99.42
3tc3_A		310	UV damage endonuclease; TIM-barrel, hydrolase; 1.5	98.86
1d8w_A		426	L-rhamnose isomerase; beta-alpha-8-barrels, aldose	98.26
3bww_A		307	Protein of unknown function DUF692/COG3220; struct	98.0
1ydn_A		295	Hydroxymethylglutaryl-COA lyase; TIM-barrel protei	97.6
2ftp_A		302	Hydroxymethylglutaryl-COA lyase; structural genomi	97.53
2cw6_A		298	Hydroxymethylglutaryl-COA lyase, mitochondrial; HM	97.5
3ewb_X		293	2-isopropylmalate synthase; LEUA, structural genom	97.28
1ydo_A		307	HMG-COA lyase; TIM-barrel protein, structural geno	97.28
2nx9_A		464	Oxaloacetate decarboxylase 2, subunit alpha; carbo	97.23
1m5w_A		243	Pyridoxal phosphate biosynthetic protein PDXJ; TIM	97.02
1rqb_A		539	Transcarboxylase 5S subunit; TIM-barrel, carbamyla	96.91
3eeg_A		325	2-isopropylmalate synthase; 11106D, beta barrel, P	96.91
3gk0_A		278	PNP synthase, pyridoxine 5'-phosphate synthase; de	96.87
3rmj_A		370	2-isopropylmalate synthase; LEUA, truncation, neis	96.78
3ble_A		337	Citramalate synthase from leptospira interrogans;	96.72
3ivs_A		423	Homocitrate synthase, mitochondrial; TIM barrel, m	96.62
3hq1_A		644	2-isopropylmalate synthase; LEUA, mycobacterium tu	96.51
2ztj_A		382	Homocitrate synthase; (beta/alpha)8 TIM barrel, su	96.37
1nvm_A		345	HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered	96.32
1qwg_A		251	PSL synthase;, (2R)-phospho-3-sulfolactate synthas	96.07
1aj0_A		282	DHPS, dihydropteroate synthase; antibiotic, resist	95.03
3tr9_A		314	Dihydropteroate synthase; biosynthesis of cofactor	94.89
3ipw_A		325	Hydrolase TATD family protein; niaid, ssgcid, seat	94.85
2dqw_A		294	Dihydropteroate synthase; dimer, structural genomi	94.85
1x7f_A		385	Outer surface protein; structural genomics, unknow	94.7
2d73_A		738	Alpha-glucosidase SUSB; glycoside hydrolase family	94.66
2ekg_A		327	Proline dehydrogenase/delta-1-pyrroline-5-carboxy	94.2
1tx2_A		297	DHPS, dihydropteroate synthase; folate biosynthesi	93.99
4h6q_A		312	Proline dehydrogenase; BETA8-alpha8-barrel, flavoe	93.7
2y5s_A		294	DHPS, dihydropteroate synthase; transferase, folat	93.65
3tc3_A		310	UV damage endonuclease; TIM-barrel, hydrolase; 1.5	93.62
3bg3_A		718	Pyruvate carboxylase, mitochondrial; TIM barrel, A	93.61
3qja_A		272	IGPS, indole-3-glycerol phosphate synthase; struct	93.6
3a24_A		641	Alpha-galactosidase; glycoside hydrolase family 97	93.58
2p10_A		286	MLL9387 protein; putative phosphonopyruvate hydrol	93.25
2cks_A		306	Endoglucanase E-5; carbohydrate metabolism, polysa	93.14
3noy_A		366	4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth;	93.08
1eye_A		280	DHPS 1, dihydropteroate synthase I; alpha-beta bar	93.06
3pnz_A		330	Phosphotriesterase family protein; amidohydrolase	93.04
3iwp_A		287	Copper homeostasis protein CUTC homolog; conserved	92.94
1ub3_A		220	Aldolase protein; schiff base, deoxyribose phospha	92.92
1zzm_A		259	Putative deoxyribonuclease YJJV; hydrolaze, zinc,	92.54
3f4w_A		211	Putative hexulose 6 phosphate synthase; humps, mal	92.47
1u83_A		276	Phosphosulfolactate synthase; structural genomics,	92.36
1egz_A		291	Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL	91.9
3o6c_A		260	PNP synthase, pyridoxine 5'-phosphate synthase; st	91.66
1nvm_A		345	HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered	91.39
3tn4_A		360	Phosphotriesterase; lactonase, hydrolase; HET: KCX	91.27
2nx9_A		464	Oxaloacetate decarboxylase 2, subunit alpha; carbo	91.27
1xwy_A		264	DNAse TATD, deoxyribonuclease TATD; TIM barrael, z	91.25
1twd_A		256	Copper homeostasis protein CUTC; TIM-like protein,	91.2
3oa3_A		288	Aldolase; structural genomics, seattle structural	91.02
7a3h_A		303	Endoglucanase; hydrolase, cellulose degradation, g	90.92
3ngj_A		239	Deoxyribose-phosphate aldolase; lyase, structural	90.8
7odc_A		424	Protein (ornithine decarboxylase); pyridoxal-5'-ph	90.77
2bdq_A		224	Copper homeostasis protein CUTC; alpha beta protei	90.66
1tqj_A		230	Ribulose-phosphate 3-epimerase; beta-alpha barrel	90.39
3r12_A		260	Deoxyribose-phosphate aldolase; TIM beta/alpha-bar	90.35
3inp_A		246	D-ribulose-phosphate 3-epimerase; IDP02542, isomer	89.55
3pzt_A		327	Endoglucanase; alpha/beta barrel, glycosyl hydrola	89.26
2whl_A		294	Beta-mannanase, baman5; glycoside hydrolase, hydro	89.17
1rqb_A		539	Transcarboxylase 5S subunit; TIM-barrel, carbamyla	88.99
1tvn_A		293	Cellulase, endoglucanase G; glycoside hydrolase, C	88.93
3jug_A		345	Beta-mannanase; TIM-barrel, glycosidase, hydrolase	88.81
3ndo_A		231	Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid	88.59
4i6k_A		294	Amidohydrolase family protein; enzyme function ini	88.55
3m0z_A		249	Putative aldolase; MCSG, PSI-2, structural genomic	87.85
3iv3_A		332	Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p	87.8
3sgv_B		253	Undecaprenyl pyrophosphate synthase; alpha/beta, t	87.7
3qr3_A		340	Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A	87.67
2cho_A		716	Glucosaminidase, hexosaminiase; O-GLCNACASE, hydro	87.57
1h1n_A		305	Endo type cellulase ENGI; hydrolase, glycosyl hydr	87.52
1ub3_A		220	Aldolase protein; schiff base, deoxyribose phospha	87.31
1wky_A		464	Endo-beta-1,4-mannanase; TIM barrel, catalytic dom	87.16
3rcm_A		287	TATD family hydrolase; HET: CIT; 2.05A {Pseudomona	87.03
3m6y_A		275	4-hydroxy-2-oxoglutarate aldolase; structural geno	86.89
1twd_A		256	Copper homeostasis protein CUTC; TIM-like protein,	86.84
2p0o_A		372	Hypothetical protein DUF871; structural genomics,	86.46
1f6y_A		262	5-methyltetrahydrofolate corrinoid/iron sulfur PR	86.34
2vp8_A		318	Dihydropteroate synthase 2; RV1207 transferase, fo	86.14
3o6c_A		260	PNP synthase, pyridoxine 5'-phosphate synthase; st	86.12
3o1n_A		276	3-dehydroquinate dehydratase; structural genomics,	86.1
3ctl_A		231	D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p	86.04
4hb7_A		270	Dihydropteroate synthase; transferase; 1.95A {Stap	85.87
3irs_A		291	Uncharacterized protein BB4693; structural genomic	85.62
1k87_A		669	PUTA, proline dehydrogenase, proline dehydroge; mu	85.48
3r4v_A		315	Putative uncharacterized protein; tubulin, unknown	84.97
3ovg_A		363	Amidohydrolase; structural genomics, PSI-2, protei	84.69
4h3d_A		258	3-dehydroquinate dehydratase; structural genomics,	84.36
2gou_A		365	Oxidoreductase, FMN-binding; OLD yeallow enzyme, f	84.15
2cw6_A		298	Hydroxymethylglutaryl-COA lyase, mitochondrial; HM	84.15
3gtx_A		339	Organophosphorus hydrolase; mutant, amidohydrolase	84.09
2v9d_A		343	YAGE; dihydrodipicolinic acid synthase, N-acetyl n	84.01
3vup_A		351	Beta-1,4-mannanase; TIM barrel, digestive fluid, H	83.82
1rh9_A		373	Endo-beta-mannanase; endo-beta-mannase, retaining,	83.79
2oo0_A		471	ODC, ornithine decarboxylase; beta-alpha barrel, s	83.43
4g9p_A		406	4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth;	83.42
3tsm_A		272	IGPS, indole-3-glycerol phosphate synthase; struct	83.36
2ehh_A		294	DHDPS, dihydrodipicolinate synthase; structural ge	83.12
2yxg_A		289	DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b	83.01
2a4a_A		281	Deoxyribose-phosphate aldolase; lyase, TIM beta/al	82.61
3dxi_A		320	Putative aldolase; TIM barrel, 11107N, PSI2, NYSGX	82.49
4h8e_A		256	Undecaprenyl pyrophosphate synthase; alpha-helix,	82.19
2r8w_A		332	AGR_C_1641P; APC7498, dihydrodipicolinate synthase	82.04
1f75_A		249	Undecaprenyl pyrophosphate synthetase; parallel be	82.01
2y1h_A		272	Putative deoxyribonuclease tatdn3; hydrolase; 2.50	81.84
1p1x_A		260	Deoxyribose-phosphate aldolase; alpha-beta barrel,	81.82
1f3t_A		425	ODC, ornithine decarboxylase; beta-alpha-barrel, m	81.69
1uuq_A		440	Mannosyl-oligosaccharide glucosidase; hydrolase, m	81.55
1h1y_A		228	D-ribulose-5-phosphate 3-epimerase; oxidative pent	81.51
1yix_A		265	Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW	81.36
1f6y_A		262	5-methyltetrahydrofolate corrinoid/iron sulfur PR	81.1
3ugs_B		225	Undecaprenyl pyrophosphate synthase; niaid, csgid,	81.0
3si9_A		315	DHDPS, dihydrodipicolinate synthase; structural ge	80.78
2d2r_A		245	Undecaprenyl pyrophosphate synthase; prenyltransfe	80.76
2yci_X		271	5-methyltetrahydrofolate corrinoid/iron sulfur PR	80.69
3iwp_A		287	Copper homeostasis protein CUTC homolog; conserved	80.67
1j6o_A		268	TATD-related deoxyribonuclease; structural genomic	80.66
1bqc_A		302	Protein (beta-mannanase); glycosyl hydrolase, fami	80.65
3a24_A		641	Alpha-galactosidase; glycoside hydrolase family 97	80.6
2xio_A		301	Putative deoxyribonuclease tatdn1; hydrolase; 1.19	80.43
2ftp_A		302	Hydroxymethylglutaryl-COA lyase; structural genomi	80.24
3e2q_A		551	Proline oxidase, proline dehydrogenase; proline ut	80.19
3oa3_A		288	Aldolase; structural genomics, seattle structural	80.05

>3ngf_A AP endonuclease, family 2; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 1.80A {Brucella melitensis biovar abortus} SCOP: c.1.15.0	Back alignment and structure

Probab=100.00  E-value=2.6e-46  Score=319.40  Aligned_cols=252  Identities=37%  Similarity=0.657  Sum_probs=229.2

Q ss_pred             cccccccccccccccccCHHHHHHHHHHcCCCeEEecCCCCCCCHHHHHHHHHHcCCeeEEEecCCc-c---ccCCCCCc
Q psy13372          5 SFKLAANLTLLFNDLAANYLDKYRVAAELGFRYIESWFPPVGVTLEQLVAAQTRHGLKQVLINTEVD-E---NFGYAAVK   80 (273)
Q Consensus         5 ~~k~~~~~~~~~~~~~~~~~~~l~~~~~~G~~~vEl~~~~~~~~~~~~~~~l~~~gL~i~~~~~~~~-~---~~~~~~~~   80 (273)
                      |.+|++|.+++|.+.  ++++.++.++++||++||++.+++ .+.+++++.++++||++++++.+.. .   ..++++++
T Consensus         9 ~~~~~~~~~~~f~~~--~~~~~l~~~~~~G~~~vEl~~~~~-~~~~~~~~~l~~~gl~~~~~~~~~~~~~~~~~~~~~~~   85 (269)
T 3ngf_A            9 MPRFAANLSTMFNEV--PFLERFRLAAEAGFGGVEFLFPYD-FDADVIARELKQHNLTQVLFNMPPGDWAAGERGMAAIS   85 (269)
T ss_dssp             CCEEEEETTTSCTTS--CHHHHHHHHHHTTCSEEECSCCTT-SCHHHHHHHHHHTTCEEEEEECCCSCTTTTCCBCTTCT
T ss_pred             CcceeeechhhhccC--CHHHHHHHHHHcCCCEEEecCCcc-CCHHHHHHHHHHcCCcEEEEecCCCccccCCCCcCCCc
Confidence            569999999999998  999999999999999999998876 7899999999999999999886532 1   12234578


Q ss_pred             hhHHHHHHHHHHHHHHHHHcCCCeEEecCCCCCCCCCCCCCCcchHHHHHHHHHHHHHHHhhCCcEEEEccCCCCCCCCc
Q psy13372         81 GKESEFRASLEKTIQYACALNIPAIHIMSGKTESSRTQPIASEDPYTTLKENLIYACAELERHSLTALIEPVNQHSVPGY  160 (273)
Q Consensus        81 ~~~~~~~~~~~~~i~~a~~lG~~~i~~~~G~~~~~~~~~~~~~~~~~~~~~~l~~l~~~a~~~gv~i~lE~~~~~~~~~~  160 (273)
                      +.++..++.++++|++|+.+|++.|++++| .+...+    .++.++++++.|++++++|+++||++++||+++..+++.
T Consensus        86 ~~r~~~~~~~~~~i~~A~~lGa~~v~~~~g-~~~~~~----~~~~~~~~~~~l~~l~~~a~~~Gv~l~lE~~n~~~~~~~  160 (269)
T 3ngf_A           86 GREQEFRDNVDIALHYALALDCRTLHAMSG-ITEGLD----RKACEETFIENFRYAADKLAPHGITVLVEPLNTRNMPGY  160 (269)
T ss_dssp             TCHHHHHHHHHHHHHHHHHTTCCEEECCBC-BCTTSC----HHHHHHHHHHHHHHHHHHHGGGTCEEEECCCCTTTSTTB
T ss_pred             cHHHHHHHHHHHHHHHHHHcCCCEEEEccC-CCCCCC----HHHHHHHHHHHHHHHHHHHHHcCCEEEEeeCCcccCccc
Confidence            889999999999999999999999999998 433221    677899999999999999999999999999887555678


Q ss_pred             ccCCHHHHHHHHHHHhhcCCCceeEeeecccccccCCChHHHHHhcCCcceeEEeccCCCCCCCCCCCcccHHHHHHHHH
Q psy13372        161 YLSSFRVAERLIRELRAHGISNVQLQFDFFNAQRICGDLTHTFGACRDLIGHVQIAQAPDRQEPHARGEIDYAYVFELLA  240 (273)
Q Consensus       161 ~~~~~~~~~~li~~~~~~~~~~~g~~~D~~h~~~~~~~~~~~i~~~~~~i~~vHi~d~~~~~~~g~~G~id~~~i~~~L~  240 (273)
                      ++.+++++.+++   +.+++|++|+|+|++|+...+.++.++++.++++|.|+|++|+++++.||+ |.+||..+++.|+
T Consensus       161 ~~~~~~~~~~l~---~~v~~~~vg~~~D~~h~~~~g~d~~~~l~~~~~~i~~vHl~D~~~r~~~G~-G~id~~~~~~~L~  236 (269)
T 3ngf_A          161 FIVHQLEAVGLV---KRVNRPNVAVQLDLYHAQIMDGDLTRLIEKMNGAFSHVQIASVPDRHEPDE-GELNYPYLFSVLE  236 (269)
T ss_dssp             SCCCHHHHHHHH---HHHCCTTEEEEEEHHHHHHHTCCHHHHHHHTTTSEEEEEECCTTTCCCTTS-SSBCHHHHHHHHH
T ss_pred             hhcCHHHHHHHH---HHhCCCCCCeEEEhhhHHhhCCCHHHHHHHhhhhEEEEEEecCCCCCCCCC-CccCHHHHHHHHH
Confidence            999999999999   999999999999999999989999999999999999999999989999999 9999999999999


Q ss_pred             HcCCCceEEEeeecCCChHHHHHHHHHhh
Q psy13372        241 REGYEGYVGLEYKPQGNTKEGLEEFLKTF  269 (273)
Q Consensus       241 ~~gy~g~~~lE~~~~~~~~~~~~~~~~~~  269 (273)
                      +.||+|++++|+.|.++..+|++ ||+++
T Consensus       237 ~~gy~g~i~lE~~p~~~~~~sl~-~l~~~  264 (269)
T 3ngf_A          237 SVGYRGWVGCEYNPRGKTESGLA-WFAPY  264 (269)
T ss_dssp             HTTCCSEEEECCCCSSSGGGGGG-GGGGG
T ss_pred             HcCCCceEEEEecCCccHHHHHH-HHHHH
Confidence            99999999999999999999999 99986

PyMOL of 3ngf

>1k77_A EC1530, hypothetical protein YGBM; TIM barrel, structural genomics, PSI, structure initiative; 1.63A {Escherichia coli} SCOP: c.1.15.5	Back alignment and structure

>3kws_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 1.68A {Parabacteroides distasonis atcc 8503}	Back alignment and structure

>3vni_A Xylose isomerase domain protein TIM barrel; D-psicose 3-epimerase, ketohexose; 1.98A {Clostridium cellulolyticum} PDB: 3vnj_A* 3vnl_A* 3vnk_A* 3vnm_A*	Back alignment and structure

>3qc0_A Sugar isomerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-biology,; HET: UNL PG4; 1.45A {Sinorhizobium meliloti} PDB: 3ju2_A	Back alignment and structure

>2qul_A D-tagatose 3-epimerase; beta/alpha barrel, isomerase; 1.79A {Pseudomonas cichorii} PDB: 2ou4_A 2qum_A* 2qun_A*	Back alignment and structure

>1i60_A IOLI protein; beta barrel, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: c.1.15.4 PDB: 1i6n_A	Back alignment and structure

>3u0h_A Xylose isomerase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel; 2.30A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>2hk0_A D-psicose 3-epimerase; TIM-barrel, isomerase; 2.00A {Agrobacterium tumefaciens} PDB: 2hk1_A*	Back alignment and structure

>3obe_A Sugar phosphate isomerase/epimerase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.70A {Parabacteroides distasonis}	Back alignment and structure

>3dx5_A Uncharacterized protein ASBF; beta-alpha barrel, petrobactin synthesis, ASB locus, structu genomics, PSI-2, protein structure initiative; HET: MSE DHB TRS; 2.12A {Bacillus anthracis}	Back alignment and structure

>3cqj_A L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barrel, isomerase, phosphate-binding motif; 2.04A {Escherichia coli} PDB: 3cqi_A 3cqh_A 3cqk_A	Back alignment and structure

>3l23_A Sugar phosphate isomerase/epimerase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.70A {Parabacteroides distasonis}	Back alignment and structure

>3qxb_A Putative xylose isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 1.90A {Rhodospirillum rubrum}	Back alignment and structure

>2zvr_A Uncharacterized protein TM_0416; hyperthermophIle, ketohexose 3-epimeras tagatose 3-epimerase, isomerase; 2.20A {Thermotoga maritima}	Back alignment and structure

>3aal_A Probable endonuclease 4; endoiv, DNA repair, base excision repair, TIM barrel, DNA DA endonuclease, hydrolase, metal-binding; 1.60A {Geobacillus kaustophilus} PDB: 1xp3_A	Back alignment and structure

>3cny_A Inositol catabolism protein IOLE; xylose isomerase-like TIM barrel, structural genomics, joint for structural genomics, JCSG; 1.85A {Lactobacillus plantarum WCFS1}	Back alignment and structure

>2qw5_A Xylose isomerase-like TIM barrel; putative sugar phosphate isomerase/epimerase; 1.78A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3tva_A Xylose isomerase domain protein TIM barrel; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.15A {Planctomyces limnophilus}	Back alignment and structure

>2q02_A Putative cytoplasmic protein; structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.40A {Salmonella typhimurium LT2} SCOP: c.1.15.4	Back alignment and structure

>1qtw_A Endonuclease IV; DNA repair enzyme, TIM barrel, trinuclear Zn cluster, hydrolase; 1.02A {Escherichia coli} SCOP: c.1.15.1 PDB: 1qum_A* 2nqh_A 2nqj_A* 2nq9_A*	Back alignment and structure

>2g0w_A LMO2234 protein; putative sugar isomerase, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE PG4; 1.70A {Listeria monocytogenes} SCOP: c.1.15.4	Back alignment and structure

>2zds_A Putative DNA-binding protein; TIM-barrel fold, structural genomics, NPPSFA; 2.30A {Streptomyces coelicolor}	Back alignment and structure

>3lmz_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS isomerase; HET: MSE CIT PGE; 1.44A {Parabacteroides distasonis}	Back alignment and structure

>3aam_A Endonuclease IV, endoiv; DNA repair, base excision repair, BER, TIM barrel, endonucle hydrolase, structural genomics, NPPSFA; 1.58A {Thermus thermophilus}	Back alignment and structure

>2x7v_A Probable endonuclease 4; DNA repair protein, metal-binding, hydrolase, DNA damage, DN; 2.30A {Thermotoga maritima MSB8} PDB: 2x7w_A*	Back alignment and structure

>1xla_A D-xylose isomerase; isomerase(intramolecular oxidoreductase); 2.30A {Arthrobacter SP} SCOP: c.1.15.3 PDB: 1die_A* 1did_A 1xlb_A 1xlc_A* 1xld_A* 1xle_A 1xlf_A* 1xlg_A* 1xlh_A 1xli_A* 1xlj_A* 1xlk_A 1xll_A 1xlm_A* 4xia_A* 5xia_A*	Back alignment and structure

>3ktc_A Xylose isomerase; putative sugar isomerase, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.54A {Pectobacterium atrosepticum SCRI1043}	Back alignment and structure

>1muw_A Xylose isomerase; atomic resolution, disorder; 0.86A {Streptomyces olivochromogenes} SCOP: c.1.15.3 PDB: 1s5m_A* 1s5n_A* 2gyi_A* 1xyb_A* 1xyc_A* 1xya_A* 1xyl_A 1xym_A* 1dxi_A 3gnx_A* 1gw9_A* 1xib_A 1xic_A* 1xid_A* 1xie_A* 1xif_A* 1xig_A* 1xih_A* 1xii_A* 1xij_A ...	Back alignment and structure

>3p6l_A Sugar phosphate isomerase/epimerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.85A {Parabacteroides distasonis}	Back alignment and structure

>1bxb_A Xylose isomerase; xylose metabolism; 2.20A {Thermus thermophilus} SCOP: c.1.15.3 PDB: 1bxc_A	Back alignment and structure

>1xim_A D-xylose isomerase; isomerase(intramolecular oxidoreductse); HET: XYL; 2.20A {Actinoplanes missouriensis} SCOP: c.1.15.3 PDB: 4xim_A 5xim_A* 6xim_A* 7xim_A 8xim_A* 9xim_A* 3xin_A 2xim_A* 5xin_A* 1xin_A* 1bhw_A* 2xin_A* 3xim_A*	Back alignment and structure

>1a0c_A Xylose isomerase; ketolisomerase, xylose metabolism, glucose-fructose interconversion, hydride transfer; 2.50A {Thermoanaerobacteriumthermosulfurigenes} SCOP: c.1.15.3 PDB: 1a0d_A 1a0e_A	Back alignment and structure

>1yx1_A Hypothetical protein PA2260; structural genomics, PSI, PROT structure initiative; HET: MSE; 1.80A {Pseudomonas aeruginosa PAO1} SCOP: c.1.15.7	Back alignment and structure

>3bdk_A D-mannonate dehydratase; xylose isomerase-like TIM barrel, lyase; HET: DNO; 2.50A {Streptococcus suis} PDB: 3ban_A* 3dbn_A* 3fvm_A	Back alignment and structure

>1tz9_A Mannonate dehydratase; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium; 2.90A {Enterococcus faecalis} SCOP: c.1.15.6	Back alignment and structure

>3ayv_A Putative uncharacterized protein TTHB071; structural genomics, riken structural genomics/proteomics in RSGI, TIM barrel, unknown function; 1.85A {Thermus thermophilus} PDB: 3ayt_A	Back alignment and structure

>3m0m_A L-rhamnose isomerase; beta/alpha barrel, HOMO-tetramer, metal-binding protein, TIM isomerase; HET: AOS; 1.45A {Pseudomonas stutzeri} PDB: 3m0l_A* 3m0h_A* 3m0v_A* 3m0x_A* 3m0y_A* 3itx_A 2hcv_A* 2i57_A* 2i56_A 3ity_A 3iud_A 3iuh_A 3iui_A 3itv_A* 3itt_A* 3itl_A* 3ito_A* 4gji_A* 4gjj_A*	Back alignment and structure

>2j6v_A UV endonuclease, UVDE; plasmid, TIM barrel, DNA repair, DNA binding protein, lyase; HET: KCX ALY; 1.55A {Thermus thermophilus} PDB: 3bzg_A 3c0s_A* 3c0l_A 3c0q_A* 3bzj_A	Back alignment and structure

>3p14_A L-rhamnose isomerase; TIM barrel; 2.51A {Bacillus halodurans} SCOP: c.1.15.2 PDB: 3uu0_A 3uva_A 3uxi_A	Back alignment and structure

>3tc3_A UV damage endonuclease; TIM-barrel, hydrolase; 1.50A {Sulfolobus acidocaldarius}	Back alignment and structure

>1d8w_A L-rhamnose isomerase; beta-alpha-8-barrels, aldose-ketose isomerization, hydride shift; 1.60A {Escherichia coli} SCOP: c.1.15.2 PDB: 1de5_A* 1de6_A*	Back alignment and structure

>3bww_A Protein of unknown function DUF692/COG3220; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.20A {Haemophilus somnus}	Back alignment and structure

>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis}	Back alignment and structure

>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa}	Back alignment and structure

>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A*	Back alignment and structure

>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str}	Back alignment and structure

>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp}	Back alignment and structure

>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae}	Back alignment and structure

>1m5w_A Pyridoxal phosphate biosynthetic protein PDXJ; TIM barrel, protein-substrate complex, multi-binding states; HET: DXP; 1.96A {Escherichia coli} SCOP: c.1.24.1 PDB: 1ho1_A 1ho4_A* 1ixn_A* 1ixo_A* 1ixp_A 1ixq_A 3f4n_A*	Back alignment and structure

>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A*	Back alignment and structure

>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>3gk0_A PNP synthase, pyridoxine 5'-phosphate synthase; decode, ssgcid, niaid, SBRI, cytoplasm, pyridoxine biosynthesis, transferase; HET: DXP; 2.28A {Burkholderia pseudomallei}	Back alignment and structure

>3rmj_A 2-isopropylmalate synthase; LEUA, truncation, neisseria MENI TIM barrel, catalytic domain, dimer, leucine biosynthesis, ketoisovalerate; 1.95A {Neisseria meningitidis}	Back alignment and structure

>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A*	Back alignment and structure

>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensatio acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A*	Back alignment and structure

>3hq1_A 2-isopropylmalate synthase; LEUA, mycobacterium tuberculosis inhibition, bromopyruvate, amino-acid biosynthesis; HET: FLC; 1.70A {Mycobacterium tuberculosis} PDB: 1sr9_A 3hpz_A 3hps_A* 3fig_A 3u6w_A 3hpx_A	Back alignment and structure

>2ztj_A Homocitrate synthase; (beta/alpha)8 TIM barrel, substrate complex, amino-acid BIOS lysine biosynthesis, transferase; HET: AKG; 1.80A {Thermus thermophilus} PDB: 2ztk_A* 2zyf_A* 3a9i_A*	Back alignment and structure

>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5	Back alignment and structure

>1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1	Back alignment and structure

>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A	Back alignment and structure

>3tr9_A Dihydropteroate synthase; biosynthesis of cofactors, prosthetic groups, and carriers, transferase; HET: PT1; 1.90A {Coxiella burnetii}	Back alignment and structure

>3ipw_A Hydrolase TATD family protein; niaid, ssgcid, seattle structural genomics center for infect disease, dysentery, liver abcess; 1.95A {Entamoeba histolytica hm-1}	Back alignment and structure

>2dqw_A Dihydropteroate synthase; dimer, structural genomics; 1.65A {Thermus thermophilus} PDB: 2dza_A* 2dzb_A*	Back alignment and structure

>1x7f_A Outer surface protein; structural genomics, unknown function, MCSG, PSI, midwest center for struct genomics; 2.30A {Bacillus cereus atcc 14579} SCOP: b.62.1.2 c.1.8.12	Back alignment and structure

>2d73_A Alpha-glucosidase SUSB; glycoside hydrolase family 97, TIM barrel; 1.60A {Bacteroides thetaiotaomicron vpi-5482} PDB: 2zq0_A* 2jke_A* 2jka_A* 2jkp_A*	Back alignment and structure

>2ekg_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; flavoenzyme, prodh, beta-alpha-barrel inhibitor, inactivation, flavocyanine; HET: LYX FAD; 1.90A {Thermus thermophilus} PDB: 2g37_A*	Back alignment and structure

>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ...	Back alignment and structure

>4h6q_A Proline dehydrogenase; BETA8-alpha8-barrel, flavoenzyme, oxidoreductase; HET: FAD; 1.36A {Deinococcus radiodurans} PDB: 4h6r_A*	Back alignment and structure

>2y5s_A DHPS, dihydropteroate synthase; transferase, folate biosynthesis; HET: 78H; 1.95A {Burkholderia cenocepacia} PDB: 2y5j_A*	Back alignment and structure

>3tc3_A UV damage endonuclease; TIM-barrel, hydrolase; 1.50A {Sulfolobus acidocaldarius}	Back alignment and structure

>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A	Back alignment and structure

>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A*	Back alignment and structure

>3a24_A Alpha-galactosidase; glycoside hydrolase family 97, retaining glycosidase; HET: MES; 2.30A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9	Back alignment and structure

>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A*	Back alignment and structure

>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus}	Back alignment and structure

>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1	Back alignment and structure

>3pnz_A Phosphotriesterase family protein; amidohydrolase fold; HET: KCX; 1.60A {Listeria monocytogenes serotype 4b strorganism_taxid} SCOP: c.1.9.0	Back alignment and structure

>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens}	Back alignment and structure

>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A*	Back alignment and structure

>1zzm_A Putative deoxyribonuclease YJJV; hydrolaze, zinc, PEG, structural genomics, PSI; HET: P33; 1.80A {Escherichia coli} SCOP: c.1.9.12	Back alignment and structure

>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0	Back alignment and structure

>1u83_A Phosphosulfolactate synthase; structural genomics, phosphosulfolactate PSI, protein structure initiative, midwest center for struc genomics; 2.20A {Bacillus subtilis} SCOP: c.1.27.1	Back alignment and structure

>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3	Back alignment and structure

>3o6c_A PNP synthase, pyridoxine 5'-phosphate synthase; structural genomics, IDP90671, center for structural genomic infectious diseases; HET: MSE; 1.87A {Campylobacter jejuni subsp} SCOP: c.1.24.0 PDB: 3o6d_A*	Back alignment and structure

>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5	Back alignment and structure

>3tn4_A Phosphotriesterase; lactonase, hydrolase; HET: KCX; 1.50A {Geobacillus kaustophilus} PDB: 3tnb_A* 3tn3_A* 3tn5_A* 3tn6_A* 3ojg_A* 3orw_A* 3f4c_A* 3f4d_A*	Back alignment and structure

>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae}	Back alignment and structure

>1xwy_A DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc ION, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.1.9.12	Back alignment and structure

>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A	Back alignment and structure

>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis}	Back alignment and structure

>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A	Back alignment and structure

>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica}	Back alignment and structure

>7odc_A Protein (ornithine decarboxylase); pyridoxal-5'-phosphate, PLP, group IV decarboxylase, polyami parasitical, chemotherapy target, putrescine; HET: PLP; 1.60A {Mus musculus} SCOP: b.49.2.3 c.1.6.1 PDB: 2on3_A 1d7k_A*	Back alignment and structure

>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae}	Back alignment and structure

>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2	Back alignment and structure

>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A*	Back alignment and structure

>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp}	Back alignment and structure

>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A	Back alignment and structure

>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A	Back alignment and structure

>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A*	Back alignment and structure

>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A*	Back alignment and structure

>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus}	Back alignment and structure

>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A	Back alignment and structure

>4i6k_A Amidohydrolase family protein; enzyme function initiative, isomerase, structural; HET: CIT; 2.28A {Acinetobacter baumannii}	Back alignment and structure

>3m0z_A Putative aldolase; MCSG, PSI-2, structural genomics, protein structure initiative, midwest center for structural genomics, lyase; HET: MSE; 1.20A {Klebsiella pneumoniae subsp} PDB: 3nzr_A 3lm7_A	Back alignment and structure

>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A	Back alignment and structure

>3sgv_B Undecaprenyl pyrophosphate synthase; alpha/beta, transferase; HET: 2BJ; 1.61A {Escherichia coli} PDB: 1jp3_A* 1v7u_A* 1x06_A* 1x07_A* 2e98_A* 2e99_A* 2e9a_A* 2e9c_A* 2e9d_A* 1ueh_A 3sgt_B* 3qas_B* 3sgx_A* 3sh0_B* 3th8_A* 4h2j_A* 4h2m_A* 4h2o_B* 4h38_A* 4h3a_A* ...	Back alignment and structure

>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina}	Back alignment and structure

>2cho_A Glucosaminidase, hexosaminiase; O-GLCNACASE, hydrolase, N-acetylglucosamine; 1.85A {Bacteroides thetaiotaomicron} SCOP: a.246.1.1 c.1.8.10 d.92.2.3 PDB: 2chn_A 2vvn_A* 2vvs_A* 2x0h_A* 2xm2_A* 2w4x_A* 2w66_A* 2w67_A* 2wca_A* 2xj7_A* 2xm1_A* 2j47_A* 2jiw_A* 2wzh_A* 2wzi_A* 2j4g_A*	Back alignment and structure

>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A	Back alignment and structure

>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A*	Back alignment and structure

>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3	Back alignment and structure

>3rcm_A TATD family hydrolase; HET: CIT; 2.05A {Pseudomonas putida}	Back alignment and structure

>3m6y_A 4-hydroxy-2-oxoglutarate aldolase; structural genomics, MCSG, lyase, PSI-2, protein structure initiative; HET: MSE; 1.45A {Bacillus cereus} PDB: 3n73_A 3mux_A	Back alignment and structure

>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A	Back alignment and structure

>2p0o_A Hypothetical protein DUF871; structural genomics, TIM barrel, PF05 2, protein structure initiative, midwest center for structu genomics; 2.15A {Enterococcus faecalis}	Back alignment and structure

>1f6y_A 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; carbon dioxide fixation, cobalamin, methyltatrahydrofolate; 2.20A {Moorella thermoacetica} SCOP: c.1.21.2 PDB: 2e7f_A* 4djd_A* 4dje_A* 4djf_A* 2ogy_A*	Back alignment and structure

>2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis}	Back alignment and structure

>3o6c_A PNP synthase, pyridoxine 5'-phosphate synthase; structural genomics, IDP90671, center for structural genomic infectious diseases; HET: MSE; 1.87A {Campylobacter jejuni subsp} SCOP: c.1.24.0 PDB: 3o6d_A*	Back alignment and structure

>3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 4guf_A 4gug_A* 4guh_A* 3nnt_A* 4guj_A* 3m7w_A 3oex_A 4gfs_A* 4gui_A* 1gqn_A 1l9w_A* 1qfe_A*	Back alignment and structure

>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A*	Back alignment and structure

>4hb7_A Dihydropteroate synthase; transferase; 1.95A {Staphylococcus aureus} PDB: 1ad1_A 1ad4_A*	Back alignment and structure

>3irs_A Uncharacterized protein BB4693; structural genomics, PSI-2, protein structure initiative, TI protein; HET: GOL; 1.76A {Bordetella bronchiseptica} PDB: 3k4w_A	Back alignment and structure

>1k87_A PUTA, proline dehydrogenase, proline dehydroge; multi-functional protein, transcripti repressor, shuttling, dimer, oxidoreductase; HET: FAD 1PE; 2.00A {Escherichia coli} SCOP: a.176.1.1 c.1.23.2	Back alignment and structure

>3r4v_A Putative uncharacterized protein; tubulin, unknown function; HET: GDP; 1.67A {Pseudomonas phage 201phi2-1} PDB: 3rb8_A*	Back alignment and structure

>3ovg_A Amidohydrolase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, NYSGXRC, HAD, PSI; HET: KCX; 2.06A {Mycoplasma synoviae} PDB: 3msr_A*	Back alignment and structure

>4h3d_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, aldolase class I; HET: PGE SHL; 1.95A {Clostridium difficile} PDB: 3js3_A*	Back alignment and structure

>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A*	Back alignment and structure

>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A*	Back alignment and structure

>3gtx_A Organophosphorus hydrolase; mutant, amidohydrolase, alpha-beta barrel; HET: KCX; 1.62A {Deinococcus radiodurans} PDB: 2zc1_A* 3gti_A* 3gu9_A* 3gtf_A* 3gth_A* 3gu2_A* 3gu1_A* 3fdk_A* 3htw_A*	Back alignment and structure

>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A*	Back alignment and structure

>3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai}	Back alignment and structure

>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3	Back alignment and structure

>2oo0_A ODC, ornithine decarboxylase; beta-alpha barrel, sheet, lyase; HET: PLP; 1.90A {Homo sapiens}	Back alignment and structure

>4g9p_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; oxidoreductase, isoprenoid biosynthesis, non mevalonate PATH iron-sulphur-cluster; HET: CDI MES; 1.55A {Thermus thermophilus} PDB: 2y0f_A*	Back alignment and structure

>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0	Back alignment and structure

>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus}	Back alignment and structure

>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661}	Back alignment and structure

>2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1	Back alignment and structure

>3dxi_A Putative aldolase; TIM barrel, 11107N, PSI2, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Bacteroides vulgatus atcc 8482}	Back alignment and structure

>4h8e_A Undecaprenyl pyrophosphate synthase; alpha-helix, prenyl transferase, cell WALL biosynthesis, FAR diphosphate binding; HET: FPP; 1.30A {Staphylococcus aureus subsp}	Back alignment and structure

>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str}	Back alignment and structure

>1f75_A Undecaprenyl pyrophosphate synthetase; parallel beta sheet, NEW fold for isoprenoid synthase, peptidoglycan synthesis, transferase; 2.20A {Micrococcus luteus} SCOP: c.101.1.1	Back alignment and structure

>2y1h_A Putative deoxyribonuclease tatdn3; hydrolase; 2.50A {Homo sapiens}	Back alignment and structure

>1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A	Back alignment and structure

>1f3t_A ODC, ornithine decarboxylase; beta-alpha-barrel, modified greek KEY beta-sheet, lyase; HET: PLP; 2.00A {Trypanosoma brucei} SCOP: b.49.2.3 c.1.6.1 PDB: 1qu4_A* 1szr_C* 2tod_A* 1njj_A*	Back alignment and structure

>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A*	Back alignment and structure

>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A	Back alignment and structure

>1yix_A Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW YORK SGX center for structural genomics, nysgxrc; 1.90A {Escherichia coli} SCOP: c.1.9.12	Back alignment and structure

>1f6y_A 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; carbon dioxide fixation, cobalamin, methyltatrahydrofolate; 2.20A {Moorella thermoacetica} SCOP: c.1.21.2 PDB: 2e7f_A* 4djd_A* 4dje_A* 4djf_A* 2ogy_A*	Back alignment and structure

>3ugs_B Undecaprenyl pyrophosphate synthase; niaid, csgid, structural genomics, center for structural GEN infectious diseases; HET: FFT; 2.46A {Campylobacter jejuni} SCOP: c.101.1.0	Back alignment and structure

>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae}	Back alignment and structure

>2d2r_A Undecaprenyl pyrophosphate synthase; prenyltransferase, transferase; 1.88A {Helicobacter pylori} PDB: 2dtn_A	Back alignment and structure

>2yci_X 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; 1.78A {Carboxydothermus hydrogenoformans} PDB: 2ycj_A* 2yck_X*	Back alignment and structure

>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens}	Back alignment and structure

>1j6o_A TATD-related deoxyribonuclease; structural genomics, TM0667, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.80A {Thermotoga maritima} SCOP: c.1.9.12	Back alignment and structure

>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A*	Back alignment and structure

>3a24_A Alpha-galactosidase; glycoside hydrolase family 97, retaining glycosidase; HET: MES; 2.30A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2xio_A Putative deoxyribonuclease tatdn1; hydrolase; 1.19A {Homo sapiens}	Back alignment and structure

>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa}	Back alignment and structure

>3e2q_A Proline oxidase, proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, DNA-binding, FAD, flavoprotein, multifunctional enzyme, NAD; HET: FAD 1PE; 1.75A {Escherichia coli} PDB: 3e2r_A* 3e2s_A* 1tj2_A* 1tiw_A* 1tj0_A* 1tj1_A* 2fzm_A* 2fzn_A* 3itg_A*	Back alignment and structure

>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		273
d1k77a_		260	c.1.15.5 (A:) Hypothetical protein YgbM (EC1530) {	4e-40
d1i60a_		278	c.1.15.4 (A:) Hypothetical protein IolI {Bacillus	1e-18
d2q02a1		271	c.1.15.4 (A:1-271) Putative cytoplasmic protein ST	1e-15
d1yx1a1		250	c.1.15.7 (A:3-252) Hypothetical protein PA2260 {Ps	3e-15
d2g0wa1		275	c.1.15.4 (A:10-284) Hypothetical protein Lmo2234 {	3e-14
d1tz9a_		353	c.1.15.6 (A:) Mannonate dehydratase UxuA {Enteroco	4e-06
d1muwa_		386	c.1.15.3 (A:) D-xylose isomerase {Streptomyces oli	2e-04

>d1k77a_ c.1.15.5 (A:) Hypothetical protein YgbM (EC1530) {Escherichia coli [TaxId: 562]} Length = 260	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Xylose isomerase-like
family: Hypothetical protein YgbM (EC1530)
domain: Hypothetical protein YgbM (EC1530)
species: Escherichia coli [TaxId: 562]

 Score =  137 bits (346), Expect = 4e-40
 Identities = 83/261 (31%), Positives = 134/261 (51%), Gaps = 15/261 (5%)

Query: 7   KLAANLTLLFNDLAANYLDKYRVAAELGFRYIESWFPPVGVTLEQLVAAQTRHGLKQVLI 66
           + AANL+++F ++   +++++  A + GF  +E  FP    +  Q+     ++ L   L 
Sbjct: 3   RFAANLSMMFTEVP--FIERFAAARKAGFDAVEFLFPY-NYSTLQIQKQLEQNHLTLALF 59

Query: 67  NTEVDE----NFGYAAVKGKESEFRASLEKTIQYACALNIPAIHIMSGKTESSRTQPIAS 122
           NT   +     +G +A+ G+E E  A ++  ++YA ALN   +H+M+G           +
Sbjct: 60  NTAPGDINAGEWGLSALPGREHEAHADIDLALEYALALNCEQVHVMAGV----VPAGEDA 115

Query: 123 EDPYTTLKENLIYACAELERHSLTALIEPVNQHSVPGYYLSSFRVAERLIRELRAHGISN 182
           E       +N+ YA      H    L+E ++    P Y  SS   A  ++ E+      N
Sbjct: 116 ERYRAVFIDNIRYAADRFAPHGKRILVEALSPGVKPHYLFSSQYQALAIVEEV---ARDN 172

Query: 183 VQLQFDFFNAQRICGDLTHTFGACRDLIGHVQIAQAPDRQEPHARGEIDYAYVFELLARE 242
           V +Q D F+AQ++ G+LTH          HVQIA  PDR EP   GEI+Y ++F L    
Sbjct: 173 VFIQLDTFHAQKVDGNLTHLIRDYAGKYAHVQIAGLPDRHEPD-DGEINYPWLFRLFDEV 231

Query: 243 GYEGYVGLEYKPQGNTKEGLE 263
           GY+G++G EYKP+G T+EGL 
Sbjct: 232 GYQGWIGCEYKPRGLTEEGLG 252

PyMOL of d1k77a_

>d1i60a_ c.1.15.4 (A:) Hypothetical protein IolI {Bacillus subtilis [TaxId: 1423]} Length = 278	Back information, alignment and structure

>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Length = 271	Back information, alignment and structure

>d1yx1a1 c.1.15.7 (A:3-252) Hypothetical protein PA2260 {Pseudomonas aeruginosa [TaxId: 287]} Length = 250	Back information, alignment and structure

>d2g0wa1 c.1.15.4 (A:10-284) Hypothetical protein Lmo2234 {Listeria monocytogenes [TaxId: 1639]} Length = 275	Back information, alignment and structure

>d1tz9a_ c.1.15.6 (A:) Mannonate dehydratase UxuA {Enterococcus faecalis (Streptococcus faecalis) [TaxId: 1351]} Length = 353	Back information, alignment and structure

>d1muwa_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces olivochromogenes [TaxId: 1963]} Length = 386	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		273
d1k77a_		260	Hypothetical protein YgbM (EC1530) {Escherichia co	100.0
d1i60a_		278	Hypothetical protein IolI {Bacillus subtilis [TaxI	100.0
d2q02a1		271	Putative cytoplasmic protein STM4435 {Salmonella t	100.0
d2g0wa1		275	Hypothetical protein Lmo2234 {Listeria monocytogen	100.0
d1yx1a1		250	Hypothetical protein PA2260 {Pseudomonas aeruginos	99.98
d1qtwa_		285	Endonuclease IV {Escherichia coli [TaxId: 562]}	99.97
d1muwa_		386	D-xylose isomerase {Streptomyces olivochromogenes	99.95
d1xp3a1		297	Endonuclease IV {Bacillus anthracis [TaxId: 1392]}	99.95
d1bxba_		387	D-xylose isomerase {Thermus aquaticus, subsp. Ther	99.95
d1xima_		392	D-xylose isomerase {Actinoplanes missouriensis [Ta	99.94
d1tz9a_		353	Mannonate dehydratase UxuA {Enterococcus faecalis	99.92
d1xlma_		393	D-xylose isomerase {Arthrobacter, strain b3728 [Ta	99.91
d1a0ca_		437	D-xylose isomerase {Clostridium thermosulfurogenes	99.77
d1d8wa_		416	L-rhamnose isomerase {Escherichia coli [TaxId: 562	97.74
d1m5wa_		242	Pyridoxine 5'-phosphate synthase {Escherichia coli	96.55
d1qwga_		251	(2r)-phospho-3-sulfolactate synthase ComA {Archaeo	95.69
d7odca2		240	Eukaryotic ornithine decarboxylase {Mouse (Mus mus	95.07
d1x7fa2		244	Outer surface protein, N-terminal domain {Bacillus	94.56
d1f3ta2		240	Eukaryotic ornithine decarboxylase {Trypanosoma br	94.16
d1nvma2		289	4-hydroxy-2-oxovalerate aldolase DmpG, catalytic d	94.0
d1twda_		247	Copper homeostasis protein CutC {Shigella flexneri	93.73
d1a0ca_		437	D-xylose isomerase {Clostridium thermosulfurogenes	92.93
d1ub3a_		211	Deoxyribose-phosphate aldolase DeoC {Thermus therm	92.35
d1rh9a1		370	Beta-mannanase {Tomato (Lycopersicon esculentum) [	92.24
d1zzma1		259	Putative deoxyribonuclease YjjV {Escherichia coli	91.29
d1uuqa_		410	Exomannosidase {Cellvibrio mixtus [TaxId: 39650]}	91.2
d2flia1		217	D-ribulose-5-phosphate 3-epimerase {Streptococcus	91.16
d1o0ya_		251	Deoxyribose-phosphate aldolase DeoC {Thermotoga ma	90.42
d1xlma_		393	D-xylose isomerase {Arthrobacter, strain b3728 [Ta	89.65
d1to3a_		291	Putative aldolase YihT {Salmonella typhimurium [Ta	89.6
d1gqna_		252	Type I 3-dehydroquinate dehydratase {Salmonella ty	89.49
d1j6oa_		260	Hypothetical protein TM0667 {Thermotoga maritima [	88.95
d1tvna1		293	Endoglucanase Cel5a {Pseudoalteromonas haloplankti	88.9
d1bqca_		302	Beta-mannanase {Thermomonospora fusca [TaxId: 2021	88.22
d1o5ka_		295	Dihydrodipicolinate synthase {Thermotoga maritima	87.65
d1rpxa_		230	D-ribulose-5-phosphate 3-epimerase {Potato (Solanu	87.45
d7a3ha_		300	Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId	87.32
d1h1na_		305	Endocellulase EngI {Thermoascus aurantiacus [TaxId	86.56
d1xwya1		260	Deoxyribonuclease TatD (MttC) {Escherichia coli [T	85.85
d1wkya2		297	Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449	85.67
d2nlya1		224	Hypothetical protein BH1492 {Bacillus halodurans [	84.63
d2csua1		129	Acetate-CoA ligase alpha chain, AcdA, N-terminal d	84.25
d1egza_		291	Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId:	84.02
d1bf6a_		291	Phosphotriesterase homology protein {Escherichia c	83.59
d1f75a_		229	Undecaprenyl diphosphate synthase {Micrococcus lut	83.2
d1n7ka_		234	Deoxyribose-phosphate aldolase DeoC {Archaeon Aero	82.55
d1muwa_		386	D-xylose isomerase {Streptomyces olivochromogenes	82.16
d3bofa2		300	Cobalamin-dependent methionine synthase MetH, N-te	81.53
d3bofa1		260	Cobalamin-dependent methionine synthase MetH, C-te	81.34
d1geqa_		248	Trp synthase alpha-subunit {Archaeon Pyrococcus fu	81.25
d1ajza_		282	Dihydropteroate synthetase {Escherichia coli [TaxI	80.56
d1yixa1		265	Putative deoxyribonuclease YcfH {Escherichia coli	80.15
d1ceoa_		340	Endoglucanase CelC {Clostridium thermocellum [TaxI	80.1

>d1k77a_ c.1.15.5 (A:) Hypothetical protein YgbM (EC1530) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Xylose isomerase-like
family: Hypothetical protein YgbM (EC1530)
domain: Hypothetical protein YgbM (EC1530)
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=1.2e-43  Score=298.02  Aligned_cols=253  Identities=32%  Similarity=0.579  Sum_probs=229.9

Q ss_pred             cccccccccccccccccCHHHHHHHHHHcCCCeEEecCCCCCCCHHHHHHHHHHcCCeeEEEecCCc----cccCCCCCc
Q psy13372          5 SFKLAANLTLLFNDLAANYLDKYRVAAELGFRYIESWFPPVGVTLEQLVAAQTRHGLKQVLINTEVD----ENFGYAAVK   80 (273)
Q Consensus         5 ~~k~~~~~~~~~~~~~~~~~~~l~~~~~~G~~~vEl~~~~~~~~~~~~~~~l~~~gL~i~~~~~~~~----~~~~~~~~~   80 (273)
                      |+|||+|++++|++.  |++|+++.++++||++||++.+++ .+.+++++.++++|+++++++.+..    .....+.++
T Consensus         1 ~~~~~~~~~~~f~~~--pl~e~i~~a~~~Gf~gIEl~~~~~-~~~~~~~~~l~~~gl~~~~~~~~~~~~~~~~~~~~~~~   77 (260)
T d1k77a_           1 MPRFAANLSMMFTEV--PFIERFAAARKAGFDAVEFLFPYN-YSTLQIQKQLEQNHLTLALFNTAPGDINAGEWGLSALP   77 (260)
T ss_dssp             CCCEEEETTTSSTTS--CGGGHHHHHHHHTCSEEECSCCTT-SCHHHHHHHHHHTTCEEEEEECCCCCGGGTCSCSTTCT
T ss_pred             CCeeeeeccccCCCC--CHHHHHHHHHHhCCCEEEECCCCC-CCHHHHHHHHHHCCCcEEEEecccccccccccccccCH
Confidence            669999999999998  999999999999999999998876 7899999999999999999886432    111233467


Q ss_pred             hhHHHHHHHHHHHHHHHHHcCCCeEEecCCCCCCCCCCCCCCcchHHHHHHHHHHHHHHHhhCCcEEEEccCCCCCCCCc
Q psy13372         81 GKESEFRASLEKTIQYACALNIPAIHIMSGKTESSRTQPIASEDPYTTLKENLIYACAELERHSLTALIEPVNQHSVPGY  160 (273)
Q Consensus        81 ~~~~~~~~~~~~~i~~a~~lG~~~i~~~~G~~~~~~~~~~~~~~~~~~~~~~l~~l~~~a~~~gv~i~lE~~~~~~~~~~  160 (273)
                      ..++..++.....++.+..+|+..+++++|.......    .+..++.+.+.+++++++++++|+++++||+.+..+++.
T Consensus        78 ~~~~~~~~~~~~~~~~~~~l~~~~v~~~~~~~~~~~~----~~~~~~~~~~~l~~~~~~a~~~gi~~~~e~~~~~~~~~~  153 (260)
T d1k77a_          78 GREHEAHADIDLALEYALALNCEQVHVMAGVVPAGED----AERYRAVFIDNIRYAADRFAPHGKRILVEALSPGVKPHY  153 (260)
T ss_dssp             TCHHHHHHHHHHHHHHHHHTTCSEEECCCCBCCTTSC----HHHHHHHHHHHHHHHHHHHGGGTCEEEECCCCTTTSTTB
T ss_pred             HHHHHHHHHHHHHHHHHHhhCCCeeeecCCCCCCCcc----HHHHHHHHHHHHHHHhhHHHhcCceeecccccccccccc
Confidence            7888899999999999999999999999887654422    667888999999999999999999999999887666788


Q ss_pred             ccCCHHHHHHHHHHHhhcCCCceeEeeecccccccCCChHHHHHhcCCcceeEEeccCCCCCCCCCCCcccHHHHHHHHH
Q psy13372        161 YLSSFRVAERLIRELRAHGISNVQLQFDFFNAQRICGDLTHTFGACRDLIGHVQIAQAPDRQEPHARGEIDYAYVFELLA  240 (273)
Q Consensus       161 ~~~~~~~~~~li~~~~~~~~~~~g~~~D~~h~~~~~~~~~~~i~~~~~~i~~vHi~d~~~~~~~g~~G~id~~~i~~~L~  240 (273)
                      ++.|+.++.+++   +.++++++|+++|++|+...+.++...++.+.++|.|+|++|.++++.||+ |++||..++++|+
T Consensus       154 ~~~~~~~~~~l~---~~v~~~~~~~~~D~~h~~~~~~~~~~~~~~~~~~i~~vH~~D~~~~~~pG~-G~id~~~i~~~L~  229 (260)
T d1k77a_         154 LFSSQYQALAIV---EEVARDNVFIQLDTFHAQKVDGNLTHLIRDYAGKYAHVQIAGLPDRHEPDD-GEINYPWLFRLFD  229 (260)
T ss_dssp             SCCSHHHHHHHH---HHHCCTTEEEEEEHHHHHHHTCCHHHHHHHTTTSEEEEEECCTTTCCCSSS-SSSCHHHHHHHHH
T ss_pred             ccCCHHHHHHHH---HHhCCccccccccchhhhccCCcHHHHHHHhccccceEeecCCCCCCCCCC-cccCHHHHHHHHH
Confidence            999999999999   999999999999999999999999999999999999999999999999999 9999999999999


Q ss_pred             HcCCCceEEEeeecCCChHHHHHHHHHhh
Q psy13372        241 REGYEGYVGLEYKPQGNTKEGLEEFLKTF  269 (273)
Q Consensus       241 ~~gy~g~~~lE~~~~~~~~~~~~~~~~~~  269 (273)
                      +.||+||+++|++|.+++.+++. |++++
T Consensus       230 ~~GY~G~vs~E~~p~~~~~~~l~-~~~~~  257 (260)
T d1k77a_         230 EVGYQGWIGCEYKPRGLTEEGLG-WFDAW  257 (260)
T ss_dssp             HTTCCSCEEECCCCSSCTGGGTH-HHHHH
T ss_pred             HhCCCceEEEEeccCCCCHHHHH-HHHHH
Confidence            99999999999999999999999 99985

PyMOL of d1k77a_

>d1i60a_ c.1.15.4 (A:) Hypothetical protein IolI {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d2g0wa1 c.1.15.4 (A:10-284) Hypothetical protein Lmo2234 {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1yx1a1 c.1.15.7 (A:3-252) Hypothetical protein PA2260 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1qtwa_ c.1.15.1 (A:) Endonuclease IV {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1muwa_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces olivochromogenes [TaxId: 1963]}	Back information, alignment and structure

>d1xp3a1 c.1.15.1 (A:2-298) Endonuclease IV {Bacillus anthracis [TaxId: 1392]}	Back information, alignment and structure

>d1bxba_ c.1.15.3 (A:) D-xylose isomerase {Thermus aquaticus, subsp. Thermophilus [TaxId: 271]}	Back information, alignment and structure

>d1xima_ c.1.15.3 (A:) D-xylose isomerase {Actinoplanes missouriensis [TaxId: 1866]}	Back information, alignment and structure

>d1tz9a_ c.1.15.6 (A:) Mannonate dehydratase UxuA {Enterococcus faecalis (Streptococcus faecalis) [TaxId: 1351]}	Back information, alignment and structure

>d1xlma_ c.1.15.3 (A:) D-xylose isomerase {Arthrobacter, strain b3728 [TaxId: 1663]}	Back information, alignment and structure

>d1a0ca_ c.1.15.3 (A:) D-xylose isomerase {Clostridium thermosulfurogenes, also known as Thermoanaerobacter thermosulfurigenes [TaxId: 33950]}	Back information, alignment and structure

>d1d8wa_ c.1.15.2 (A:) L-rhamnose isomerase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1m5wa_ c.1.24.1 (A:) Pyridoxine 5'-phosphate synthase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qwga_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d7odca2 c.1.6.1 (A:44-283) Eukaryotic ornithine decarboxylase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1f3ta2 c.1.6.1 (A:44-283) Eukaryotic ornithine decarboxylase {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]}	Back information, alignment and structure

>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]}	Back information, alignment and structure

>d1a0ca_ c.1.15.3 (A:) D-xylose isomerase {Clostridium thermosulfurogenes, also known as Thermoanaerobacter thermosulfurigenes [TaxId: 33950]}	Back information, alignment and structure

>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]}	Back information, alignment and structure

>d1zzma1 c.1.9.12 (A:1-259) Putative deoxyribonuclease YjjV {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]}	Back information, alignment and structure

>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1xlma_ c.1.15.3 (A:) D-xylose isomerase {Arthrobacter, strain b3728 [TaxId: 1663]}	Back information, alignment and structure

>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]}	Back information, alignment and structure

>d1j6oa_ c.1.9.12 (A:) Hypothetical protein TM0667 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]}	Back information, alignment and structure

>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]}	Back information, alignment and structure

>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]}	Back information, alignment and structure

>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]}	Back information, alignment and structure

>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]}	Back information, alignment and structure

>d1xwya1 c.1.9.12 (A:1-260) Deoxyribonuclease TatD (MttC) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]}	Back information, alignment and structure

>d2nlya1 c.6.2.7 (A:31-254) Hypothetical protein BH1492 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]}	Back information, alignment and structure

>d1bf6a_ c.1.9.3 (A:) Phosphotriesterase homology protein {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1f75a_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Micrococcus luteus [TaxId: 1270]}	Back information, alignment and structure

>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1muwa_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces olivochromogenes [TaxId: 1963]}	Back information, alignment and structure

>d3bofa2 c.1.26.1 (A:1-300) Cobalamin-dependent methionine synthase MetH, N-terminal domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d3bofa1 c.1.21.2 (A:301-560) Cobalamin-dependent methionine synthase MetH, C-terminal domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1ajza_ c.1.21.1 (A:) Dihydropteroate synthetase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yixa1 c.1.9.12 (A:1-265) Putative deoxyribonuclease YcfH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure