Psyllid ID: psy13373

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-----
MDTEEAVRKVAQLKEKIRQLKEDLTNAETELETILEDRAFKSRPTDGASVRDDTIRRDVSNERDTNGAGQRGAHSTDSQVGDPASPEEIHREPNNVNQTTESDNPNGPVKVEDDCVWYGEVYSKFSKDITERYSRQILLDQVGVMGQEKLLNASVLIVGCGGTGSPCIQYLAASGVGTLGLADYDRVELSNLHRQVIHTTHTIGQPKVTSAKRFISAINRNTIVHAYQTLLDTSNACDIIRRYDVVVDACDNAPTRYLLNDACLREGRPLVSASALGLEGQLCVYNYKGGPCYRCIYPVPPPAETVGTCGDNGVLGPVPGVMGTLQAVETIKLLIGLPVMDKLLVYDAELSKFLSVKLRKKKEDCVCAHPADTQLVDYEVFCSSRANDKTPDISILDPTEHLTALDYRDEFLARRVAHTLLDVRSVDEFAMMSLNIASHATMADVQLMFAEAGECPAFLESLREDILAHRHVFVICRRGNDSQKVVQLLKRYVERHRPGVVYDIRNIKEGYKGWQKYVDNRIPTY
ccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccHHHHHHHHHccEEEEccccccHHHHHHHHHHcccEEEEEccccccccccccHHcccccccccHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHcccEEEEEEccEEcEEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEcccccEEEEEEccccccccccccccccccHHHHHHcccccccccccccccccccccHHHHHHHHHHccccEEEEEcccHHHHHHccccccccccHHHHHHHHHHccccHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHHcccccccccEEEccccHHHHHHHHccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccHHHHccccccccccccccccccccccHHHccHHHHHHHHHHHHcHHccHHHHHHHHHcEEEEEEcccccHHHHHHHHHccccEEEEEEcccEccccHHHHHHccccccccHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHcccEEEEccccccHHHHHHHHHHHcccccEEEEEEEEccEEEEEEcccccccccccccccccccccccccccEEcHHHHHHHHHHHHHHHHHHHccccccEEEEEEcHcccEEEEEEcccccccccccccccccccHHHHcccccccHHHcHccccHHHcccHHHHHHHHHcccccEEEEEcccccEEEEEEccccEEccHHHHHcccHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHcHHHHHcccccHHHHHHHHHHHHHHcccccccc
MDTEEAVRKVAQLKEKIRQLKEDLTNAETELETILEdrafksrptdgasvrddtirrdvsnerdtngagqrgahstdsqvgdpaspeeihrepnnvnqttesdnpngpvkveddcvWYGEVYSKFSKDITERYSRQILLDQVGVMGQEKLLNASVLIVgcggtgspcIQYLAAsgvgtlgladydrvelsNLHRQVIHtthtigqpkvtsAKRFISAINRNTIVHAYQTLLdtsnacdiirrYDVVVdacdnaptryllndaclregrplvsasalglegqlcvynykggpcyrciypvpppaetvgtcgdngvlgpvpgvmgTLQAVETIKLLIGLPVMDKLLVYDAELSKFLSVKLRkkkedcvcahpadtqlvDYEVFCssrandktpdisildptehltaldYRDEFLARRVAHTlldvrsvdEFAMMSLNIASHATMADVQLMFAEAGECPAFLESLREDILAHRHVFVICRRGNDSQKVVQLLKRYVErhrpgvvydiRNIKEGYKGWQKYVDNRIPTY
MDTEEAVRKVAQLKEKIrqlkedltnaeteletiledrafksrptdgasvrddtirrdvsnerdtngagqrgahstdsqvGDPASPEEIhrepnnvnqttesdnpngpvKVEDDCVWYGEVYSKFSKDITERYSRQILLDQVGVMGQEKLLNASVLIVGCGGTGSPCIQYLAASGVGTLGLADYDRVELSNLHRQVIhtthtigqpkvtsAKRFISAINRNTIVHAYQTLLDTSNACDIIRRYDVVVDACDNAPTRYLLNDACLREGRPLVSASALGLEGQLCVYNYKGGPCYRCIYPVPPPAETVGTCGDNGVLGPVPGVMGTLQAVETIKLLIGLPVMDKLLVYDAELSKFLSVKlrkkkedcvcahpadtqlvdYEVFCSSRandktpdisildpteHLTALDYRDEFLARRVAHTLLDVRSVDEFAMMSLNIASHATMADVQLMFAEAGECPAFLESLREDILAHRHVFVIcrrgndsqKVVQLLKryverhrpgvvydirnikegykgwqkyvdnripty
MDTEEAVRKVAQLKEKIRQLKEDLTNAETELETILEDRAFKSRPTDGASVRDDTIRRDVSNERDTNGAGQRGAHSTDSQVGDPASPEEIHREPNNVNQTTESDNPNGPVKVEDDCVWYGEVYSKFSKDITERYSRQILLDQVGVMGQEKLLNASVLIVGCGGTGSPCIQYLAASGVGTLGLADYDRVELSNLHRQVIHTTHTIGQPKVTSAKRFISAINRNTIVHAYQTLLDTSNACDIIRRYDVVVDACDNAPTRYLLNDACLREGRPLVSASALGLEGQLCVYNYKGGPCYRCIYPVPPPAETVGTCGDNGVLGPVPGVMGTLQAVETIKLLIGLPVMDKLLVYDAELSKFLSVKLRKKKEDCVCAHPADTQLVDYEVFCSSRANDKTPDISILDPTEHLTALDYRDEFLARRVAHTLLDVRSVDEFAMMSLNIASHATMADVQLMFAEAGECPAFLESLREDILAHRHVFVICRRGNDSQKVVQLLKRYVERHRPGVVYDIRNIKEGYKGWQKYVDNRIPTY
**************************************************************************************************************VEDDCVWYGEVYSKFSKDITERYSRQILLDQVGVMGQEKLLNASVLIVGCGGTGSPCIQYLAASGVGTLGLADYDRVELSNLHRQVIHTTHTIGQPKVTSAKRFISAINRNTIVHAYQTLLDTSNACDIIRRYDVVVDACDNAPTRYLLNDACLREGRPLVSASALGLEGQLCVYNYKGGPCYRCIYPVPPPAETVGTCGDNGVLGPVPGVMGTLQAVETIKLLIGLPVMDKLLVYDAELSKFLSVKLRKKKEDCVCAHPADTQLVDYEVFCSSRANDKTPDISILDPTEHLTALDYRDEFLARRVAHTLLDVRSVDEFAMMSLNIASHATMADVQL****************EDILAHRHVFVICRRGNDSQKVVQLLKRYVERHRPGVVYDIRNIKEGYKGWQKYVDN*****
***********QLKEKIRQLKEDLTNAETELETILEDRA*************************************************************************************FSKDITERYSRQILLDQVGVMGQEKLLNASVLIVGCGGTGSPCIQYLAASGVGTLGLADYDRVELSNLHRQVIHTTHTIGQPKVTSAKRFISAINRNTIVHAYQTLLDTSNACDIIRRYDVVVDACDNAPTRYLLNDACLREGRPLVSASALGLEGQLCVYNYKGGPCYRCIYPVPPPAETVGTCGDNGVLGPVPGVMGTLQAVETIKLLIGLPVMDKLLVYDAELSKFLSVKLRKKKEDCVCAHPADTQLVDYEVFCSSR*************TEHLTALDYRDEFLARRVAHTLLDVRSVDEFAMMSLNIASHATMADVQLMFAE*G************ILAHRHVFVICRRGNDSQKVVQLLKRYVERHRPGVVYDIRNIKEGYKGWQKYVDNRIPTY
*********VAQLKEKIRQLKEDLTNAETELETILEDRAFKS*********DDTIRRDVSN***************************IHREPNNVNQTTESDNPNGPVKVEDDCVWYGEVYSKFSKDITERYSRQILLDQVGVMGQEKLLNASVLIVGCGGTGSPCIQYLAASGVGTLGLADYDRVELSNLHRQVIHTTHTIGQPKVTSAKRFISAINRNTIVHAYQTLLDTSNACDIIRRYDVVVDACDNAPTRYLLNDACLREGRPLVSASALGLEGQLCVYNYKGGPCYRCIYPVPPPAETVGTCGDNGVLGPVPGVMGTLQAVETIKLLIGLPVMDKLLVYDAELSKFLSVKLRKKKEDCVCAHPADTQLVDYEVFCSSRANDKTPDISILDPTEHLTALDYRDEFLARRVAHTLLDVRSVDEFAMMSLNIASHATMADVQLMFAEAGECPAFLESLREDILAHRHVFVICRRGNDSQKVVQLLKRYVERHRPGVVYDIRNIKEGYKGWQKYVDNRIPTY
****EAVRKVAQLKEKIRQLKEDLTNAETELETILEDRAFK******************************************ASPEEI****N****T******************YGEVYSKFSKDITERYSRQILLDQVGVMGQEKLLNASVLIVGCGGTGSPCIQYLAASGVGTLGLADYDRVELSNLHRQVIHTTHTIGQPKVTSAKRFISAINRNTIVHAYQTLLDTSNACDIIRRYDVVVDACDNAPTRYLLNDACLREGRPLVSASALGLEGQLCVYNYKGGPCYRCIYPVPPPAETVGTCGDNGVLGPVPGVMGTLQAVETIKLLIGLPVMDKLLVYDAELSKFLSVKLRKKKEDCVCAHPADTQLVDYEVFCSSRANDKTPDISILDPTEHLTALDYRDEFLARRVAHTLLDVRSVDEFAMMSLNIASHATMADVQLMFAEAGECPAFLESLREDILAHRHVFVICRRGNDSQKVVQLLKRYVERHRPGVVYDIRNIKEGYKGWQKYVDNRIPTY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRAFKSRPTDGASVRDDTIRRDVSNERDTNGAGQRGAHSTDSQVGDPASPEEIHREPNNVNQTTESDNPNGPVKVEDDCVWYGEVYSKFSKDITERYSRQILLDQVGVMGQEKLLNASVLIVGCGGTGSPCIQYLAASGVGTLGLADYDRVELSNLHRQVIHTTHTIGQPKVTSAKRFISAINRNTIVHAYQTLLDTSNACDIIRRYDVVVDACDNAPTRYLLNDACLREGRPLVSASALGLEGQLCVYNYKGGPCYRCIYPVPPPAETVGTCGDNGVLGPVPGVMGTLQAVETIKLLIGLPVMDKLLVYDAELSKFLSVKLRKKKEDCVCAHPADTQLVDYEVFCSSRANDKTPDISILDPTEHLTALDYRDEFLARRVAHTLLDVRSVDEFAMMSLNIASHATMADVQLMFAEAGECPAFLESLREDILAHRHVFVICRRGNDSQKVVQLLKRYVERHRPGVVYDIRNIKEGYKGWQKYVDNRIPTY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query525 2.2.26 [Sep-21-2011]
Q8AWD2459 Adenylyltransferase and s yes N/A 0.756 0.864 0.457 4e-95
B0W377438 Adenylyltransferase and s N/A N/A 0.748 0.897 0.460 8e-95
Q7PY41441 Adenylyltransferase and s yes N/A 0.748 0.891 0.453 4e-94
B4LRB9452 Adenylyltransferase and s N/A N/A 0.744 0.865 0.452 3e-92
B4JBC4449 Adenylyltransferase and s N/A N/A 0.739 0.864 0.443 5e-91
B4KI53452 Adenylyltransferase and s N/A N/A 0.740 0.860 0.439 2e-90
Q17CA7437 Adenylyltransferase and s N/A N/A 0.727 0.874 0.427 3e-90
B4NXF7453 Adenylyltransferase and s N/A N/A 0.742 0.860 0.437 2e-89
B5DS72451 Adenylyltransferase and s yes N/A 0.739 0.860 0.439 3e-88
B4GKQ3451 Adenylyltransferase and s N/A N/A 0.739 0.860 0.437 4e-88
>sp|Q8AWD2|MOCS3_DANRE Adenylyltransferase and sulfurtransferase MOCS3 OS=Danio rerio GN=mocs3 PE=2 SV=1 Back     alignment and function desciption
 Score =  349 bits (895), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 189/413 (45%), Positives = 252/413 (61%), Gaps = 16/413 (3%)

Query: 123 SKFSKDITERYSRQILLDQVGVMGQEKLLNASVLIVGCGGTGSPCIQYLAASGVGTLGLA 182
           +  + D   RYSRQ+LL ++GV GQ  + N SVL+VGCGG G P  QYLAA+G+G LGL 
Sbjct: 53  TSLNNDDIMRYSRQLLLPELGVKGQIAISNISVLVVGCGGLGCPLAQYLAAAGIGRLGLL 112

Query: 183 DYDRVELSNLHRQVIHTTHTIGQPKVTSAKRFISAINRNTIVHAYQTLLDTSNACDIIRR 242
           DYD VELSNLHRQV+HT  T GQPK  SA + IS +N       Y   L   NA  +I++
Sbjct: 113 DYDVVELSNLHRQVLHTELTQGQPKALSAAQAISRMNSTVQCVPYHLQLSRENAIQLIQQ 172

Query: 243 YDVVVDACDNAPTRYLLNDACLREGRPLVSASALGLEGQLCVYNYKGGPCYRCIYPVPPP 302
           YD+V D  DN PTRYL+NDAC+   RPLVSASAL +EGQL VYNY+GGPCYRC+YP+PPP
Sbjct: 173 YDIVADCSDNVPTRYLVNDACVLTSRPLVSASALRMEGQLTVYNYRGGPCYRCLYPIPPP 232

Query: 303 AETVGTCGDNGVLGPVPGVMGTLQAVETIKLLIG--LPVMDKLLVYDAELSKFLSVKLRK 360
            ETV  C D GVLG VPG+MG LQA+E +K+  G       +LL++D E ++F S++LR 
Sbjct: 233 PETVTNCSDGGVLGVVPGIMGCLQALEVLKIASGQECSFAQQLLMFDGEQTRFRSIRLRS 292

Query: 361 KKEDC-VCAH-PADTQLVDYEVFCSSRANDKTPDISILDPTEHLTALDYRDEFLARRVAH 418
           ++++C VC   P  T+L DYE FC S A DK   + +L   + ++  DY+   L     H
Sbjct: 293 RQKECVVCGEKPTITELQDYEHFCGSAATDKCRRLHLLSREQRVSVQDYKG-ILDHSTPH 351

Query: 419 TLLDVRSVDEFAMMSLNIASHATMADVQLMFAEAGECPAFLESLREDILAHRH------V 472
            LLDVR   E  +  L+ + H  +A ++    +  E    L+    D+  H +      V
Sbjct: 352 LLLDVRPKVEVDICRLSNSLHIPLASLE---DKKPEHITLLKEAISDLQEHLNNQSPVQV 408

Query: 473 FVICRRGNDSQKVVQLLKRYVERHRPGVVYDIRNIKEGYKGWQKYVDNRIPTY 525
           FV+C+ GNDSQK VQLL++        +   +++I  G   W K +D   P Y
Sbjct: 409 FVVCKLGNDSQKAVQLLEKMSGAEVEAMT--VKDIGGGLMAWAKKIDYCFPQY 459
Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers urm1 and mocs2a. Its N-terminus first activates urm1 and mocs2a as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to urm1 and mocs2a to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards urm1 and mocs2a. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; nfs1 probably acting as a sulfur donor for thiocarboxylation reactions.
Danio rerio (taxid: 7955)
EC: 2EC: .EC: 8EC: .EC: 1EC: .EC: 1EC: 1
>sp|B0W377|MOCS3_CULQU Adenylyltransferase and sulfurtransferase MOCS3 OS=Culex quinquefasciatus GN=CPIJ001621 PE=3 SV=1 Back     alignment and function description
>sp|Q7PY41|MOCS3_ANOGA Adenylyltransferase and sulfurtransferase MOCS3 OS=Anopheles gambiae GN=AGAP001737 PE=3 SV=4 Back     alignment and function description
>sp|B4LRB9|MOCS3_DROVI Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila virilis GN=GJ21670 PE=3 SV=1 Back     alignment and function description
>sp|B4JBC4|MOCS3_DROGR Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila grimshawi GN=GH10959 PE=3 SV=1 Back     alignment and function description
>sp|B4KI53|MOCS3_DROMO Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila mojavensis GN=GI10453 PE=3 SV=1 Back     alignment and function description
>sp|Q17CA7|MOCS3_AEDAE Adenylyltransferase and sulfurtransferase MOCS3 OS=Aedes aegypti GN=AAEL004607 PE=3 SV=1 Back     alignment and function description
>sp|B4NXF7|MOCS3_DROYA Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila yakuba GN=GE18783 PE=3 SV=1 Back     alignment and function description
>sp|B5DS72|MOC31_DROPS Adenylyltransferase and sulfurtransferase MOCS3 1 OS=Drosophila pseudoobscura pseudoobscura GN=GA24966 PE=3 SV=1 Back     alignment and function description
>sp|B4GKQ3|MOCS3_DROPE Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila persimilis GN=GL26133 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query525
41056017459 adenylyltransferase and sulfurtransferas 0.756 0.864 0.457 2e-93
170030570438 molybdenum cofactor synthesis protein 3 0.748 0.897 0.460 5e-93
156554954434 PREDICTED: adenylyltransferase and sulfu 0.716 0.866 0.449 9e-93
47938002459 Zgc:55696 [Danio rerio] 0.756 0.864 0.452 2e-92
158301689441 AGAP001737-PA [Anopheles gambiae str. PE 0.748 0.891 0.453 3e-92
195387501452 GJ21670 [Drosophila virilis] gi|22670752 0.744 0.865 0.452 2e-90
350410351464 PREDICTED: adenylyltransferase and sulfu 0.731 0.827 0.438 3e-90
340709807436 PREDICTED: adenylyltransferase and sulfu 0.731 0.880 0.438 3e-90
195030412449 GH10959 [Drosophila grimshawi] gi|226707 0.739 0.864 0.443 3e-89
307177331446 Molybdenum cofactor synthesis protein 3 0.754 0.887 0.422 1e-88
>gi|41056017|ref|NP_956421.1| adenylyltransferase and sulfurtransferase MOCS3 [Danio rerio] gi|82242672|sp|Q8AWD2.1|MOCS3_DANRE RecName: Full=Adenylyltransferase and sulfurtransferase MOCS3; AltName: Full=Molybdenum cofactor synthesis protein 3; Includes: RecName: Full=Molybdopterin-synthase adenylyltransferase; AltName: Full=Adenylyltransferase MOCS3; AltName: Full=Sulfur carrier protein MOCS2A adenylyltransferase; Includes: RecName: Full=Molybdopterin-synthase sulfurtransferase; AltName: Full=Sulfur carrier protein MOCS2A sulfurtransferase; AltName: Full=Sulfurtransferase MOCS3 gi|27503360|gb|AAH42324.1| Zgc:55696 [Danio rerio] gi|182891020|gb|AAI64541.1| Zgc:55696 protein [Danio rerio] Back     alignment and taxonomy information
 Score =  349 bits (895), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 189/413 (45%), Positives = 252/413 (61%), Gaps = 16/413 (3%)

Query: 123 SKFSKDITERYSRQILLDQVGVMGQEKLLNASVLIVGCGGTGSPCIQYLAASGVGTLGLA 182
           +  + D   RYSRQ+LL ++GV GQ  + N SVL+VGCGG G P  QYLAA+G+G LGL 
Sbjct: 53  TSLNNDDIMRYSRQLLLPELGVKGQIAISNISVLVVGCGGLGCPLAQYLAAAGIGRLGLL 112

Query: 183 DYDRVELSNLHRQVIHTTHTIGQPKVTSAKRFISAINRNTIVHAYQTLLDTSNACDIIRR 242
           DYD VELSNLHRQV+HT  T GQPK  SA + IS +N       Y   L   NA  +I++
Sbjct: 113 DYDVVELSNLHRQVLHTELTQGQPKALSAAQAISRMNSTVQCVPYHLQLSRENAIQLIQQ 172

Query: 243 YDVVVDACDNAPTRYLLNDACLREGRPLVSASALGLEGQLCVYNYKGGPCYRCIYPVPPP 302
           YD+V D  DN PTRYL+NDAC+   RPLVSASAL +EGQL VYNY+GGPCYRC+YP+PPP
Sbjct: 173 YDIVADCSDNVPTRYLVNDACVLTSRPLVSASALRMEGQLTVYNYRGGPCYRCLYPIPPP 232

Query: 303 AETVGTCGDNGVLGPVPGVMGTLQAVETIKLLIG--LPVMDKLLVYDAELSKFLSVKLRK 360
            ETV  C D GVLG VPG+MG LQA+E +K+  G       +LL++D E ++F S++LR 
Sbjct: 233 PETVTNCSDGGVLGVVPGIMGCLQALEVLKIASGQECSFAQQLLMFDGEQTRFRSIRLRS 292

Query: 361 KKEDC-VCAH-PADTQLVDYEVFCSSRANDKTPDISILDPTEHLTALDYRDEFLARRVAH 418
           ++++C VC   P  T+L DYE FC S A DK   + +L   + ++  DY+   L     H
Sbjct: 293 RQKECVVCGEKPTITELQDYEHFCGSAATDKCRRLHLLSREQRVSVQDYKG-ILDHSTPH 351

Query: 419 TLLDVRSVDEFAMMSLNIASHATMADVQLMFAEAGECPAFLESLREDILAHRH------V 472
            LLDVR   E  +  L+ + H  +A ++    +  E    L+    D+  H +      V
Sbjct: 352 LLLDVRPKVEVDICRLSNSLHIPLASLE---DKKPEHITLLKEAISDLQEHLNNQSPVQV 408

Query: 473 FVICRRGNDSQKVVQLLKRYVERHRPGVVYDIRNIKEGYKGWQKYVDNRIPTY 525
           FV+C+ GNDSQK VQLL++        +   +++I  G   W K +D   P Y
Sbjct: 409 FVVCKLGNDSQKAVQLLEKMSGAEVEAMT--VKDIGGGLMAWAKKIDYCFPQY 459

Source: Danio rerio

Species: Danio rerio

Genus: Danio

Family: Cyprinidae

Order: Cypriniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota
>gi|170030570|ref|XP_001843161.1| molybdenum cofactor synthesis protein 3 [Culex quinquefasciatus] gi|226707518|sp|B0W377.1|MOCS3_CULQU RecName: Full=Adenylyltransferase and sulfurtransferase MOCS3; AltName: Full=Molybdenum cofactor synthesis protein 3; Includes: RecName: Full=Molybdopterin-synthase adenylyltransferase; AltName: Full=Adenylyltransferase MOCS3; AltName: Full=Sulfur carrier protein MOCS2A adenylyltransferase; Includes: RecName: Full=Molybdopterin-synthase sulfurtransferase; AltName: Full=Sulfur carrier protein MOCS2A sulfurtransferase; AltName: Full=Sulfurtransferase MOCS3 gi|167867837|gb|EDS31220.1| molybdenum cofactor synthesis protein 3 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|156554954|ref|XP_001602170.1| PREDICTED: adenylyltransferase and sulfurtransferase MOCS3-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|47938002|gb|AAH71459.1| Zgc:55696 [Danio rerio] Back     alignment and taxonomy information
>gi|158301689|ref|XP_321349.4| AGAP001737-PA [Anopheles gambiae str. PEST] gi|226707554|sp|Q7PY41.4|MOCS3_ANOGA RecName: Full=Adenylyltransferase and sulfurtransferase MOCS3; AltName: Full=Molybdenum cofactor synthesis protein 3; Includes: RecName: Full=Molybdopterin-synthase adenylyltransferase; AltName: Full=Adenylyltransferase MOCS3; AltName: Full=Sulfur carrier protein MOCS2A adenylyltransferase; Includes: RecName: Full=Molybdopterin-synthase sulfurtransferase; AltName: Full=Sulfur carrier protein MOCS2A sulfurtransferase; AltName: Full=Sulfurtransferase MOCS3 gi|157012594|gb|EAA01635.4| AGAP001737-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195387501|ref|XP_002052434.1| GJ21670 [Drosophila virilis] gi|226707524|sp|B4LRB9.1|MOCS3_DROVI RecName: Full=Adenylyltransferase and sulfurtransferase MOCS3; AltName: Full=Molybdenum cofactor synthesis protein 3; Includes: RecName: Full=Molybdopterin-synthase adenylyltransferase; AltName: Full=Adenylyltransferase MOCS3; AltName: Full=Sulfur carrier protein MOCS2A adenylyltransferase; Includes: RecName: Full=Molybdopterin-synthase sulfurtransferase; AltName: Full=Sulfur carrier protein MOCS2A sulfurtransferase; AltName: Full=Sulfurtransferase MOCS3 gi|194148891|gb|EDW64589.1| GJ21670 [Drosophila virilis] Back     alignment and taxonomy information
>gi|350410351|ref|XP_003489016.1| PREDICTED: adenylyltransferase and sulfurtransferase MOCS3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340709807|ref|XP_003393492.1| PREDICTED: adenylyltransferase and sulfurtransferase MOCS3-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|195030412|ref|XP_001988062.1| GH10959 [Drosophila grimshawi] gi|226707520|sp|B4JBC4.1|MOCS3_DROGR RecName: Full=Adenylyltransferase and sulfurtransferase MOCS3; AltName: Full=Molybdenum cofactor synthesis protein 3; Includes: RecName: Full=Molybdopterin-synthase adenylyltransferase; AltName: Full=Adenylyltransferase MOCS3; AltName: Full=Sulfur carrier protein MOCS2A adenylyltransferase; Includes: RecName: Full=Molybdopterin-synthase sulfurtransferase; AltName: Full=Sulfur carrier protein MOCS2A sulfurtransferase; AltName: Full=Sulfurtransferase MOCS3 gi|193904062|gb|EDW02929.1| GH10959 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|307177331|gb|EFN66504.1| Molybdenum cofactor synthesis protein 3 [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query525
UNIPROTKB|B0W377438 CPIJ001621 "Adenylyltransferas 0.748 0.897 0.463 1.6e-92
ZFIN|ZDB-GENE-040426-782459 mocs3 "molybdenum cofactor syn 0.756 0.864 0.457 8.9e-92
UNIPROTKB|Q7PY41441 AGAP001737 "Adenylyltransferas 0.746 0.888 0.454 4.9e-91
UNIPROTKB|B4KI53452 GI10453 "Adenylyltransferase a 0.742 0.862 0.444 7.2e-88
UNIPROTKB|B4LRB9452 GJ21670 "Adenylyltransferase a 0.744 0.865 0.452 2.3e-87
UNIPROTKB|O95396460 MOCS3 "Adenylyltransferase and 0.754 0.860 0.452 4.4e-86
UNIPROTKB|B4JBC4449 GH10959 "Adenylyltransferase a 0.739 0.864 0.443 1.1e-85
UNIPROTKB|B4NXF7453 GE18783 "Adenylyltransferase a 0.742 0.860 0.440 4.9e-85
UNIPROTKB|B4N7R4457 GK18675 "Adenylyltransferase a 0.746 0.857 0.434 5e-85
UNIPROTKB|B3MLX7451 GF15533 "Adenylyltransferase a 0.746 0.869 0.435 5e-85
UNIPROTKB|B0W377 CPIJ001621 "Adenylyltransferase and sulfurtransferase MOCS3" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms
 Score = 897 (320.8 bits), Expect = 1.6e-92, Sum P(2) = 1.6e-92
 Identities = 189/408 (46%), Positives = 258/408 (63%)

Query:   123 SKFSKDITERYSRQILLDQVGVMGQEKLLNASVLIVGCGGTGSPCIQYLAASGVGTLGLA 182
             +K + +   RYSRQI+L ++GV GQ KL  ASVL+VG GG G P   YLA +GVG +G+ 
Sbjct:    41 TKLNNNEIARYSRQIILSEIGVQGQLKLKRASVLVVGAGGLGCPSSLYLAGAGVGHIGIL 100

Query:   183 DYDRVELSNLHRQVIHTTHTIGQPKVTSAKRFISAINRNTIVHAYQTLLDTSNACDIIRR 242
             DYD VEL+NLHRQ++HT  T+G  KV SA+ ++  +N    V  + T L + NA  I+ +
Sbjct:   101 DYDEVELTNLHRQLLHTESTVGLTKVDSARDYLQELNSQIEVSTHHTQLTSDNALTILEQ 160

Query:   243 YDVVVDACDNAPTRYLLNDACLREGRPLVSASALGLEGQLCVYNYKGGPCYRCIYPVPPP 302
             YD+VVDA DN  TRYLLNDAC+   +PLVS SAL LEGQL VYN+K GPCYRC++P PPP
Sbjct:   161 YDIVVDATDNVATRYLLNDACVLLKKPLVSGSALQLEGQLTVYNHKSGPCYRCLFPNPPP 220

Query:   303 AETVGTCGDNGVLGPVPGVMGTLQAVETIKLLIGLP-VMD-KLLVYDAELSKFLSVKLRK 360
              ETV  CGD GVLG + GV+G LQA+ETIK+++G   V+  +LL++D   S F ++KLR 
Sbjct:   221 PETVTNCGDGGVLGAITGVIGALQALETIKIILGNDGVLSGRLLLFDGHQSSFRNLKLRG 280

Query:   361 KKEDCV-CA-HPADTQLVDYEVFCSSRANDKTPDISILDPTEHLTALDYRDEFLARRVAH 418
             KK DCV C+ +P+ T+L+DYE FCS +A DK   + +L P E +T  +Y+   +  +  H
Sbjct:   281 KKADCVACSDNPSLTKLIDYEQFCSMKATDKDSHLDLLSPEERITVQEYKS-IVDSKQRH 339

Query:   419 TLLDVRSVDEFAMMSLNIASHATMADVQLMFAEAGECPAFLESLREDILAHRHVFVICRR 478
              L+DVR  ++F +  L  + +  + D+  +    G       S  +D +A   VFV+CRR
Sbjct:   340 VLVDVRGANQFEICQLPCSVNVPIEDI--LKNRRGVTDILGSSESDDEVA---VFVVCRR 394

Query:   479 GNDSQKVVQ-LLKRYVERHRPGVVYDIRNIKEGYKGWQKYVDNRIPTY 525
             GNDSQ  V+ L   + ER  P      R+I  G   W + VD   P Y
Sbjct:   395 GNDSQLAVRHLAPLFKERGLPTP----RDIVGGLHAWTRNVDKEFPIY 438
GO:0004792 "thiosulfate sulfurtransferase activity" evidence=ISS
GO:0005829 "cytosol" evidence=ISS
GO:0006777 "Mo-molybdopterin cofactor biosynthetic process" evidence=ISS
ZFIN|ZDB-GENE-040426-782 mocs3 "molybdenum cofactor synthesis 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q7PY41 AGAP001737 "Adenylyltransferase and sulfurtransferase MOCS3" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
UNIPROTKB|B4KI53 GI10453 "Adenylyltransferase and sulfurtransferase MOCS3" [Drosophila mojavensis (taxid:7230)] Back     alignment and assigned GO terms
UNIPROTKB|B4LRB9 GJ21670 "Adenylyltransferase and sulfurtransferase MOCS3" [Drosophila virilis (taxid:7244)] Back     alignment and assigned GO terms
UNIPROTKB|O95396 MOCS3 "Adenylyltransferase and sulfurtransferase MOCS3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B4JBC4 GH10959 "Adenylyltransferase and sulfurtransferase MOCS3" [Drosophila grimshawi (taxid:7222)] Back     alignment and assigned GO terms
UNIPROTKB|B4NXF7 GE18783 "Adenylyltransferase and sulfurtransferase MOCS3" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
UNIPROTKB|B4N7R4 GK18675 "Adenylyltransferase and sulfurtransferase MOCS3" [Drosophila willistoni (taxid:7260)] Back     alignment and assigned GO terms
UNIPROTKB|B3MLX7 GF15533 "Adenylyltransferase and sulfurtransferase MOCS3" [Drosophila ananassae (taxid:7217)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q29PG5MOC32_DROPS2, ., 8, ., 1, ., 1, 10.43730.73900.8603yesN/A
Q9ZNW0MOCS3_ARATH2, ., 8, ., 1, ., 1, 10.40890.74090.8383yesN/A
Q6FR35UBA4_CANGA2, ., 8, ., 1, ., -0.35260.71420.8660yesN/A
O59954UBA4_EMENI2, ., 8, ., 1, ., 1, 10.38200.78660.8568yesN/A
Q8AWD2MOCS3_DANRE2, ., 8, ., 1, ., 1, 10.45760.75610.8649yesN/A
Q6CBK1UBA4_YARLI2, ., 8, ., 1, ., -0.37920.67800.8989yesN/A
A3LQF9UBA4_PICST2, ., 8, ., 1, ., -0.35260.72950.8645yesN/A
Q6BHZ2UBA4_DEBHA2, ., 8, ., 1, ., -0.34940.72190.8459yesN/A
O95396MOCS3_HUMAN2, ., 8, ., 1, ., 1, 10.44470.75230.8586yesN/A
Q6CMC2UBA4_KLULA2, ., 8, ., 1, ., -0.35930.71420.8445yesN/A
Q4WV19UBA4_ASPFU2, ., 8, ., 1, ., 1, 10.37670.72950.7768yesN/A
A2BDX3MOCS3_MOUSE2, ., 8, ., 1, ., 1, 10.43520.75420.8608yesN/A
B5DS72MOC31_DROPS2, ., 8, ., 1, ., 1, 10.43980.73900.8603yesN/A
O44510MOCS3_CAEEL2, ., 8, ., 1, ., 1, 10.38660.73900.9651yesN/A
Q7PY41MOCS3_ANOGA2, ., 8, ., 1, ., 1, 10.45340.74850.8911yesN/A
A5GFZ6MOCS3_PIG2, ., 8, ., 1, ., 1, 10.44900.75420.8703yesN/A
Q9VLJ8MOCS3_DROME2, ., 8, ., 1, ., 1, 10.42190.74090.8587yesN/A
A1A4L8MOCS3_BOVIN2, ., 8, ., 1, ., 1, 10.43930.75420.8703yesN/A
Q756K6UBA4_ASHGO2, ., 8, ., 1, ., -0.33570.72190.8555yesN/A
Q55FS0MOCS3_DICDI2, ., 8, ., 1, ., 1, 10.40040.73900.9129yesN/A
Q09810UBA4_SCHPO2, ., 8, ., 1, ., -0.39180.71040.9301yesN/A
P38820UBA4_YEAST2, ., 8, ., 1, ., -0.35420.71610.8545yesN/A
A3ACF3MOCS3_ORYSJ2, ., 8, ., 1, ., 1, 10.40920.68380.8067yesN/A
A2R3H4UBA4_ASPNC2, ., 8, ., 1, ., 1, 10.38780.73520.8008yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.8.1.n1LOW CONFIDENCE prediction!
4th Layer2.7.7.n4LOW CONFIDENCE prediction!
3rd Layer2.7.70.766
3rd Layer2.8.10.766

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query525
cd00757228 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA 1e-115
PRK08762376 PRK08762, PRK08762, molybdopterin biosynthesis pro 1e-103
PRK07411390 PRK07411, PRK07411, hypothetical protein; Validate 1e-99
PRK05690245 PRK05690, PRK05690, molybdopterin biosynthesis pro 8e-98
COG0476254 COG0476, ThiF, Dinucleotide-utilizing enzymes invo 1e-87
TIGR02356202 TIGR02356, adenyl_thiF, thiazole biosynthesis aden 1e-84
PRK07878392 PRK07878, PRK07878, molybdopterin biosynthesis-lik 4e-83
PRK05597355 PRK05597, PRK05597, molybdopterin biosynthesis pro 9e-69
TIGR02355240 TIGR02355, moeB, molybdopterin synthase sulfurylas 2e-65
pfam00899134 pfam00899, ThiF, ThiF family 1e-55
PRK08328231 PRK08328, PRK08328, hypothetical protein; Provisio 8e-46
PRK05600370 PRK05600, PRK05600, thiamine biosynthesis protein 1e-45
cd01483143 cd01483, E1_enzyme_family, Superfamily of activati 1e-37
PRK07688339 PRK07688, PRK07688, thiamine/molybdopterin biosynt 2e-37
PRK12475338 PRK12475, PRK12475, thiamine/molybdopterin biosynt 1e-36
PRK08644212 PRK08644, PRK08644, thiamine biosynthesis protein 4e-31
cd00755231 cd00755, YgdL_like, Family of activating enzymes ( 2e-27
COG1179263 COG1179, COG1179, Dinucleotide-utilizing enzymes i 1e-25
cd01487174 cd01487, E1_ThiF_like, E1_ThiF_like 7e-25
pfam0523777 pfam05237, MoeZ_MoeB, MoeZ/MoeB domain 6e-20
TIGR02354200 TIGR02354, thiF_fam2, thiamine biosynthesis protei 2e-19
cd01489312 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E 1e-17
PRK08223287 PRK08223, PRK08223, hypothetical protein; Validate 2e-17
cd01484234 cd01484, E1-2_like, Ubiquitin activating enzyme (E 9e-17
cd01526122 cd01526, RHOD_ThiF, Member of the Rhodanese Homolo 2e-16
TIGR01408 1008 TIGR01408, Ube1, ubiquitin-activating enzyme E1 8e-16
cd01490435 cd01490, Ube1_repeat2, Ubiquitin activating enzyme 9e-13
cd01485198 cd01485, E1-1_like, Ubiquitin activating enzyme (E 3e-11
PRK15116268 PRK15116, PRK15116, sulfur acceptor protein CsdL; 4e-11
cd01491286 cd01491, Ube1_repeat1, Ubiquitin activating enzyme 9e-11
cd01488291 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 6e-09
PRK14852 989 PRK14852, PRK14852, hypothetical protein; Provisio 2e-08
PRK14851 679 PRK14851, PRK14851, hypothetical protein; Provisio 3e-08
cd01492197 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E 3e-07
smart00450100 smart00450, RHOD, Rhodanese Homology Domain 1e-06
PRK07877 722 PRK07877, PRK07877, hypothetical protein; Provisio 1e-06
cd0015889 cd00158, RHOD, Rhodanese Homology Domain (RHOD); a 3e-06
cd01493425 cd01493, APPBP1_RUB, Ubiquitin activating enzyme ( 2e-05
TIGR01408 1008 TIGR01408, Ube1, ubiquitin-activating enzyme E1 3e-05
pfam00581106 pfam00581, Rhodanese, Rhodanese-like domain 5e-05
COG0607110 COG0607, PspE, Rhodanese-related sulfurtransferase 2e-04
TIGR03736244 TIGR03736, PRTRC_ThiF, PRTRC system ThiF family pr 0.003
>gnl|CDD|238386 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA Back     alignment and domain information 
 Score =  338 bits (870), Expect = e-115
 Identities = 123/229 (53%), Positives = 162/229 (70%), Gaps = 3/229 (1%)

Query: 132 RYSRQILLDQVGVMGQEKLLNASVLIVGCGGTGSPCIQYLAASGVGTLGLADYDRVELSN 191
           RYSRQILL ++G  GQEKL NA VL+VG GG GSP  +YLAA+GVG LGL D D VELSN
Sbjct: 1   RYSRQILLPEIGEEGQEKLKNARVLVVGAGGLGSPAAEYLAAAGVGKLGLVDDDVVELSN 60

Query: 192 LHRQVIHTTHTIGQPKVTSAKRFISAINRNTIVHAYQTLLDTSNACDIIRRYDVVVDACD 251
           L RQ++HT   +GQPK  +A   + AIN +  + AY   LD  NA ++I  YD+V+D  D
Sbjct: 61  LQRQILHTEADVGQPKAEAAAERLRAINPDVEIEAYNERLDAENAEELIAGYDLVLDCTD 120

Query: 252 NAPTRYLLNDACLREGRPLVSASALGLEGQLCVYNYKGGPCYRCIYPVPPPAETVGTCGD 311
           N  TRYL+NDAC++ G+PLVS + LG EGQ+ V+    GPCYRC++P PPP   V +C +
Sbjct: 121 NFATRYLINDACVKLGKPLVSGAVLGFEGQVTVFIPGEGPCYRCLFPEPPPPG-VPSCAE 179

Query: 312 NGVLGPVPGVMGTLQAVETIKLL--IGLPVMDKLLVYDAELSKFLSVKL 358
            GVLGP+ GV+G+LQA+E +K+L  IG P+  +LL++DA    F ++KL
Sbjct: 180 AGVLGPLVGVIGSLQALEALKILLGIGEPLAGRLLLFDALSMSFRTLKL 228

Family of E1-like enzymes involved in molybdopterin and thiamine biosynthesis family. The common reaction mechanism catalyzed by MoeB and ThiF, like other E1 enzymes, begins with a nucleophilic attack of the C-terminal carboxylate of MoaD and ThiS, respectively, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of MoaD and ThiS. MoeB, as the MPT synthase (MoaE/MoaD complex) sulfurase, is involved in the biosynthesis of the molybdenum cofactor, a derivative of the tricyclic pterin, molybdopterin (MPT). ThiF catalyzes the adenylation of ThiS, as part of the biosynthesis pathway of thiamin pyrophosphate (vitamin B1). . Length = 228
>gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|180967 PRK07411, PRK07411, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|180204 PRK05690, PRK05690, molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>gnl|CDD|223552 COG0476, ThiF, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|162820 TIGR02356, adenyl_thiF, thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>gnl|CDD|181156 PRK07878, PRK07878, molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|131408 TIGR02355, moeB, molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>gnl|CDD|216180 pfam00899, ThiF, ThiF family Back     alignment and domain information
>gnl|CDD|169382 PRK08328, PRK08328, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235528 PRK05600, PRK05600, thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>gnl|CDD|238760 cd01483, E1_enzyme_family, Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>gnl|CDD|181084 PRK07688, PRK07688, thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>gnl|CDD|183547 PRK12475, PRK12475, thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>gnl|CDD|236320 PRK08644, PRK08644, thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>gnl|CDD|238384 cd00755, YgdL_like, Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>gnl|CDD|224100 COG1179, COG1179, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|238764 cd01487, E1_ThiF_like, E1_ThiF_like Back     alignment and domain information
>gnl|CDD|113988 pfam05237, MoeZ_MoeB, MoeZ/MoeB domain Back     alignment and domain information
>gnl|CDD|162819 TIGR02354, thiF_fam2, thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>gnl|CDD|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>gnl|CDD|181302 PRK08223, PRK08223, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>gnl|CDD|238784 cd01526, RHOD_ThiF, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1 Back     alignment and domain information
>gnl|CDD|238767 cd01490, Ube1_repeat2, Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>gnl|CDD|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>gnl|CDD|185071 PRK15116, PRK15116, sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>gnl|CDD|238768 cd01491, Ube1_repeat1, Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>gnl|CDD|184854 PRK14852, PRK14852, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|184853 PRK14851, PRK14851, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain Back     alignment and domain information
>gnl|CDD|236122 PRK07877, PRK07877, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>gnl|CDD|238770 cd01493, APPBP1_RUB, Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>gnl|CDD|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1 Back     alignment and domain information
>gnl|CDD|216005 pfam00581, Rhodanese, Rhodanese-like domain Back     alignment and domain information
>gnl|CDD|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|163448 TIGR03736, PRTRC_ThiF, PRTRC system ThiF family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 525
KOG2017|consensus427 100.0
PRK07411390 hypothetical protein; Validated 100.0
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 100.0
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 100.0
PRK05600370 thiamine biosynthesis protein ThiF; Validated 100.0
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 100.0
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 100.0
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 100.0
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 100.0
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 100.0
PRK08223287 hypothetical protein; Validated 100.0
PRK08328231 hypothetical protein; Provisional 100.0
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 100.0
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 100.0
COG0476254 ThiF Dinucleotide-utilizing enzymes involved in mo 100.0
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 100.0
TIGR03603318 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehy 100.0
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 100.0
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 100.0
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 100.0
PRK14852 989 hypothetical protein; Provisional 100.0
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 100.0
PRK14851 679 hypothetical protein; Provisional 100.0
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 100.0
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 100.0
PRK07877 722 hypothetical protein; Provisional 100.0
KOG2015|consensus422 100.0
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 100.0
PRK15116268 sulfur acceptor protein CsdL; Provisional 100.0
KOG2014|consensus331 100.0
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 100.0
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 100.0
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 100.0
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 100.0
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 100.0
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 99.98
cd01493425 APPBP1_RUB Ubiquitin activating enzyme (E1) subuni 99.97
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 99.97
KOG2013|consensus 603 99.97
cd01490435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 99.97
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 99.97
cd01483143 E1_enzyme_family Superfamily of activating enzymes 99.96
KOG2336|consensus422 99.96
KOG2012|consensus 1013 99.96
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 99.96
PTZ00245287 ubiquitin activating enzyme; Provisional 99.95
KOG2018|consensus430 99.94
PRK06153393 hypothetical protein; Provisional 99.93
KOG2012|consensus 1013 99.93
TIGR03693 637 ocin_ThiF_like putative thiazole-containing bacter 99.9
KOG2016|consensus 523 99.88
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 99.85
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 99.82
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 99.81
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 99.81
KOG2337|consensus669 99.8
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 99.79
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 99.78
PRK00162108 glpE thiosulfate sulfurtransferase; Validated 99.77
KOG1530|consensus136 99.75
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 99.75
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs a 99.75
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 99.74
PLN02160136 thiosulfate sulfurtransferase 99.73
cd01530121 Cdc25 Cdc25 phosphatases are members of the Rhodan 99.72
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 99.72
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 99.72
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 99.72
cd01525105 RHOD_Kc Member of the Rhodanese Homology Domain su 99.72
PRK01415247 hypothetical protein; Validated 99.71
cd0152996 4RHOD_Repeats Member of the Rhodanese Homology Dom 99.69
cd01521110 RHOD_PspE2 Member of the Rhodanese Homology Domain 99.69
PRK05320257 rhodanese superfamily protein; Provisional 99.69
cd01531113 Acr2p Eukaryotic arsenate resistance proteins are 99.69
cd01447103 Polysulfide_ST Polysulfide-sulfurtransferase - Rho 99.69
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 99.68
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 99.68
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 99.66
cd0153292 4RHOD_Repeat_1 Member of the Rhodanese Homology Do 99.66
TIGR02981101 phageshock_pspE phage shock operon rhodanese PspE. 99.66
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 99.65
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 99.65
cd01535145 4RHOD_Repeat_4 Member of the Rhodanese Homology Do 99.65
PRK00142314 putative rhodanese-related sulfurtransferase; Prov 99.64
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 99.63
PRK10287104 thiosulfate:cyanide sulfurtransferase; Provisional 99.63
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 99.62
cd0015889 RHOD Rhodanese Homology Domain (RHOD); an alpha be 99.61
PF0523784 MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 T 99.58
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 99.56
PLN02723320 3-mercaptopyruvate sulfurtransferase 99.52
cd01445138 TST_Repeats Thiosulfate sulfurtransferases (TST) c 99.49
COG2897285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.49
TIGR03167 311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 99.49
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.46
PRK11784 345 tRNA 2-selenouridine synthase; Provisional 99.45
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.44
cd01446132 DSP_MapKP N-terminal regulatory rhodanese domain o 99.44
PRK11493 281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.4
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.36
COG1054308 Predicted sulfurtransferase [General function pred 99.35
PLN02723 320 3-mercaptopyruvate sulfurtransferase 99.32
PRK01269482 tRNA s(4)U8 sulfurtransferase; Provisional 99.1
cd0176494 Urm1 Urm1-like ubuitin domain. Urm1 (Ubiquitin-Rel 99.03
KOG3772|consensus325 98.8
COG4015217 Predicted dinucleotide-utilizing enzyme of the Thi 98.78
COG2897 285 SseA Rhodanese-related sulfurtransferase [Inorgani 98.63
KOG1529|consensus286 98.29
TIGR0168788 moaD_arch MoaD family protein, archaeal. Members o 98.18
TIGR03882193 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydr 98.09
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.9
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.86
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 97.81
PRK06718202 precorrin-2 dehydrogenase; Reviewed 97.63
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 97.45
COG5105427 MIH1 Mitotic inducer, protein phosphatase [Cell di 97.37
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 97.35
KOG1529|consensus 286 97.26
PRK14027283 quinate/shikimate dehydrogenase; Provisional 97.22
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 97.18
PRK06719157 precorrin-2 dehydrogenase; Validated 97.14
PRK12548289 shikimate 5-dehydrogenase; Provisional 97.05
PRK05562223 precorrin-2 dehydrogenase; Provisional 96.94
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 96.93
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 96.72
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 96.7
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 96.66
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.63
cd0075480 MoaD Ubiquitin domain of MoaD-like proteins. MoaD 96.57
PRK13940414 glutamyl-tRNA reductase; Provisional 96.54
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 96.46
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.42
COG2603 334 Predicted ATPase [General function prediction only 96.41
COG0569225 TrkA K+ transport systems, NAD-binding component [ 96.34
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 96.33
PF0259777 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiam 96.29
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.29
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 96.22
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 96.14
PRK04148134 hypothetical protein; Provisional 96.1
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 96.05
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 96.02
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 95.99
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.93
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 95.9
PRK10637 457 cysG siroheme synthase; Provisional 95.85
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 95.85
PRK1113081 moaD molybdopterin synthase small subunit; Provisi 95.81
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 95.77
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 95.71
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 95.66
TIGR0168280 moaD molybdopterin converting factor, subunit 1, n 95.63
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 95.47
COG197784 MoaD Molybdopterin converting factor, small subuni 95.42
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 95.38
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 95.35
PTZ00082321 L-lactate dehydrogenase; Provisional 95.34
PLN00203519 glutamyl-tRNA reductase 95.33
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 95.27
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.26
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 95.26
PRK08618325 ornithine cyclodeaminase; Validated 95.23
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 95.1
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 95.09
PTZ00117319 malate dehydrogenase; Provisional 95.08
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 95.04
PRK13403335 ketol-acid reductoisomerase; Provisional 94.95
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 94.95
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 94.92
PRK07574385 formate dehydrogenase; Provisional 94.88
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 94.86
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 94.86
PLN0279982 Molybdopterin synthase sulfur carrier subunit 94.8
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 94.77
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 94.75
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 94.73
PRK06141314 ornithine cyclodeaminase; Validated 94.73
PRK00048257 dihydrodipicolinate reductase; Provisional 94.68
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.56
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 94.56
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 94.53
PRK00676338 hemA glutamyl-tRNA reductase; Validated 94.53
KOG4169|consensus261 94.52
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 94.51
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.46
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 94.46
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 94.37
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 94.35
PRK05479330 ketol-acid reductoisomerase; Provisional 94.31
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 94.31
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 94.27
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.26
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.25
PRK07340304 ornithine cyclodeaminase; Validated 94.24
PRK09496453 trkA potassium transporter peripheral membrane com 94.24
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 94.19
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 94.17
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 94.17
PRK06932314 glycerate dehydrogenase; Provisional 94.13
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.12
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 94.11
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 94.11
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 94.1
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 94.1
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 94.06
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 94.02
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 93.97
PRK06223307 malate dehydrogenase; Reviewed 93.93
PRK06197306 short chain dehydrogenase; Provisional 93.85
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.84
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 93.82
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 93.8
PRK12480330 D-lactate dehydrogenase; Provisional 93.79
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 93.73
PRK08306296 dipicolinate synthase subunit A; Reviewed 93.69
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 93.69
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.68
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 93.67
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 93.64
PRK08291330 ectoine utilization protein EutC; Validated 93.64
PRK07502307 cyclohexadienyl dehydrogenase; Validated 93.63
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.62
PLN02494477 adenosylhomocysteinase 93.62
PRK09242257 tropinone reductase; Provisional 93.61
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 93.57
PLN02602350 lactate dehydrogenase 93.48
PRK07062265 short chain dehydrogenase; Provisional 93.48
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.47
PRK09496 453 trkA potassium transporter peripheral membrane com 93.43
PRK05854313 short chain dehydrogenase; Provisional 93.38
PRK07680273 late competence protein ComER; Validated 93.38
PRK13304265 L-aspartate dehydrogenase; Reviewed 93.35
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 93.34
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 93.31
KOG0069|consensus336 93.29
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 93.27
PLN02427386 UDP-apiose/xylose synthase 93.24
PRK13302271 putative L-aspartate dehydrogenase; Provisional 93.23
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 93.22
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 93.22
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.22
PRK11908347 NAD-dependent epimerase/dehydratase family protein 93.2
PRK07063260 short chain dehydrogenase; Provisional 93.18
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 93.15
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 93.13
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 93.13
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 93.13
PTZ00075476 Adenosylhomocysteinase; Provisional 93.04
PLN02240352 UDP-glucose 4-epimerase 93.02
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 93.0
PLN03209 576 translocon at the inner envelope of chloroplast su 92.98
PLN03139386 formate dehydrogenase; Provisional 92.97
PRK08229341 2-dehydropantoate 2-reductase; Provisional 92.93
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 92.89
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 92.89
PRK05875276 short chain dehydrogenase; Provisional 92.88
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 92.84
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 92.8
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 92.77
PRK07831262 short chain dehydrogenase; Provisional 92.75
PRK07417279 arogenate dehydrogenase; Reviewed 92.74
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 92.74
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 92.68
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.66
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 92.6
PTZ00431260 pyrroline carboxylate reductase; Provisional 92.53
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 92.48
PTZ00325321 malate dehydrogenase; Provisional 92.39
PRK07576264 short chain dehydrogenase; Provisional 92.35
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 92.34
PLN02688266 pyrroline-5-carboxylate reductase 92.34
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.32
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 92.32
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.31
PRK06270341 homoserine dehydrogenase; Provisional 92.3
TIGR00036266 dapB dihydrodipicolinate reductase. 92.3
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 92.29
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 92.27
PRK03562621 glutathione-regulated potassium-efflux system prot 92.24
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 92.18
PRK13301267 putative L-aspartate dehydrogenase; Provisional 92.18
PRK12550272 shikimate 5-dehydrogenase; Reviewed 92.16
PLN00106323 malate dehydrogenase 92.11
PRK08374336 homoserine dehydrogenase; Provisional 92.11
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 91.85
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 91.83
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 91.81
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 91.79
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 91.76
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 91.71
PRK06545359 prephenate dehydrogenase; Validated 91.69
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 91.68
PRK03659601 glutathione-regulated potassium-efflux system prot 91.58
PRK07523255 gluconate 5-dehydrogenase; Provisional 91.42
PRK05225487 ketol-acid reductoisomerase; Validated 91.41
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.34
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 91.33
PLN02306386 hydroxypyruvate reductase 91.33
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.32
PLN02206442 UDP-glucuronate decarboxylase 91.3
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 91.25
COG0300265 DltE Short-chain dehydrogenases of various substra 91.23
PRK08251248 short chain dehydrogenase; Provisional 91.22
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 91.2
COG0281432 SfcA Malic enzyme [Energy production and conversio 91.14
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 91.14
PRK08818370 prephenate dehydrogenase; Provisional 91.11
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 90.97
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 90.93
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 90.9
PRK05866293 short chain dehydrogenase; Provisional 90.89
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.84
PRK05867253 short chain dehydrogenase; Provisional 90.81
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 90.73
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.69
PRK09186256 flagellin modification protein A; Provisional 90.67
PRK07478254 short chain dehydrogenase; Provisional 90.66
PRK12779 944 putative bifunctional glutamate synthase subunit b 90.63
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 90.57
PRK06194287 hypothetical protein; Provisional 90.57
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 90.51
cd01493425 APPBP1_RUB Ubiquitin activating enzyme (E1) subuni 90.51
PRK06125259 short chain dehydrogenase; Provisional 90.46
PRK08339263 short chain dehydrogenase; Provisional 90.37
PRK06949258 short chain dehydrogenase; Provisional 90.32
PRK06046326 alanine dehydrogenase; Validated 90.25
PRK05872296 short chain dehydrogenase; Provisional 90.24
PRK15059292 tartronate semialdehyde reductase; Provisional 90.24
PRK00142 314 putative rhodanese-related sulfurtransferase; Prov 90.22
PRK09880343 L-idonate 5-dehydrogenase; Provisional 90.21
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 90.14
PRK11730715 fadB multifunctional fatty acid oxidation complex 90.12
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 90.1
PF1008797 DUF2325: Uncharacterized protein conserved in bact 90.06
PLN02928347 oxidoreductase family protein 90.03
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 90.01
PRK06436303 glycerate dehydrogenase; Provisional 89.99
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 89.98
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.98
PRK06138252 short chain dehydrogenase; Provisional 89.97
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 89.96
PLN02166436 dTDP-glucose 4,6-dehydratase 89.93
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 89.85
PRK12771564 putative glutamate synthase (NADPH) small subunit; 89.83
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 89.83
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 89.82
PRK06181263 short chain dehydrogenase; Provisional 89.8
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 89.76
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 89.76
TIGR00065349 ftsZ cell division protein FtsZ. This family consi 89.75
PLN02253280 xanthoxin dehydrogenase 89.71
PRK12939250 short chain dehydrogenase; Provisional 89.67
PLN02852491 ferredoxin-NADP+ reductase 89.67
PRK12862 763 malic enzyme; Reviewed 89.67
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 89.65
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.63
PRK12921305 2-dehydropantoate 2-reductase; Provisional 89.62
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 89.58
PRK07814263 short chain dehydrogenase; Provisional 89.58
PRK09330384 cell division protein FtsZ; Validated 89.58
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 89.54
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 89.53
PRK08277278 D-mannonate oxidoreductase; Provisional 89.44
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 89.41
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 89.38
PRK10669558 putative cation:proton antiport protein; Provision 89.38
PRK08213259 gluconate 5-dehydrogenase; Provisional 89.38
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 89.34
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 89.33
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 89.32
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 89.32
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 89.24
PRK06199379 ornithine cyclodeaminase; Validated 89.23
PRK12367245 short chain dehydrogenase; Provisional 89.22
COG2085211 Predicted dinucleotide-binding enzymes [General fu 89.21
KOG1205|consensus282 89.16
PRK06139330 short chain dehydrogenase; Provisional 89.08
PRK05708305 2-dehydropantoate 2-reductase; Provisional 89.07
PRK14982340 acyl-ACP reductase; Provisional 89.06
PLN02214342 cinnamoyl-CoA reductase 89.06
PLN02780320 ketoreductase/ oxidoreductase 89.02
PRK06567 1028 putative bifunctional glutamate synthase subunit b 89.01
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 89.0
PRK13529563 malate dehydrogenase; Provisional 88.94
PLN03129581 NADP-dependent malic enzyme; Provisional 88.9
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 88.85
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 88.85
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 88.78
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 88.77
PRK12829264 short chain dehydrogenase; Provisional 88.77
PRK05876275 short chain dehydrogenase; Provisional 88.75
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 88.75
KOG1093|consensus725 88.75
KOG0024|consensus354 88.71
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 88.66
PRK07326237 short chain dehydrogenase; Provisional 88.64
PRK08655437 prephenate dehydrogenase; Provisional 88.59
PRK13303265 L-aspartate dehydrogenase; Provisional 88.57
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 88.54
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 88.51
PRK07035252 short chain dehydrogenase; Provisional 88.51
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 88.45
cd02201304 FtsZ_type1 FtsZ is a GTPase that is similar to the 88.45
PLN00016378 RNA-binding protein; Provisional 88.44
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 88.44
PRK06523260 short chain dehydrogenase; Provisional 88.43
PRK07774250 short chain dehydrogenase; Provisional 88.33
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 88.3
PRK13243333 glyoxylate reductase; Reviewed 88.26
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 88.22
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 88.06
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 88.0
CHL00194317 ycf39 Ycf39; Provisional 87.96
PRK14031444 glutamate dehydrogenase; Provisional 87.91
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 87.83
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 87.81
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 87.8
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 87.76
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.7
PLN02896353 cinnamyl-alcohol dehydrogenase 87.69
PRK07109334 short chain dehydrogenase; Provisional 87.66
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 87.63
PLN02653340 GDP-mannose 4,6-dehydratase 87.6
PRK09072263 short chain dehydrogenase; Provisional 87.54
PRK06487317 glycerate dehydrogenase; Provisional 87.53
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 87.51
PRK06940275 short chain dehydrogenase; Provisional 87.49
PRK06172253 short chain dehydrogenase; Provisional 87.48
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 87.4
PRK12861 764 malic enzyme; Reviewed 87.4
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 87.38
PRK07589346 ornithine cyclodeaminase; Validated 87.37
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 87.36
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 87.33
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 87.29
PLN02695370 GDP-D-mannose-3',5'-epimerase 87.23
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 87.23
PRK11259376 solA N-methyltryptophan oxidase; Provisional 87.19
PRK06914280 short chain dehydrogenase; Provisional 87.11
PRK08324681 short chain dehydrogenase; Validated 87.08
PRK12814652 putative NADPH-dependent glutamate synthase small 87.08
PRK06392326 homoserine dehydrogenase; Provisional 87.07
PRK10537393 voltage-gated potassium channel; Provisional 86.93
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 86.9
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 86.85
PRK07453322 protochlorophyllide oxidoreductase; Validated 86.82
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 86.78
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 86.76
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 86.75
PRK12746254 short chain dehydrogenase; Provisional 86.71
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 86.67
PRK00811283 spermidine synthase; Provisional 86.67
PRK11154708 fadJ multifunctional fatty acid oxidation complex 86.67
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 86.64
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 86.6
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 86.55
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 86.49
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.44
PLN02503605 fatty acyl-CoA reductase 2 86.44
KOG2016|consensus523 86.42
cd05298437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 86.3
PRK06249313 2-dehydropantoate 2-reductase; Provisional 86.28
PRK10675338 UDP-galactose-4-epimerase; Provisional 86.28
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 86.28
KOG0409|consensus327 86.27
PRK08226263 short chain dehydrogenase; Provisional 86.21
PRK06124256 gluconate 5-dehydrogenase; Provisional 86.19
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 86.15
PRK08589272 short chain dehydrogenase; Validated 86.1
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 86.07
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 86.06
PRK08264238 short chain dehydrogenase; Validated 85.97
PTZ00188506 adrenodoxin reductase; Provisional 85.96
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 85.95
PRK06196315 oxidoreductase; Provisional 85.92
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 85.91
PRK13018378 cell division protein FtsZ; Provisional 85.89
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 85.87
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 85.84
PRK08265261 short chain dehydrogenase; Provisional 85.83
PRK12744257 short chain dehydrogenase; Provisional 85.76
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 85.75
PRK12831464 putative oxidoreductase; Provisional 85.75
PRK06823315 ornithine cyclodeaminase; Validated 85.74
PLN02572442 UDP-sulfoquinovose synthase 85.74
PRK07067257 sorbitol dehydrogenase; Provisional 85.72
COG3453130 Uncharacterized protein conserved in bacteria [Fun 85.69
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 85.65
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 85.6
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 85.6
PRK12937245 short chain dehydrogenase; Provisional 85.6
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 85.58
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 85.56
PRK05855582 short chain dehydrogenase; Validated 85.45
TIGR01746367 Thioester-redct thioester reductase domain. It has 85.44
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 85.44
PLN02650351 dihydroflavonol-4-reductase 85.42
cd05197425 GH4_glycoside_hydrolases Glycoside Hydrases Family 85.37
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 85.34
PRK06198260 short chain dehydrogenase; Provisional 85.34
>KOG2017|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.7e-81  Score=612.84  Aligned_cols=386  Identities=47%  Similarity=0.866  Sum_probs=364.4

Q ss_pred             CCCCHHHHhhhhhcccccccCHHHHHHhhcCcEEEEcCCcchHHHHHHhHHcCCceEEEEeCCcccccCCCcccccCCCC
Q psy13373        123 SKFSKDITERYSRQILLDQVGVMGQEKLLNASVLIVGCGGTGSPCIQYLAASGVGTLGLADYDRVELSNLHRQVIHTTHT  202 (525)
Q Consensus       123 ~~l~~~~~~rysRq~~l~~~G~~~q~kL~~~~VlViG~GglGs~ia~~La~~GVg~i~lvD~d~V~~sNL~Rq~l~~~~d  202 (525)
                      +.||.+|+.||+||+.+|++|..||.+|++++|+|||||||||.++.+|+.+|||+|.|||.|.|+.+||+||++++++.
T Consensus        37 ~~Ls~dei~RYsRQlilpe~gV~GQ~~Lk~s~VLVVGaGGLGcPa~~YLaaaGvG~lGiVD~DvVe~sNlhRQVlh~ea~  116 (427)
T KOG2017|consen   37 AGLSLDEILRYSRQLILPEFGVHGQLSLKNSSVLVVGAGGLGCPAAQYLAAAGVGRLGIVDYDVVELSNLHRQVLHTEAR  116 (427)
T ss_pred             cCCCHHHHHhhhheeeccccccccccccCCccEEEEccCCCCCHHHHHHHHcCCCeecccccceeehhhHHHHHhhhhhh
Confidence            46899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcHHHHHHHHHHhhCCCcEEEEeeecCCcchHhHhhccCCeEeecCCCHHHHHHHHHHhHhcCCcEEEecccCccceE
Q psy13373        203 IGQPKVTSAKRFISAINRNTIVHAYQTLLDTSNACDIIRRYDVVVDACDNAPTRYLLNDACLREGRPLVSASALGLEGQL  282 (525)
Q Consensus       203 iG~~Ka~~~~~~l~~lnp~v~v~~~~~~i~~~~~~~~~~~~dvVi~~~d~~~~r~~l~~~~~~~~~p~i~~~~~g~~G~v  282 (525)
                      +|+.|+++++..++++||.++|..|...++.+|..+++++||+|+|||||..+|++|++.|+..|+|+|+++..++.||+
T Consensus       117 vg~~Ka~sA~~~lr~lNs~v~v~~y~~~L~~sNa~~Ii~~YdvVlDCTDN~~TRYLisD~CVlLgkpLVSgSaLr~EGQL  196 (427)
T KOG2017|consen  117 VGMHKAESAAAFLRRLNSHVEVQTYNEFLSSSNAFDIIKQYDVVLDCTDNVPTRYLISDVCVLLGKPLVSGSALRWEGQL  196 (427)
T ss_pred             hhhHHHHHHHHHHHhcCCCceeeechhhccchhHHHHhhccceEEEcCCCccchhhhhhHHHHcCCccccccccccccee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEecCCCCceeecCCCCCCCCCCCCcCCCCcccchhHHHHHHHHHHHHHHHhCC-CCC-CeEEEEEcCCCeeEEeeecC
Q psy13373        283 CVYNYKGGPCYRCIYPVPPPAETVGTCGDNGVLGPVPGVMGTLQAVETIKLLIGL-PVM-DKLLVYDAELSKFLSVKLRK  360 (525)
Q Consensus       283 ~v~~~~~~~c~~c~~~~~~~~~~~~~c~~~~~~~~~~~ivg~~~a~e~lk~l~g~-~~l-~~~~~~d~~~~~~~~~~l~~  360 (525)
                      .++++..+|||+|+||.+|+++.+.+|++.|++||+++++|+|+|.|+||.++|. +.+ +++++||+.++.|++++++.
T Consensus       197 tvYny~~GPCYRClFP~Ppp~~~vt~C~dgGVlGpv~GviG~mQALE~iKli~~~~~~~s~~lllfdg~~~~~r~irlR~  276 (427)
T KOG2017|consen  197 TVYNYNNGPCYRCLFPNPPPPEAVTNCADGGVLGPVTGVIGCMQALETIKLIAGIGESLSGRLLLFDGLSGHFRTIRLRS  276 (427)
T ss_pred             EEeecCCCceeeecCCCCcChHHhcccccCceeecchhhhhHHHHHHHHHHHHccCccCCcceEEEecccceeEEEEecc
Confidence            9999999999999999999999999999999999999999999999999999999 888 99999999999999999999


Q ss_pred             CCCCC-cc-CCCCccccccchhhccccCCCCCCCccCCCCCcccChhhhHHHHHhcCCCcEEEecCChhhhhcCCCCCeE
Q psy13373        361 KKEDC-VC-AHPADTQLVDYEVFCSSRANDKTPDISILDPTEHLTALDYRDEFLARRVAHTLLDVRSVDEFAMMSLNIAS  438 (525)
Q Consensus       361 r~p~C-~C-~~~~~~~l~~y~~~cg~~~~~~~~~~~~~~~~~~is~~el~~~~l~~~~~~~lIDVR~~~E~~~ghIpGAi  438 (525)
                      |++.| +| .+|.++.+.+|+.|||..+.+.. .++++.+..+|+..++++. +++++.+++||||++.||+..|+|+|+
T Consensus       277 r~~~C~~Cg~n~tit~~~dYe~fCg~~~~~~~-~l~lL~~~~Rvsv~d~k~i-l~~~~~h~llDvRp~~~~eI~~lP~av  354 (427)
T KOG2017|consen  277 RRPKCAVCGKNPTITSLIDYELFCGSSATDKC-PLKLLEPDERVSVTDYKRI-LDSGAKHLLLDVRPSHEYEICRLPEAV  354 (427)
T ss_pred             CCCCCcccCCCCccCcccchhcccCCcccccc-chhcCChhhcccHHHHHHH-HhcCCCeEEEeccCcceEEEEeccccc
Confidence            99999 99 88999999999999999999988 6788999999999999999 998778999999999999999999999


Q ss_pred             EeChhhHHHHHhhcCCchHHHHhhhhhc-CCCCeEEEEcCcChHHHHHHHHHHHccCCCCCCCcccEEEecccHHHHHhc
Q psy13373        439 HATMADVQLMFAEAGECPAFLESLREDI-LAHRHVFVICRRGNDSQKVVQLLKRYVERHRPGVVYDIRNIKEGYKGWQKY  517 (525)
Q Consensus       439 nip~~~l~~~~~~~~~~~~~l~~l~~~~-~~~~~Ivv~C~~G~rS~~aa~~L~~~G~~~~~~~~~~v~~l~GG~~aW~~~  517 (525)
                      |||+.++...-+         +++...+ ....+|+|+|+.|+.|+.|++.|++.+....      ++-+.||+.+|..+
T Consensus       355 NIPL~~l~~~~~---------~~~~~~~~~~~~~I~ViCrrGNdSQ~Av~~Lre~~~~~~------vrDvigGl~~w~~~  419 (427)
T KOG2017|consen  355 NIPLKELRSRSG---------KKLQGDLNTESKDIFVICRRGNDSQRAVRILREKFPDSS------VRDVIGGLKAWAAK  419 (427)
T ss_pred             ccchhhhhhhhh---------hhhcccccccCCCEEEEeCCCCchHHHHHHHHhhCCchh------hhhhhhHHHHHHHh
Confidence            999999987610         1221111 2467799999999999999999998876542      77889999999999


Q ss_pred             ccCCCCCC
Q psy13373        518 VDNRIPTY  525 (525)
Q Consensus       518 ~~p~~p~~  525 (525)
                      ++|++|.|
T Consensus       420 vd~~fP~Y  427 (427)
T KOG2017|consen  420 VDPNFPLY  427 (427)
T ss_pred             cCcCCCCC
Confidence            99999998

>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>TIGR03603 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehydratase, SagC family Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>KOG2015|consensus Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>KOG2014|consensus Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>KOG2013|consensus Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>KOG2336|consensus Back     alignment and domain information
>KOG2012|consensus Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PTZ00245 ubiquitin activating enzyme; Provisional Back     alignment and domain information
>KOG2018|consensus Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>KOG2012|consensus Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>KOG2016|consensus Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>KOG2337|consensus Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>PRK00162 glpE thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>KOG1530|consensus Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 Back     alignment and domain information
>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>PF05237 MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 This putative domain is found in the MoeZ protein and the MoeB protein Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>COG1054 Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information
>cd01764 Urm1 Urm1-like ubuitin domain Back     alignment and domain information
>KOG3772|consensus Back     alignment and domain information
>COG4015 Predicted dinucleotide-utilizing enzyme of the ThiF/HesA family [General function prediction only] Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1529|consensus Back     alignment and domain information
>TIGR01687 moaD_arch MoaD family protein, archaeal Back     alignment and domain information
>TIGR03882 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydratase domain Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>KOG1529|consensus Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>cd00754 MoaD Ubiquitin domain of MoaD-like proteins Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>COG2603 Predicted ATPase [General function prediction only] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PF02597 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiaminS) is a 66 aa protein involved in sulphur transfer Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11130 moaD molybdopterin synthase small subunit; Provisional Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>TIGR01682 moaD molybdopterin converting factor, subunit 1, non-archaeal Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>COG1977 MoaD Molybdopterin converting factor, small subunit [Coenzyme metabolism] Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>PLN02799 Molybdopterin synthase sulfur carrier subunit Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>KOG0069|consensus Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>TIGR00065 ftsZ cell division protein FtsZ Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09330 cell division protein FtsZ; Validated Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>KOG1093|consensus Back     alignment and domain information
>KOG0024|consensus Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>cd02201 FtsZ_type1 FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>KOG2016|consensus Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG0409|consensus Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK13018 cell division protein FtsZ; Provisional Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>COG3453 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query525
1jwb_B249 Structure Of The Covalent Acyl-Adenylate Form Of Th 5e-47
1zud_1251 Structure Of This-Thif Protein Complex Length = 251 5e-40
1zfn_A253 Structural Analysis Of Escherichia Coli Thif Length 6e-40
1y8q_B 640 Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex 2e-14
3kyc_B 660 Human Sumo E1 Complex With A Sumo1-Amp Mimic Length 3e-14
3kyd_B 551 Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mi 4e-14
3h5a_A358 Crystal Structure Of E. Coli Mccb Length = 358 4e-14
3h5n_B353 Crystal Structure Of E. Coli Mccb + Atp Length = 35 5e-14
4ii2_A 1001 Crystal Structure Of Ubiquitin Activating Enzyme 1 1e-09
3cmm_A 1015 Crystal Structure Of The Uba1-Ubiquitin Complex Len 6e-09
2nvu_B805 Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 1e-08
3gzn_B463 Structure Of Nedd8-Activating Enzyme In Complex Wit 1e-08
3dbh_B434 Structural Dissection Of A Gating Mechanism Prevent 2e-08
1tt5_B434 Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I 2e-08
1yov_B444 Insights Into The Ubiquitin Transfer Cascade From T 3e-08
3dbr_B434 Structural Dissection Of A Gating Mechanism Prevent 4e-08
3dbl_B434 Structural Dissection Of A Gating Mechanism Prevent 5e-08
1r4m_B431 Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com 5e-08
3guc_A292 Human Ubiquitin-Activating Enzyme 5 In Complex With 3e-07
1r4m_A 529 Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com 2e-05
3gzn_A 534 Structure Of Nedd8-Activating Enzyme In Complex Wit 2e-05
2nvu_A 536 Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 2e-05
1yov_A 537 Insights Into The Ubiquitin Transfer Cascade From T 2e-05
1tt5_A 531 Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I 2e-05
3i2v_A127 Crystal Structure Of Human Mocs3 Rhodanese-Like Dom 2e-04
>pdb|1JWB|B Chain B, Structure Of The Covalent Acyl-Adenylate Form Of The Moeb-Moad Protein Complex Length = 249 Back     alignment and structure 
Iteration: 1

 Score =  185 bits (470), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 103/241 (42%), Positives = 144/241 (59%), Gaps = 5/241 (2%)
Query: 132 RYSRQILLDQVGVMGQEKLLNASVLIVGCGGTGSPCIQYLAASGVGTLGLADYDRVELSN 191
           RY+RQI+L      GQE L ++ VLIVG GG G    QYLA++GVG L L D+D V LSN
Sbjct: 11  RYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLLDFDTVSLSN 70
Query: 192 LHRQVIHTTHTIGQPKVTSAKRFISAINRNTIVHAYQTLLDTSNACDIIRRYDVVVDACD 251
           L RQ +H+  T+GQPKV SA+  ++ IN +  +     LLD +    +I  +D+V+D  D
Sbjct: 71  LQRQTLHSDATVGQPKVESARDALTRINPHIAITPVNALLDDAELAALIAEHDLVLDCTD 130
Query: 252 NAPTRYLLNDACLREGRPLVSASALGLEGQLCVYNYKGG-PCYRCIYPVPPPAETVGTCG 310
           N   R  LN  C     PLVS +A+ +EGQ+ V+ Y+ G PCYRC+  +    E   TC 
Sbjct: 131 NVAVRNQLNAGCFAAKVPLVSGAAIRMEGQITVFTYQDGEPCYRCLSRL--FGENALTCV 188
Query: 311 DNGVLGPVPGVMGTLQAVETIKLLIGL--PVMDKLLVYDAELSKFLSVKLRKKKEDCVCA 368
           + GV+ P+ GV+G+LQA+E IK+L G   P   K+++YDA   +F  +KL +     VC 
Sbjct: 189 EAGVMAPLIGVIGSLQAMEAIKMLAGYGKPASGKIVMYDAMTCQFREMKLMRNPGCEVCG 248
Query: 369 H 369
Sbjct: 249 Q 249
>pdb|1ZUD|1 Chain 1, Structure Of This-Thif Protein Complex Length = 251 Back     alignment and structure
>pdb|1ZFN|A Chain A, Structural Analysis Of Escherichia Coli Thif Length = 253 Back     alignment and structure
>pdb|1Y8Q|B Chain B, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 640 Back     alignment and structure
>pdb|3KYC|B Chain B, Human Sumo E1 Complex With A Sumo1-Amp Mimic Length = 660 Back     alignment and structure
>pdb|3KYD|B Chain B, Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mimic Length = 551 Back     alignment and structure
>pdb|3H5A|A Chain A, Crystal Structure Of E. Coli Mccb Length = 358 Back     alignment and structure
>pdb|3H5N|B Chain B, Crystal Structure Of E. Coli Mccb + Atp Length = 353 Back     alignment and structure
>pdb|4II2|A Chain A, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 1001 Back     alignment and structure
>pdb|3CMM|A Chain A, Crystal Structure Of The Uba1-Ubiquitin Complex Length = 1015 Back     alignment and structure
>pdb|2NVU|B Chain B, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 805 Back     alignment and structure
>pdb|3GZN|B Chain B, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 463 Back     alignment and structure
>pdb|3DBH|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190ala-Nedd8ala72arg) Length = 434 Back     alignment and structure
>pdb|1TT5|B Chain B, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 434 Back     alignment and structure
>pdb|1YOV|B Chain B, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 444 Back     alignment and structure
>pdb|3DBR|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190gln-Nedd8ala72arg) Length = 434 Back     alignment and structure
>pdb|3DBL|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190wt-Nedd8ala72gln) Length = 434 Back     alignment and structure
>pdb|1R4M|B Chain B, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 431 Back     alignment and structure
>pdb|3GUC|A Chain A, Human Ubiquitin-Activating Enzyme 5 In Complex With Amppnp Length = 292 Back     alignment and structure
>pdb|1R4M|A Chain A, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 529 Back     alignment and structure
>pdb|3GZN|A Chain A, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 534 Back     alignment and structure
>pdb|2NVU|A Chain A, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 536 Back     alignment and structure
>pdb|1YOV|A Chain A, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 537 Back     alignment and structure
>pdb|1TT5|A Chain A, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 531 Back     alignment and structure
>pdb|3I2V|A Chain A, Crystal Structure Of Human Mocs3 Rhodanese-Like Domain Length = 127 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query525
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 1e-130
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 1e-129
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 1e-117
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 1e-111
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 1e-103
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 1e-94
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 2e-59
1y8q_B 640 Anthracycline-, ubiquitin-like 2 activating enzyme 9e-58
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 3e-56
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 2e-35
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 2e-28
1tt5_A 531 APPBP1, amyloid protein-binding protein 1; cell cy 4e-34
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 8e-20
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 2e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 7e-10
1tq1_A129 AT5G66040, senescence-associated family protein; C 2e-08
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 3e-08
3foj_A100 Uncharacterized protein; protein SSP1007, structur 1e-07
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 2e-07
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 4e-07
1vee_A134 Proline-rich protein family; hypothetical protein, 2e-06
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 3e-06
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 5e-06
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 2e-05
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 5e-05
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 5e-05
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 3e-04
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 4e-04
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 5e-04
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Length = 249 Back     alignment and structure
 Score =  377 bits (970), Expect = e-130
 Identities = 104/251 (41%), Positives = 147/251 (58%), Gaps = 7/251 (2%)

Query: 123 SKFSKDITERYSRQILLDQVGVMGQEKLLNASVLIVGCGGTGSPCIQYLAASGVGTLGLA 182
           ++ S     RY+RQI+L      GQE L ++ VLIVG GG G    QYLA++GVG L L 
Sbjct: 2   AELSDQEMLRYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLL 61

Query: 183 DYDRVELSNLHRQVIHTTHTIGQPKVTSAKRFISAINRNTIVHAYQTLLDTSNACDIIRR 242
           D+D V LSNL RQ +H+  T+GQPKV SA+  ++ IN +  +     LLD +    +I  
Sbjct: 62  DFDTVSLSNLQRQTLHSDATVGQPKVESARDALTRINPHIAITPVNALLDDAELAALIAE 121

Query: 243 YDVVVDACDNAPTRYLLNDACLREGRPLVSASALGLEGQLCVYNYK-GGPCYRCIYPVPP 301
           +D+V+D  DN   R  LN  C     PLVS +A+ +EGQ+ V+ Y+ G PCYRC+  +  
Sbjct: 122 HDLVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQITVFTYQDGEPCYRCLSRLFG 181

Query: 302 PAETVGTCGDNGVLGPVPGVMGTLQAVETIKLLIGL--PVMDKLLVYDAELSKFLSVKLR 359
                 TC + GV+ P+ GV+G+LQA+E IK+L G   P   K+++YDA   +F  +KL 
Sbjct: 182 EN--ALTCVEAGVMAPLIGVIGSLQAMEAIKMLAGYGKPASGKIVMYDAMTCQFREMKLM 239

Query: 360 KKKEDC-VCAH 369
           +    C VC  
Sbjct: 240 RNP-GCEVCGQ 249
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Length = 251 Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Length = 292 Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Length = 340 Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Length = 598 Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Length = 640 Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Length = 346 Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Length = 127 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Length = 108 Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Length = 108 Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Length = 100 Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Length = 94 Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Length = 134 Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Length = 110 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Length = 118 Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query525
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 100.0
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 100.0
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 100.0
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 100.0
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 100.0
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 100.0
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 100.0
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 100.0
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 100.0
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 100.0
1tt5_A 531 APPBP1, amyloid protein-binding protein 1; cell cy 100.0
1y8q_B 640 Anthracycline-, ubiquitin-like 2 activating enzyme 100.0
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 100.0
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 99.98
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.88
3foj_A100 Uncharacterized protein; protein SSP1007, structur 99.86
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 99.86
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.85
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 99.85
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 99.84
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 99.81
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 99.81
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 99.8
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 99.8
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 99.8
1tq1_A129 AT5G66040, senescence-associated family protein; C 99.79
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 99.79
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 99.79
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 99.76
2jtq_A85 Phage shock protein E; solution structure rhodanes 99.76
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 99.76
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 99.74
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 99.74
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 99.74
3op3_A216 M-phase inducer phosphatase 3; structural genomics 99.74
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 99.72
1vee_A134 Proline-rich protein family; hypothetical protein, 99.72
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 99.7
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 99.7
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 99.7
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.68
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 99.67
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 99.67
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 99.67
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.67
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 99.66
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.65
2ouc_A142 Dual specificity protein phosphatase 10; rhodanese 99.63
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.63
3tg1_B158 Dual specificity protein phosphatase 10; kinase/rh 99.62
1e0c_A 271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.61
3hzu_A 318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.6
1hzm_A154 Dual specificity protein phosphatase 6; hydrolase; 99.6
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.59
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.59
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 99.59
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 99.58
1urh_A 280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.58
1uar_A 285 Rhodanese; sulfurtransferase, riken structural gen 99.57
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 99.57
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 99.56
3aay_A 277 Putative thiosulfate sulfurtransferase; sulfurtran 99.56
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 99.56
2wlr_A423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.53
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.52
1rhs_A 296 Sulfur-substituted rhodanese; transferase, sulfurt 99.5
3olh_A 302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.49
1whb_A157 KIAA0055; deubiqutinating enzyme, UBPY, structural 99.49
2gwf_A157 Ubiquitin carboxyl-terminal hydrolase 8; protein-p 99.49
2wlr_A 423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.47
1okg_A373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.46
1okg_A 373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.45
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.45
2eg4_A 230 Probable thiosulfate sulfurtransferase; structural 99.41
3utn_X327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.39
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.3
1wgk_A114 Riken cDNA 2900073H19 protein; THis domain, ubiqut 99.13
3r2u_A466 Metallo-beta-lactamase family protein; structural 98.83
3utn_X 327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 98.74
3dwg_C93 9.5 kDa culture filtrate antigen CFP10A; sulfur ca 98.5
2qjl_A99 URM1, ubiquitin-related modifier 1; ubiquitin-like 98.3
2k9x_A110 Tburm1, uncharacterized protein; unknown function; 98.26
2g1e_A90 Hypothetical protein TA0895; MOAD, molybdopterin, 98.13
2l52_A99 Methanosarcina acetivorans SAMP1 homolog; beta-grA 98.07
3po0_A89 Small archaeal modifier protein 1; ubiquitin-like 97.99
1vjk_A98 Molybdopterin converting factor, subunit 1; struct 97.83
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.83
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.62
1v8c_A168 MOAD related protein; riken structural genomics/pr 97.53
2f46_A156 Hypothetical protein; structural genomics, joint c 97.51
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.44
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 97.41
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.41
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.4
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.36
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 97.13
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 97.11
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 97.1
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.05
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 97.04
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.96
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 96.73
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.71
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 96.69
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 96.69
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 96.67
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 96.65
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 96.64
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 96.62
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 96.57
3c85_A183 Putative glutathione-regulated potassium-efflux S 96.52
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.51
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 96.5
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 96.41
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 96.31
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 96.16
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 96.09
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 96.05
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 96.01
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 96.01
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 95.96
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 95.94
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 95.89
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 95.88
3slg_A372 PBGP3 protein; structural genomics, seattle struct 95.82
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 95.79
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 95.78
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 95.77
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 95.77
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 95.77
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 95.75
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 95.72
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 95.72
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 95.71
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 95.7
1fm0_D81 Molybdopterin convertin factor, subunit 1; molybde 95.68
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 95.57
4ezb_A317 Uncharacterized conserved protein; structural geno 95.56
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 95.55
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 95.51
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 95.48
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 95.48
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 95.47
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 95.47
4g65_A 461 TRK system potassium uptake protein TRKA; structur 95.45
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 95.43
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 95.4
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 95.39
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 95.36
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 95.35
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 95.33
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 95.31
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 95.29
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 95.29
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 95.28
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 95.27
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 95.26
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 95.24
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 95.23
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 95.21
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 95.18
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 95.15
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 95.13
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 95.12
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 95.07
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 95.03
1tt5_A531 APPBP1, amyloid protein-binding protein 1; cell cy 95.01
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 95.01
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 94.98
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 94.97
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 94.92
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 94.89
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 94.88
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 94.88
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 94.85
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 94.83
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 94.83
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 94.82
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 94.81
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 94.76
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 94.75
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 94.75
3tl2_A315 Malate dehydrogenase; center for structural genomi 94.72
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 94.72
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 94.71
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 94.71
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 94.68
3l6d_A306 Putative oxidoreductase; structural genomics, prot 94.66
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 94.65
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 94.63
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 94.61
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 94.6
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 94.59
3rpf_C74 Molybdopterin converting factor, subunit 1 (MOAD); 94.56
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 94.52
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 94.51
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 94.51
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 94.49
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 94.49
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 94.47
1vpd_A299 Tartronate semialdehyde reductase; structural geno 94.46
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 94.46
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 94.44
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 94.42
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 94.41
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 94.38
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 94.38
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 94.38
3ius_A286 Uncharacterized conserved protein; APC63810, silic 94.36
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 94.34
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 94.33
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 94.28
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 94.24
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 94.24
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 94.21
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 94.15
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 94.13
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 94.11
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 94.09
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 94.08
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 94.08
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 94.06
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 94.06
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 94.03
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 94.03
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 94.03
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 94.0
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 94.0
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 94.0
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 93.99
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 93.99
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 93.97
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 93.94
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 93.91
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 93.91
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 93.89
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 93.86
3qha_A296 Putative oxidoreductase; seattle structural genomi 93.86
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 93.81
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 93.79
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 93.79
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 93.78
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 93.77
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 93.76
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 93.74
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 93.68
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 93.66
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 93.65
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 93.64
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 93.63
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 93.6
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 93.56
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 93.55
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 93.54
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 93.49
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 93.46
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 93.45
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 93.45
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 93.45
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 93.43
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 93.42
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 93.4
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 93.38
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 93.35
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 93.33
4g65_A461 TRK system potassium uptake protein TRKA; structur 93.33
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 93.32
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 93.29
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 93.28
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 93.25
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 93.18
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 93.17
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 93.14
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 93.06
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 93.02
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 93.02
1yb4_A295 Tartronic semialdehyde reductase; structural genom 93.01
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 93.0
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 92.98
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 92.95
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 92.93
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 92.92
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 92.91
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 92.89
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 92.87
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 92.86
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 92.85
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 92.85
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 92.83
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 92.78
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 92.76
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 92.74
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 92.66
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 92.65
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 92.62
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 92.6
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 92.59
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 92.57
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 92.55
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 92.5
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 92.5
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 92.49
1lnq_A336 MTHK channels, potassium channel related protein; 92.49
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 92.47
3qlj_A322 Short chain dehydrogenase; structural genomics, se 92.45
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 92.45
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 92.43
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 92.39
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 92.33
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 92.32
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 92.3
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 92.24
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 92.24
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 92.23
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 92.22
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 92.14
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 92.12
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 92.11
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 92.06
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 92.05
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 92.03
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 92.03
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 92.01
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 92.01
3euw_A344 MYO-inositol dehydrogenase; protein structure init 92.0
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 91.99
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 91.98
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 91.97
2ixa_A444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 91.96
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 91.95
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 91.92
1xq6_A253 Unknown protein; structural genomics, protein stru 91.92
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 91.86
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 91.85
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 91.85
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 91.82
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 91.78
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 91.78
2wm3_A299 NMRA-like family domain containing protein 1; unkn 91.77
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 91.76
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 91.76
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 91.76
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 91.75
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 91.73
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 91.73
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 91.68
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 91.66
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 91.66
3fef_A450 Putative glucosidase LPLD; gulosidase, structural 91.66
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 91.66
3p2o_A285 Bifunctional protein fold; structural genomics, ce 91.61
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 91.61
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 91.61
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 91.6
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 91.58
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 91.55
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 91.54
3fr7_A525 Putative ketol-acid reductoisomerase (OS05G057370 91.52
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 91.51
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 91.47
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 91.44
3tox_A280 Short chain dehydrogenase; structural genomics, PS 91.42
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 91.37
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 91.32
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 91.26
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 91.25
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 91.25
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 91.23
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 91.18
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 91.15
3l07_A285 Bifunctional protein fold; structural genomics, ID 91.14
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 91.11
3e03_A274 Short chain dehydrogenase; structural genomics, PS 91.1
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 91.09
3rih_A293 Short chain dehydrogenase or reductase; structural 91.08
3imf_A257 Short chain dehydrogenase; structural genomics, in 91.03
1obb_A 480 Maltase, alpha-glucosidase; glycosidase, sulfinic 91.0
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 90.97
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 90.95
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 90.92
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 90.91
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genom 90.87
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 90.86
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 90.86
4gx0_A565 TRKA domain protein; membrane protein, ION channel 90.86
2rir_A300 Dipicolinate synthase, A chain; structural genomic 90.85
3tjr_A301 Short chain dehydrogenase; structural genomics, se 90.84
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 90.82
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 90.82
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 90.79
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 90.79
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 90.78
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 90.75
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 90.75
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 90.69
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 90.67
2q5w_D77 Molybdopterin converting factor, subunit 1; MOCO, 90.66
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 90.65
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 90.64
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 90.64
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 90.62
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 90.62
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 90.62
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 90.58
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 90.57
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 90.49
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 90.47
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 90.45
4eso_A255 Putative oxidoreductase; NADP, structural genomics 90.44
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 90.44
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 90.41
3cxt_A291 Dehydrogenase with different specificities; rossma 90.38
1spx_A278 Short-chain reductase family member (5L265); paral 90.35
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 90.33
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 90.33
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 90.31
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 90.3
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 90.23
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 90.18
2duw_A145 Putative COA-binding protein; ligand binding prote 90.16
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 90.16
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 90.14
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 90.13
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 90.1
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 90.06
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 90.05
1s6y_A450 6-phospho-beta-glucosidase; hydrolase, structural 90.05
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 90.02
4f6c_A427 AUSA reductase domain protein; thioester reductase 89.97
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 89.96
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 89.94
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 89.92
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 89.92
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 89.9
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 89.87
3tsc_A277 Putative oxidoreductase; structural genomics, seat 89.86
1xkq_A280 Short-chain reductase family member (5D234); parra 89.86
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 89.85
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 89.85
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 89.82
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 89.81
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 89.77
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 89.75
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 89.74
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 89.74
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 89.73
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 89.72
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 89.71
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 89.71
1xq1_A266 Putative tropinone reducatse; structural genomics, 89.7
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 89.68
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 89.59
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 89.58
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 89.58
3edm_A259 Short chain dehydrogenase; structural genomics, ox 89.52
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 89.51
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 89.47
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 89.47
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 89.43
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 89.4
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 89.4
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 89.4
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 89.37
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 89.33
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 89.32
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 89.31
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 89.3
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 89.25
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 89.2
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 89.19
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 89.18
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 89.14
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 89.14
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 89.11
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 89.1
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 89.09
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 89.04
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 89.04
4hb9_A412 Similarities with probable monooxygenase; flavin, 89.03
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 89.0
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 88.94
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 88.92
2cu3_A64 Unknown function protein; thermus thermophilus HB8 88.91
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 88.91
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 88.85
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 88.83
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 88.79
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 88.78
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 88.77
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 88.73
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 88.7
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 88.69
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 88.65
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 88.64
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 88.63
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 88.61
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 88.61
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 88.61
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 88.61
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 88.6
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
Probab=100.00  E-value=2.5e-50  Score=399.45  Aligned_cols=242  Identities=44%  Similarity=0.712  Sum_probs=220.8

Q ss_pred             CCHHHHhhhhhcccccccCHHHHHHhhcCcEEEEcCCcchHHHHHHhHHcCCceEEEEeCCcccccCCCcccccCCCCCC
Q psy13373        125 FSKDITERYSRQILLDQVGVMGQEKLLNASVLIVGCGGTGSPCIQYLAASGVGTLGLADYDRVELSNLHRQVIHTTHTIG  204 (525)
Q Consensus       125 l~~~~~~rysRq~~l~~~G~~~q~kL~~~~VlViG~GglGs~ia~~La~~GVg~i~lvD~d~V~~sNL~Rq~l~~~~diG  204 (525)
                      ||++|.+||+||++++.||.++|++|++++|+|+|+||+|++++++|+++||++|+|+|+|.|+.+||+||++|+.+|||
T Consensus         1 l~~~e~~ry~Rq~~l~~~g~~~q~~l~~~~VlvvG~GglG~~va~~La~~Gvg~i~lvD~d~v~~sNL~Rq~l~~~~diG   80 (251)
T 1zud_1            1 MNDRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAALYLAGAGVGTLVLADDDDVHLSNLQRQILFTTEDID   80 (251)
T ss_dssp             CCHHHHHHTHHHHTSTTTHHHHHHHHHTCEEEEECCSTTHHHHHHHHHHTTCSEEEEECCCBCCGGGTTTCTTCCGGGTT
T ss_pred             CCHHHHHHhhhhcchhhcCHHHHHHHhcCcEEEEccCHHHHHHHHHHHHcCCCeEEEEeCCCcccccCCCCccCChhhCC
Confidence            57889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcHHHHHHHHHHhhCCCcEEEEeeecCCcchHhHhhccCCeEeecCCCHHHHHHHHHHhHhcCCcEEEecccCccceEEE
Q psy13373        205 QPKVTSAKRFISAINRNTIVHAYQTLLDTSNACDIIRRYDVVVDACDNAPTRYLLNDACLREGRPLVSASALGLEGQLCV  284 (525)
Q Consensus       205 ~~Ka~~~~~~l~~lnp~v~v~~~~~~i~~~~~~~~~~~~dvVi~~~d~~~~r~~l~~~~~~~~~p~i~~~~~g~~G~v~v  284 (525)
                      ++|+++++++|+++||+++|+.+...++.++..++++++|+||+|+|++..+..++++|++.++|+|++++.|+.|++.+
T Consensus        81 ~~Ka~~~~~~l~~~np~~~v~~~~~~~~~~~~~~~~~~~DvVi~~~d~~~~r~~l~~~~~~~~~p~i~~~~~g~~G~v~~  160 (251)
T 1zud_1           81 RPKSQVSQQRLTQLNPDIQLTALQQRLTGEALKDAVARADVVLDCTDNMATRQEINAACVALNTPLITASAVGFGGQLMV  160 (251)
T ss_dssp             SBHHHHHHHHHHHHCTTSEEEEECSCCCHHHHHHHHHHCSEEEECCSSHHHHHHHHHHHHHTTCCEEEEEEEBTEEEEEE
T ss_pred             CHHHHHHHHHHHHHCCCCEEEEEeccCCHHHHHHHHhcCCEEEECCCCHHHHHHHHHHHHHhCCCEEEEeccccceEEEE
Confidence            99999999999999999999999988888778889999999999999999999999999999999999999999999999


Q ss_pred             EecCC-CCceeecCCCCCCCCCCCCcCCCCcccchhHHHHHHHHHHHHHHHhCC-CCCCeEEEEEcCCCeeEEeeecCCC
Q psy13373        285 YNYKG-GPCYRCIYPVPPPAETVGTCGDNGVLGPVPGVMGTLQAVETIKLLIGL-PVMDKLLVYDAELSKFLSVKLRKKK  362 (525)
Q Consensus       285 ~~~~~-~~c~~c~~~~~~~~~~~~~c~~~~~~~~~~~ivg~~~a~e~lk~l~g~-~~l~~~~~~d~~~~~~~~~~l~~r~  362 (525)
                      +.|.. ++||+|++++.+..  ...|...|+++|+++++|+++|.|+||+|+|. ++++++++||+.++.++.+++. |+
T Consensus       161 ~~p~~~~~c~~cl~~~~~~~--~~~~~~~g~~~p~~~~~g~~~A~e~lk~l~g~~~~~~~~~~~d~~~~~~~~~~~~-~~  237 (251)
T 1zud_1          161 LTPPWEQGCYRCLWPDNQEP--ERNCRTAGVVGPVVGVMGTLQALEAIKLLSGIETPAGELRLFDGKSSQWRSLALR-RA  237 (251)
T ss_dssp             ECTTCTTCCHHHHCC-------------CCBCHHHHHHHHHHHHHHHHHHHHTCCCCCSEEEEEETTTTEEEEEECC-CC
T ss_pred             EccCCCCCcEEEeCCCCCCC--CCccccCCchHHHHHHHHHHHHHHHHHHHhCCCCcCCcEEEEECCCCEEEEEecC-CC
Confidence            98876 79999999864432  24688899999999999999999999999999 5459999999999999999986 99


Q ss_pred             CCC-ccCC
Q psy13373        363 EDC-VCAH  369 (525)
Q Consensus       363 p~C-~C~~  369 (525)
                      |+| +|+.
T Consensus       238 p~C~~C~~  245 (251)
T 1zud_1          238 SGCPVCGG  245 (251)
T ss_dssp             TTCTTTCC
T ss_pred             cCCCccCC
Confidence            999 9943
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1wgk_A Riken cDNA 2900073H19 protein; THis domain, ubiqutin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.3.3 PDB: 1xo3_A Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwg_C 9.5 kDa culture filtrate antigen CFP10A; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3dwm_A Back     alignment and structure
>2qjl_A URM1, ubiquitin-related modifier 1; ubiquitin-like protein, signaling protein; 1.44A {Saccharomyces cerevisiae} PDB: 2pko_A 2ax5_A Back     alignment and structure
>2k9x_A Tburm1, uncharacterized protein; unknown function; NMR {Trypanosoma brucei} Back     alignment and structure
>2g1e_A Hypothetical protein TA0895; MOAD, molybdopterin, transferase; NMR {Thermoplasma acidophilum} PDB: 2k22_A Back     alignment and structure
>2l52_A Methanosarcina acetivorans SAMP1 homolog; beta-grAsp fold, protein binding, E1-like, SAMP activator, ELSA, adenylation, ubiquitin; NMR {Methanosarcina acetivorans} Back     alignment and structure
>3po0_A Small archaeal modifier protein 1; ubiquitin-like protein, protein binding; 1.55A {Haloferax volcanii} PDB: 2l83_A Back     alignment and structure
>1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1fm0_D Molybdopterin convertin factor, subunit 1; molybdenum cofactor biosynthesis, transferase; 1.45A {Escherichia coli} SCOP: d.15.3.1 PDB: 1fma_D 1jw9_D 1jwa_D* 1jwb_D* 3bii_D 1nvi_D Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>2q5w_D Molybdopterin converting factor, subunit 1; MOCO, MPT synthase, MOAD, MOAE, transferase, molybdenum cofactor biosynthesis; 2.00A {Staphylococcus aureus} PDB: 2qie_B* Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>2cu3_A Unknown function protein; thermus thermophilus HB8, structural genomics, riken structu genomics/proteomics initiative, RSGI, NPPSFA; 1.70A {Thermus thermophilus} SCOP: d.15.3.2 PDB: 2htm_E Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 525
d1yova1 529 c.111.1.2 (A:6-534) Amyloid beta precursor protein 4e-60
d1yovb1426 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T 2e-55
d1jw9b_247 c.111.1.1 (B:) Molybdenum cofactor biosynthesis pr 8e-53
d1tq1a_119 c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc 3e-06
d1gmxa_108 c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia 0.001
d1e5qa1182 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase 0.004
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Activating enzymes of the ubiquitin-like proteins
superfamily: Activating enzymes of the ubiquitin-like proteins
family: Ubiquitin activating enzymes (UBA)
domain: Amyloid beta precursor protein-binding protein 1, APPBP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  204 bits (521), Expect = 4e-60
 Identities = 40/181 (22%), Positives = 69/181 (38%), Gaps = 7/181 (3%)

Query: 124 KFSKDITERYSRQILLDQVGVMGQEKLLNASVLIVGCGGTGSPCIQYLAASGVGTLGLAD 183
           K  K+  ++Y RQ+ L   G  GQE L +A V ++    TG+  ++ L   G+G+  + D
Sbjct: 1   KLLKE--QKYDRQLRL--WGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIID 56

Query: 184 YDRVELSNLHRQVIHTTHTIGQPKVTSAKRFISAINRNTIVHAYQTLLD--TSNACDIIR 241
            ++V   +          +IG+ +  +A  F+  +N +      +   +    N      
Sbjct: 57  GNQVSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFC 116

Query: 242 RYDVVVDACDNAPTRYLLNDACLREGRPLVSASALGLEGQLCVYNYKGGPCYRCIYPVPP 301
           R+ VVV       T   L D       PL+     GL G + +   K  P          
Sbjct: 117 RFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRII-IKEHPVIESHPDNAL 175

Query: 302 P 302
            
Sbjct: 176 E 176
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Length = 247 Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 182 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query525
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 100.0
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 99.98
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 99.86
d1yt8a1136 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.84
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 99.81
d1yt8a2101 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.81
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 99.8
d1e0ca2136 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.79
d1yt8a3157 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.79
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.77
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.74
d1t3ka_132 Dual specificity phosphatase Cdc25 {Thale cress (A 99.69
d1uara2141 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.67
d1c25a_161 CDC25a {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 99.66
d1ymka1174 CDC25b {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1uara1143 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.61
d1e0ca1135 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.59
d1urha1147 3-mercaptopyruvate sulfurtransferase {Escherichia 99.57
d1okga2139 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.55
d1rhsa1149 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.51
d2gwfa1135 Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum 99.44
d1hzma_154 Erk2 binding domain of Mapk phosphatase mkp-3 {Hum 99.32
d1okga1156 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.28
d1xo3a_101 C9orf74 homolog {Mouse (Mus musculus) [TaxId: 1009 98.94
d1v8ca187 MoaD-related protein, N-terminal domain {Thermus t 98.68
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.8
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.66
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.37
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.19
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.12
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 97.11
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 97.1
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.09
d1vjka_88 Molybdopterin synthase subunit MoaD {Pyrococcus fu 97.02
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.87
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.84
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 96.79
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 96.78
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.77
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.71
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 96.66
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 96.48
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 96.38
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.38
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 96.37
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 96.3
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 96.25
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.24
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.2
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 96.17
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 96.17
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 96.16
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 96.16
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.16
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 96.13
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.12
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 96.11
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 96.05
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 95.94
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.92
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 95.9
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 95.89
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 95.87
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 95.75
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 95.72
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 95.64
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 95.63
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 95.59
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 95.58
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 95.46
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 95.43
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.35
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 95.3
d1yova1529 Amyloid beta precursor protein-binding protein 1, 95.23
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 95.19
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 95.18
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 95.1
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.09
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 95.09
d1id1a_153 Rck domain from putative potassium channel Kch {Es 95.03
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 95.01
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 94.96
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 94.95
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 94.83
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 94.77
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 94.74
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 94.73
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 94.72
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 94.67
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 94.52
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 94.45
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 94.41
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 94.35
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 94.28
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 94.26
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 94.1
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 93.99
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 93.99
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 93.94
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 93.92
d2vapa1209 Cell-division protein FtsZ {Archaeon Methanococcus 93.91
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 93.89
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 93.73
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 93.72
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 93.62
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 93.58
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 93.55
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 93.53
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 93.44
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 93.29
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 93.27
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 93.26
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 93.15
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 93.04
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 93.04
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 93.03
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 93.02
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 93.01
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 92.99
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 92.97
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 92.95
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 92.92
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 92.9
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 92.88
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 92.88
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 92.84
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 92.78
d1ofua1198 Cell-division protein FtsZ {Pseudomonas aeruginosa 92.78
d1fm0d_81 Molybdopterin synthase subunit MoaD {Escherichia c 92.69
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 92.66
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 92.64
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 92.63
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 92.58
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 92.53
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 92.46
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 92.42
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 92.39
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 92.38
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 92.34
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 92.28
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 92.28
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 92.11
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 92.11
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 92.08
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 92.06
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 92.06
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 92.02
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 91.99
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 91.99
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 91.94
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 91.93
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 91.83
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 91.73
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 91.72
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 91.67
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 91.66
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 91.65
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 91.63
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 91.62
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 91.57
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 91.54
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 91.53
d1rq2a1198 Cell-division protein FtsZ {Mycobacterium tubercul 91.52
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 91.49
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 91.4
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 91.39
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 91.35
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 91.35
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 91.35
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 91.29
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 91.2
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 91.19
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 91.18
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 91.11
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 91.08
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 91.02
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 90.97
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 90.9
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 90.87
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 90.82
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 90.8
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 90.71
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 90.7
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 90.4
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 90.37
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 90.34
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 90.29
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 90.25
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 90.22
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 90.06
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 90.0
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 89.62
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 89.38
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 89.35
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 89.34
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 89.25
d1gq2a1298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 89.14
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 89.14
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 89.13
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 89.06
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 89.03
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 89.02
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 88.99
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 88.89
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 88.85
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 88.61
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 88.61
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 88.57
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 88.46
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 88.4
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 88.31
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 88.31
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 88.27
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 88.19
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 88.1
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 88.08
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 88.07
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 88.05
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 87.86
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 87.84
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 87.61
d3bswa1193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 87.51
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 87.37
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 87.31
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 87.2
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 87.19
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 87.17
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 87.05
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 86.75
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 86.71
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 86.67
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 86.58
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 86.52
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 86.51
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 86.49
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 86.34
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 86.18
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 86.15
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 86.13
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 86.1
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 86.08
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 86.06
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 86.03
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 85.96
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 85.95
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 85.87
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 85.72
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 85.62
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 85.38
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 85.32
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 84.8
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 84.75
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 84.67
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 84.53
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 84.48
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 84.48
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 84.34
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 84.24
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 83.92
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 83.92
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 83.83
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 83.78
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 83.69
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 83.68
d1pj3a1294 Mitochondrial NAD(P)-dependent malic enzyme {Human 83.57
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 83.39
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 83.33
d1o0sa1308 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 83.26
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 83.18
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 83.05
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 83.03
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 82.9
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 82.63
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 82.53
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 82.44
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 82.35
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 82.32
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 82.27
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 82.26
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 82.19
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 81.94
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 81.74
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 81.18
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 81.12
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 80.94
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 80.86
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 80.65
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 80.6
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 80.58
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 80.56
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 80.16
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 80.16
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 80.14
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Activating enzymes of the ubiquitin-like proteins
superfamily: Activating enzymes of the ubiquitin-like proteins
family: Molybdenum cofactor biosynthesis protein MoeB
domain: Molybdenum cofactor biosynthesis protein MoeB
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=5.6e-52  Score=407.83  Aligned_cols=242  Identities=42%  Similarity=0.724  Sum_probs=223.7

Q ss_pred             CCCHHHHhhhhhcccccccCHHHHHHhhcCcEEEEcCCcchHHHHHHhHHcCCceEEEEeCCcccccCCCcccccCCCCC
Q psy13373        124 KFSKDITERYSRQILLDQVGVMGQEKLLNASVLIVGCGGTGSPCIQYLAASGVGTLGLADYDRVELSNLHRQVIHTTHTI  203 (525)
Q Consensus       124 ~l~~~~~~rysRq~~l~~~G~~~q~kL~~~~VlViG~GglGs~ia~~La~~GVg~i~lvD~d~V~~sNL~Rq~l~~~~di  203 (525)
                      +||++|++||+||++|+++|.++|+||++++|+|+|+||+||++|++|+++|||+|+|+|+|.|+++||+||++|+.+||
T Consensus         2 ~l~~~e~~ry~Rqi~l~~~g~~~Q~kL~~~~VliiG~GglGs~va~~La~~Gvg~i~lvD~D~Ve~sNL~RQ~l~~~~di   81 (247)
T d1jw9b_           2 ELSDQEMLRYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLLDFDTVSLSNLQRQTLHSDATV   81 (247)
T ss_dssp             CCCHHHHHHTHHHHTSTTTHHHHHHHHHHCEEEEECCSHHHHHHHHHHHHHTCSEEEEECCCBCCGGGGGTCTTCCGGGT
T ss_pred             CCCHHHHHHhhceeccccCCHHHHHHHhCCCEEEECCCHHHHHHHHHHHHcCCCeEEEECCcccchhhhhhhccccHhhc
Confidence            68999999999999998889999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcHHHHHHHHHHhhCCCcEEEEeeecCCcchHhHhhccCCeEeecCCCHHHHHHHHHHhHhcCCcEEEecccCccceEE
Q psy13373        204 GQPKVTSAKRFISAINRNTIVHAYQTLLDTSNACDIIRRYDVVVDACDNAPTRYLLNDACLREGRPLVSASALGLEGQLC  283 (525)
Q Consensus       204 G~~Ka~~~~~~l~~lnp~v~v~~~~~~i~~~~~~~~~~~~dvVi~~~d~~~~r~~l~~~~~~~~~p~i~~~~~g~~G~v~  283 (525)
                      |++|+++++++|+++||+++|+.+...++..+...++..+|+||+|+|++..+.+++++|+++++|+|+++..|+.|++.
T Consensus        82 G~~K~~~a~~~l~~~np~~~i~~~~~~~~~~~~~~~~~~~divid~~d~~~~~~~in~~~~~~~ip~i~g~~~~~~g~~~  161 (247)
T d1jw9b_          82 GQPKVESARDALTRINPHIAITPVNALLDDAELAALIAEHDLVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQIT  161 (247)
T ss_dssp             TSBHHHHHHHHHHHHCTTSEEEEECSCCCHHHHHHHHHTSSEEEECCSSHHHHHHHHHHHHHHTCCEEEEEEEBTEEEEE
T ss_pred             CchHHHHHHHHHHHhhcccchhhhhhhhhhccccccccccceeeeccchhhhhhhHHHHHHHhCCCcccccccccccceE
Confidence            99999999999999999999999999998888888999999999999999999999999999999999999999999998


Q ss_pred             EEe-cCCCCceeecCCCCCCCCCCCCcCCCCcccchhHHHHHHHHHHHHHHHhCC-CCC-CeEEEEEcCCCeeEEeeecC
Q psy13373        284 VYN-YKGGPCYRCIYPVPPPAETVGTCGDNGVLGPVPGVMGTLQAVETIKLLIGL-PVM-DKLLVYDAELSKFLSVKLRK  360 (525)
Q Consensus       284 v~~-~~~~~c~~c~~~~~~~~~~~~~c~~~~~~~~~~~ivg~~~a~e~lk~l~g~-~~l-~~~~~~d~~~~~~~~~~l~~  360 (525)
                      ++. ++.++|+.|+++..+.  ....|.+.|+++|.++++|+++|+|++|+|+|. +++ ++++.||+.++.++.+++. 
T Consensus       162 ~~~~~~~~~c~~c~~~~~~~--~~~~~~~~g~~~p~~~~v~~~~a~e~ik~l~g~~~~~~~~~~~~d~~~~~~~~~~~~-  238 (247)
T d1jw9b_         162 VFTYQDGEPCYRCLSRLFGE--NALTCVEAGVMAPLIGVIGSLQAMEAIKMLAGYGKPASGKIVMYDAMTCQFREMKLM-  238 (247)
T ss_dssp             EECCCTTCCCTHHHHTTCCC---------CCBCHHHHHHHHHHHHHHHHHHHHTCSCCCBSEEEEEETTTTEEEEEECC-
T ss_pred             EEeecCCccccccccccccc--ccCCcccCCcccccchhHHHHHHHHHHHHHhcCCCcCcCcEEEEECCCCEEEEEecC-
Confidence            875 5678999999876554  334688889999999999999999999999999 777 9999999999999999985 


Q ss_pred             CCCCC-ccC
Q psy13373        361 KKEDC-VCA  368 (525)
Q Consensus       361 r~p~C-~C~  368 (525)
                      |+|+| +|+
T Consensus       239 ~~~~C~vCG  247 (247)
T d1jw9b_         239 RNPGCEVCG  247 (247)
T ss_dssp             CCTTCTTTC
T ss_pred             cCcCCCCCC
Confidence            99999 994
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1xo3a_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v8ca1 d.15.3.1 (A:1-87) MoaD-related protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fm0d_ d.15.3.1 (D:) Molybdopterin synthase subunit MoaD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure