Psyllid ID: psy13389


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------
MDVMSMMGKYVDANEEESKDIEKLVIEESASEDSDDEEDEDFENDENSSGKKMVKKFKCNICPKRYARKNRLTNHLRTHEAGSGDEKSEGGEGSFTCSQCPKTFVDKWHLNRHLKSHSENKVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHEGIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKPFLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNHDGLKPFHCSVCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIHLKLQHGVNPFKCDVCPNETFEKETQLSLHMRTVHGVKPFKCSMCDEGFPKKSVLKEHLRVSHNVNPFKCDICFKLFTKKSNLRTHIKTHEPIPCDKCPEIFEKKTDLQEHVDKCHNLHEEDEEEGLDEFDAPKEKSFNCSKCLNIVRIPVEIKSLVEKLTSEGVPAVQAYEHGEDAARDADILVTATYSSVPVLKYEWLKKKDAHINAVGAGLNHHSELDAAIYSHSSIFFDSEAAARGELKGLYEQVPANMVGEVGGLIAANLTRDARYPLTVFHSMGV
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccHHHHccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccHHHHcccccccccccccccccccccccccHHHccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccEEcccEEEEcccHHHHccccccccccccccccEEEEccccc
cccHHHcccccccccccccHHHHcHccccccccccccccccEEcccccEEcccccccEccccccEEccccHHHHHHHHcccccccccEcccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHccccccEEccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHccHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEcccccccEEEcccHHHHHHHHccccccEEccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEcccEEccccHHHHHHHHHccccccccHHHHHHHHcccccccccccccccEcccccHHHHHHEEccccccccccccccccEccccHHHHHHHHHcHHHHHHHccccccccccccccEEEcccHHHHHHHHcccccccccHccHHHHccccEEccccccccEEEEcHHHccHcccccccEEEEccc
mdvmsmmgkyvdaneeesKDIEKLVIEesasedsddeededfendenssgkkMVKKfkcnicpkryarknrltnhlrtheagsgdekseggegsftcsqcpktfvdkwhlnrhlkshsenkvfrceqcrfdfyvkreynrhmkihDGVKVFLCSVcsktftdkvkfnrhmrahegikpfqcsvcsesftqrsNLNIHLRihdgirpfqcnvcyicftnksdlnrhsrihngikpflcsmcakcfsrkddlnrhmkihegskrylctmcpkcftrkddlnrhmrnhdglkpfhcsvcfesFTQKALLNIHLRihtnskphacsictesfsqksNLYIHLKLQhgvnpfkcdvcpnetfekETQLSLHMrtvhgvkpfkcsmcdegfpkksvLKEHLRvshnvnpfkcdicfklftkksnlrthikthepipcdkcpeifEKKTDLQEHVDKChnlheedeeegldefdapkeksfncskclnivriPVEIKSLVEKLtsegvpavqayehgedaarDADILVTATyssvpvlkyewLKKKDAHINAVGaglnhhseldaaiyshssiffdsEAAARGELKGLYEQVPANMVGEVGGLIAanltrdaryplTVFHSMGV
MDVMSMMGKyvdaneeeskdiEKLVIEesasedsddeededfendenssgkkmvkkfkcnicpkryarknrltnhlrtheagsgdekseggeGSFTCSQCPKTFVDKWHLNRHlkshsenkvfrceqCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHEGIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKPFLCSMCAKCFSRKDDLNRHMKIhegskrylctmcPKCFTRKDDLNRHMRNHDGLKPFHCSVCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIHLKLQHGVNPFKCDVCPNETFEKETQLSLHMRTVHGVKPFKCSMCDEGFPKKSVLKEHLRVSHNVNPFKCDICFKLFTKKSNlrthikthepipcdkcpeIFEKKTDLQEHVDKCHNLHEEdeeegldefdapkeksfncskclniVRIPVEIKSLVEKLTSEGVPAVQAYEHGEDAARDADILVTATYSSVPVLKYEWLKKKDAHINAVGAGLNHHSELDAAIYSHSSIFFDSEAAARGELKGLYEQVPANMVGEVGGLIAAnltrdarypltvfhsmgv
MDVMSMMGKYVDANEEESKDIEKLVIeesasedsddeededfendenssGKKMVKKFKCNICPKRYARKNRLTNHLRTHEAgsgdekseggegsFTCSQCPKTFVDKWHLNRHLKSHSENKVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHEGIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKPFLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNHDGLKPFHCSVCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIHLKLQHGVNPFKCDVCPNETFEKETQLSLHMRTVHGVKPFKCSMCDEGFPKKSVLKEHLRVSHNVNPFKCDICFKLFTKKSNLRTHIKTHEPIPCDKCPEIFEKKTDLQEHVDKCHNLHeedeeegldefdAPKEKSFNCSKCLNIVRIPVEIKSLVEKLTSEGVPAVQAYEHGEDAARDADILVTATYSSVPVLKYEWLKKKDAHINAVGAGLNHHSELDAAIYSHSSIFFDSEAAARGELKGLYEQVPANMVGEVGGLIAANLTRDARYPLTVFHSMGV
*******************************************************KFKCNICPKRYA***************************FTCSQCPKTFVDKWHLNRHLKSHSENKVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHEGIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKPFLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNHDGLKPFHCSVCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIHLKLQHGVNPFKCDVCPNETFEKETQLSLHMRTVHGVKPFKCSMCDEGFPKKSVLKEHLRVSHNVNPFKCDICFKLFTKKSNLRTHIKTHEPIPCDKCPEIFEKKT*******************************FNCSKCLNIVRIPVEIKSLVEKLTSEGVPAVQAYEHGEDAARDADILVTATYSSVPVLKYEWLKKKDAHINAVGAGLNHHSELDAAIYSHSSIFFDSEAAARGELKGLYEQVPANMVGEVGGLIAANLTRDARYPLTVFH****
***************************ESASEDSDDEEDED**********KMVKKFKCNICPKRYARKNRLTNHLRTHEAGSGDEKSEGGEGSFTCSQCPKTFVDKWHLNRHLKSHSENKVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHEGIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKPFLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNHDGLKPFHCSVCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIHLKLQHGVNPFKCDVCPNETFEKETQLSLHMRTVHGVKPFKCSMCDEGFPKKSVLKEHLRVSHNVNPFKCDICFKLFTKKSNLRTHIKTHEPIPCDKCPEIFEKKTDLQEHVDKCHNLHEEDEEEGLDEFDAPKEKSFNCSKCLNIVRIPVEIKSLVEKLTSEGVPAVQAYEHGEDAARDADILVTATYSSVPVLKYEWLKKKDAHINAVGAGLNHHSELDAAIYSHSSIFFDSEAAARGELKGLYEQVPANMVGEVGGLIAANLTRDARYPLTVFHSMGV
********KYVDANEEESKDIEKLVIE************************KMVKKFKCNICPKRYARKNRLTNHLRTH****************TCSQCPKTFVDKWHLNRHLKSHSENKVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHEGIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKPFLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNHDGLKPFHCSVCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIHLKLQHGVNPFKCDVCPNETFEKETQLSLHMRTVHGVKPFKCSMCDEGFPKKSVLKEHLRVSHNVNPFKCDICFKLFTKKSNLRTHIKTHEPIPCDKCPEIFEKKTDLQEHVDKCHNL***********FDAPKEKSFNCSKCLNIVRIPVEIKSLVEKLTSEGVPAVQAYEHGEDAARDADILVTATYSSVPVLKYEWLKKKDAHINAVGAGLNHHSELDAAIYSHSSIFFDSEAAARGELKGLYEQVPANMVGEVGGLIAANLTRDARYPLTVFHSMGV
MDVMSMMGKYVDANEEESKDIEKLVIEESASEDSDDEEDEDFENDENSSGKKMVKKFKCNICPKRYARKNRLTNHLRTHEAGSGDEKSEGGEGSFTCSQCPKTFVDKWHLNRHLKSHSENKVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHEGIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKPFLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNHDGLKPFHCSVCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIHLKLQHGVNPFKCDVCPNETFEKETQLSLHMRTVHGVKPFKCSMCDEGFPKKSVLKEHLRVSHNVNPFKCDICFKLFTKKSNLRTHIKTHEPIPCDKCPEIFEKKTDLQEHVDKCHNLHEEDEEEGLDEFDAPKEKSFNCSKCLNIVRIPVEIKSLVEKLTSEGVPAVQAYEHGEDAARDADILVTATYSSVPVLKYEWLKKKDAHINAVGAGLNHHSELDAAIYSHSSIFFDSEAAARGELKGLYEQVPANMVGEVGGLIAANLTRDARYPLTVFHSMG*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVMSMMGKYVDANEEESKDIEKLVIEESASEDSDDEEDEDFENDENSSGKKMVKKFKCNICPKRYARKNRLTNHLRTHEAGSGDEKSEGGEGSFTCSQCPKTFVDKWHLNRHLKSHSENKVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHEGIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKPFLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNHDGLKPFHCSVCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIHLKLQHGVNPFKCDVCPNETFEKETQLSLHMRTVHGVKPFKCSMCDEGFPKKSVLKEHLRVSHNVNPFKCDICFKLFTKKSNLRTHIKTHEPIPCDKCPEIFEKKTDLQEHVDKCHNLHEEDEEEGLDEFDAPKEKSFNCSKCLNIVRIPVEIKSLVEKLTSEGVPAVQAYEHGEDAARDADILVTATYSSVPVLKYEWLKKKDAHINAVGAGLNHHSELDAAIYSHSSIFFDSEAAARGELKGLYEQVPANMVGEVGGLIAANLTRDARYPLTVFHSMGV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query617 2.2.26 [Sep-21-2011]
P51523738 Zinc finger protein 84 OS yes N/A 0.619 0.517 0.398 1e-77
P10076861 Zinc finger protein 26 OS no N/A 0.619 0.443 0.368 3e-75
Q5JVG2852 Zinc finger protein 484 O no N/A 0.619 0.448 0.376 4e-75
Q5RB30769 Zinc finger protein 585B no N/A 0.619 0.496 0.388 7e-75
Q52M93769 Zinc finger protein 585B no N/A 0.619 0.496 0.386 1e-74
Q6P3V2769 Zinc finger protein 585A no N/A 0.619 0.496 0.391 1e-74
Q5RDX1737 Zinc finger protein 585A no N/A 0.619 0.518 0.388 4e-74
Q8N4W9903 Zinc finger protein 808 O no N/A 0.619 0.423 0.371 5e-74
Q5R5U3672 Zinc finger protein 271 O no N/A 0.619 0.568 0.376 8e-74
A0JNB1787 Zinc finger protein 227 O no N/A 0.619 0.485 0.351 9e-74
>sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 Back     alignment and function desciption
 Score =  291 bits (744), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 158/396 (39%), Positives = 216/396 (54%), Gaps = 14/396 (3%)

Query: 55  KKFKCNICPKRYARKNRLTNHLRTHEAGSGDEKSEGGEGSFTCSQCPKTFVDKWHLNRHL 114
           K + CN C + ++ K+ L NH R H           GE  F C +C K F  K  L  H 
Sbjct: 317 KPYGCNECGRAFSEKSNLINHQRIHT----------GEKPFECRECGKAFSRKSQLVTHH 366

Query: 115 KSHSENKVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHE 174
           ++H+  K F C  CR  F+ K E  RH  IH G K + CS C K F ++     H R H 
Sbjct: 367 RTHTGTKPFGCSDCRKAFFEKSELIRHQTIHTGEKPYECSECRKAFRERSSLINHQRTHT 426

Query: 175 GIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKP 234
           G KP  C  C ++F+Q+S+L  H   H G +PF C+ C   F+ KS L RH R H G KP
Sbjct: 427 GEKPHGCIQCGKAFSQKSHLISHQMTHTGEKPFICSKCGKAFSRKSQLVRHQRTHTGEKP 486

Query: 235 FLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNHDGLKPFHCS 294
           + CS C K FS K  L  H +IH G K Y+C+ C K F +K  L  H R H G KP+ CS
Sbjct: 487 YECSECGKAFSEKLSLTNHQRIHTGEKPYVCSECGKAFCQKSHLISHQRTHTGEKPYECS 546

Query: 295 VCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIHLKLQHGVNPFKCDVCPN 354
            C ++F +K+ L  H R HT  KP+ C  C ++FSQKS L  H ++  G  P++C +C  
Sbjct: 547 ECGKAFGEKSSLATHQRTHTGEKPYECRDCEKAFSQKSQLNTHQRIHTGEKPYECSLCRK 606

Query: 355 ETFEKETQLSLHMRTVHGVKPFKCSMCDEGFPKKSVLKEHLRVSHNVNPFKCDICFKLFT 414
             FEK ++L  H+RT  G KP++C+ C + F +KS L  H R+     PF+C  C K F+
Sbjct: 607 AFFEK-SELIRHLRTHTGEKPYECNECRKAFREKSSLINHQRIHTGEKPFECSECGKAFS 665

Query: 415 KKSNLRTHIKTH---EPIPCDKCPEIFEKKTDLQEH 447
           +KS+L  H +TH   +P  C +C + F +K+ L  H
Sbjct: 666 RKSHLIPHQRTHTGEKPYGCSECRKAFSQKSQLVNH 701




May be involved in transcriptional regulation.
Homo sapiens (taxid: 9606)
>sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 Back     alignment and function description
>sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 Back     alignment and function description
>sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 Back     alignment and function description
>sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 Back     alignment and function description
>sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 Back     alignment and function description
>sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 Back     alignment and function description
>sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 Back     alignment and function description
>sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 Back     alignment and function description
>sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query617
326666835576 PREDICTED: zinc finger protein 271-like 0.659 0.706 0.410 5e-88
326667171681 PREDICTED: zinc finger protein 850-like 0.661 0.599 0.400 7e-88
326667187 1365 PREDICTED: zinc finger protein 729-like 0.620 0.280 0.425 3e-87
326680879710 PREDICTED: zinc finger protein 721-like, 0.658 0.571 0.409 1e-86
326667106 941 PREDICTED: zinc finger protein 729-like 0.620 0.407 0.423 3e-86
326680667 1782 PREDICTED: zinc finger protein 729-like 0.661 0.228 0.393 1e-85
390345459581 PREDICTED: zinc finger protein 84-like [ 0.620 0.659 0.423 7e-85
326670221661 PREDICTED: zinc finger protein 91-like [ 0.620 0.579 0.420 2e-84
443728181462 hypothetical protein CAPTEDRAFT_135345 [ 0.622 0.831 0.399 6e-84
326666983 853 PREDICTED: zinc finger protein 91-like [ 0.614 0.444 0.414 5e-83
>gi|326666835|ref|XP_003198391.1| PREDICTED: zinc finger protein 271-like [Danio rerio] Back     alignment and taxonomy information
 Score =  332 bits (850), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 177/431 (41%), Positives = 240/431 (55%), Gaps = 24/431 (5%)

Query: 55  KKFKCNICPKRYARKNRLTNHLRTHEAGSGDEKSEGGEGSFTCSQCPKTFVDKWHLNRHL 114
           + F C  C K +++ + L  H+R H           GE  FTC+QC K+F    HLN H+
Sbjct: 115 RPFTCTQCGKSFSQSSSLNQHMRIHT----------GEKPFTCTQCEKSFSQSSHLNEHM 164

Query: 115 KSHSENKVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHE 174
             H+  K F C QCR +FY     N+HM+IH G K F C+ C K+F+     N HMR H 
Sbjct: 165 MIHTGKKPFTCTQCRKNFYCSSHLNKHMRIHTGEKPFTCTQCGKSFSRSSSLNLHMRIHT 224

Query: 175 GIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKP 234
           G+KPF C+ C +SF   S+LN+H+RIH G +PF C  C   F   S LNRH RIH G KP
Sbjct: 225 GVKPFTCTRCGKSFNCSSSLNLHMRIHTGEKPFTCTRCGKSFNCSSSLNRHMRIHTGEKP 284

Query: 235 FLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNHDGLKPFHCS 294
           F C+ C K FS+   LN HM IH G K + CT C K F++   LN+HMR H G KPF C+
Sbjct: 285 FTCTQCEKSFSQSSHLNEHMMIHTGRKPFTCTQCGKSFSQSSYLNQHMRIHTGEKPFICT 344

Query: 295 VCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIHLKLQHGVNPFKCDVCPN 354
            C +SF+  + LN H+RIHT  KP  C+ C +SFSQ S+L +H+++  G  PFKC +C  
Sbjct: 345 HCGKSFSHSSSLNQHMRIHTGEKPFTCTQCGKSFSQSSSLNLHMRIHTGKKPFKCTLC-G 403

Query: 355 ETFEKETQLSLHMRTVHGVKPFKCSMCDEGFPKKSVLKEHLRVSHNVNPFKCDICFKLFT 414
           ++F + + L+ HM    G KPF C+ C + F + S L  H+R+     PF C  C K F+
Sbjct: 404 KSFSQSSSLNQHMMIHTGEKPFTCTQCGKSFSQSSSLNLHMRIHTGDKPFTCTQCRKSFS 463

Query: 415 KKSNLRTHIKTH---EPIPCDKCPEIFEKKTDLQEHVDKCHNLHEEDEEEGLDEFDAPK- 470
             S+L  H++ H   +P  C +C + F + +    H+     +H      G   F  PK 
Sbjct: 464 NSSSLYRHMRIHTGEKPFTCTQCGKSFIQSSSFNVHM----RIH-----TGEKPFTCPKC 514

Query: 471 EKSFNCSKCLN 481
            KSF  S  LN
Sbjct: 515 GKSFRKSSSLN 525




Source: Danio rerio

Species: Danio rerio

Genus: Danio

Family: Cyprinidae

Order: Cypriniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|326667171|ref|XP_003198510.1| PREDICTED: zinc finger protein 850-like [Danio rerio] Back     alignment and taxonomy information
>gi|326667187|ref|XP_001920997.3| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
>gi|326680879|ref|XP_003201653.1| PREDICTED: zinc finger protein 721-like, partial [Danio rerio] Back     alignment and taxonomy information
>gi|326667106|ref|XP_003198487.1| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
>gi|326680667|ref|XP_003201586.1| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
>gi|390345459|ref|XP_003726339.1| PREDICTED: zinc finger protein 84-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|326670221|ref|XP_003199165.1| PREDICTED: zinc finger protein 91-like [Danio rerio] Back     alignment and taxonomy information
>gi|443728181|gb|ELU14642.1| hypothetical protein CAPTEDRAFT_135345 [Capitella teleta] Back     alignment and taxonomy information
>gi|326666983|ref|XP_003198441.1| PREDICTED: zinc finger protein 91-like [Danio rerio] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query617
ZFIN|ZDB-GENE-110913-38987 si:ch211-208f21.5 "si:ch211-20 0.670 0.419 0.387 3.6e-89
ZFIN|ZDB-GENE-110913-121 898 si:ch211-162i8.3 "si:ch211-162 0.620 0.426 0.408 5.3e-88
ZFIN|ZDB-GENE-120703-37911 si:dkey-78o7.1 "si:dkey-78o7.1 0.617 0.418 0.425 8.6e-88
ZFIN|ZDB-GENE-110913-145656 si:ch211-209n20.58 "si:ch211-2 0.620 0.583 0.405 2.3e-87
ZFIN|ZDB-GENE-110913-163485 si:ch211-209p16.2 "si:ch211-20 0.622 0.791 0.413 3.7e-87
ZFIN|ZDB-GENE-110913-140485 si:dkey-54i3.4 "si:dkey-54i3.4 0.622 0.791 0.408 7.7e-87
ZFIN|ZDB-GENE-110913-133485 si:dkey-222o15.5 "si:dkey-222o 0.622 0.791 0.403 9.9e-87
ZFIN|ZDB-GENE-110913-176797 si:dkey-238o14.5 "si:dkey-238o 0.531 0.411 0.397 1.8e-74
ZFIN|ZDB-GENE-110913-92548 si:ch211-271g18.3 "si:ch211-27 0.623 0.702 0.4 1.6e-86
ZFIN|ZDB-GENE-110913-160846 si:dkey-29p23.3 "si:dkey-29p23 0.620 0.452 0.387 1.8e-85
ZFIN|ZDB-GENE-110913-38 si:ch211-208f21.5 "si:ch211-208f21.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 890 (318.4 bits), Expect = 3.6e-89, P = 3.6e-89
 Identities = 170/439 (38%), Positives = 237/439 (53%)

Query:    55 KKFKCNICPKRYARKNRLTNHLRTHEAXXXXXXXXXXXXXFTCSQCPKTFVDKWHLNRHL 114
             K F C  C K + + + L  H+R H               FTC++C K+F    HL +H+
Sbjct:   539 KPFTCTKCGKSFNQSSYLNKHMRIHTGKRS----------FTCTRCGKSFTHSSHLKKHM 588

Query:   115 KSHSENKVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHE 174
             K+H+   +++C +C      K +   HM+IH+ VK+F C+ C K+F++    N+HMR H 
Sbjct:   589 KNHTAETLYQCSECGKSLANKSKLKIHMRIHNRVKLFTCTQCGKSFSNSANLNQHMRIHT 648

Query:   175 GIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKP 234
             G KPF C+ C +SF+Q SNLN+H+RIH G +PF C+ C   F+  S LN H RIH G KP
Sbjct:   649 GEKPFTCTQCGKSFSQSSNLNLHMRIHTGEKPFTCSQCGKSFSQSSSLNLHMRIHTGEKP 708

Query:   235 FLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNHDGLKPFHCS 294
             F C+ C K FS+   LN HM+ H G K + C  C K F++   LN+HMR H G   F C+
Sbjct:   709 FTCTQCGKSFSQSSILNIHMRNHTGEKPFTCLQCGKSFSQSTYLNQHMRIHTGENLFTCT 768

Query:   295 VCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIHLKLQHGVNPFKCDVCPN 354
              C +SF+  A LN+H+RIHT  KP  C+ C +SFSQ SNL IH+++  G  PF C  C  
Sbjct:   769 QCGKSFSNSANLNLHMRIHTGEKPFTCTQCGKSFSQSSNLNIHMRIHTGEKPFTCSQC-G 827

Query:   355 ETFEKETQLSLHMRTVHGVKPFKCSMCDEGFPKKSVLKEHLRVSHNVNPFKCDICFKLFT 414
             ++F +   L+ HMR   G KPF CS C + F K S L  H+R+     PF C  C   F+
Sbjct:   828 KSFSQSPYLNHHMRIHTGEKPFTCSQCGKSFSKSSNLNIHMRIHTGEKPFTCTQCGTSFS 887

Query:   415 KKSNLRTHIKTH---EPIPCDKCPEIFEKKTDLQEHVD-----------KCHNLHXXXXX 460
             + SNL  H++ H   +P  C +C + F + T L  H+            KC N       
Sbjct:   888 QSSNLNIHMRNHTGEKPFTCLQCGKSFSRSTSLNRHMMIHTGEKEFMCLKCENTFITAAE 947

Query:   461 XXXXXXXAPKEKSFNCSKC 479
                       EK + CS+C
Sbjct:   948 LKRHQRVHTGEKPYKCSQC 966


GO:0008270 "zinc ion binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
ZFIN|ZDB-GENE-110913-121 si:ch211-162i8.3 "si:ch211-162i8.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-120703-37 si:dkey-78o7.1 "si:dkey-78o7.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-145 si:ch211-209n20.58 "si:ch211-209n20.58" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-163 si:ch211-209p16.2 "si:ch211-209p16.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-140 si:dkey-54i3.4 "si:dkey-54i3.4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-133 si:dkey-222o15.5 "si:dkey-222o15.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-176 si:dkey-238o14.5 "si:dkey-238o14.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-92 si:ch211-271g18.3 "si:ch211-271g18.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-160 si:dkey-29p23.3 "si:dkey-29p23.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.3.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query617
COG2423330 COG2423, COG2423, Predicted ornithine cyclodeamina 4e-16
pfam02423313 pfam02423, OCD_Mu_crystall, Ornithine cyclodeamina 6e-16
PRK08618325 PRK08618, PRK08618, ornithine cyclodeaminase; Vali 4e-12
TIGR02371325 TIGR02371, ala_DH_arch, alanine dehydrogenase, Arc 8e-11
PRK06046326 PRK06046, PRK06046, alanine dehydrogenase; Validat 1e-10
PRK08291330 PRK08291, PRK08291, ectoine utilization protein Eu 8e-10
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 3e-09
PRK06141314 PRK06141, PRK06141, ornithine cyclodeaminase; Vali 6e-08
TIGR02992326 TIGR02992, ectoine_eutC, ectoine utilization prote 7e-07
PRK07340304 PRK07340, PRK07340, ornithine cyclodeaminase; Vali 4e-06
PRK06823315 PRK06823, PRK06823, ornithine cyclodeaminase; Vali 5e-06
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 9e-06
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 3e-05
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 5e-05
PRK06407301 PRK06407, PRK06407, ornithine cyclodeaminase; Prov 7e-05
PRK07589346 PRK07589, PRK07589, ornithine cyclodeaminase; Vali 2e-04
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.002
>gnl|CDD|225280 COG2423, COG2423, Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
 Score = 79.7 bits (197), Expect = 4e-16
 Identities = 46/136 (33%), Positives = 66/136 (48%), Gaps = 11/136 (8%)

Query: 490 KSLVEKLTSEGVPAVQAYEHGEDAARDADILVTATYSSVPVLKYEWLKKKDAHINAVGAG 549
           ++   +L   G  AV A +  E+A   ADI+VTAT S+ PVLK EWL K   HINA+GA 
Sbjct: 169 EAFAARLRKRGGEAVGAADSAEEAVEGADIVVTATPSTEPVLKAEWL-KPGTHINAIGAD 227

Query: 550 LNHHSELDAAIYSHS-SIFFDSEAAAR---GELKGLYEQ---VPANMVGEVGGLIAANL- 601
                ELD  + + +  +  DS    R   GE+          P  +V E+G ++A  + 
Sbjct: 228 APGKRELDPEVLARADRVVVDSLEQTRKESGEISQAVAAGVLSPDAIVAELGDVVAGKIP 287

Query: 602 -TRDARYPLTVFHSMG 616
                    T+F S+G
Sbjct: 288 GRESDDEI-TLFDSVG 302


Length = 330

>gnl|CDD|217026 pfam02423, OCD_Mu_crystall, Ornithine cyclodeaminase/mu-crystallin family Back     alignment and domain information
>gnl|CDD|236313 PRK08618, PRK08618, ornithine cyclodeaminase; Validated Back     alignment and domain information
>gnl|CDD|131424 TIGR02371, ala_DH_arch, alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>gnl|CDD|180367 PRK06046, PRK06046, alanine dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236221 PRK08291, PRK08291, ectoine utilization protein EutC; Validated Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|180421 PRK06141, PRK06141, ornithine cyclodeaminase; Validated Back     alignment and domain information
>gnl|CDD|132037 TIGR02992, ectoine_eutC, ectoine utilization protein EutC Back     alignment and domain information
>gnl|CDD|235996 PRK07340, PRK07340, ornithine cyclodeaminase; Validated Back     alignment and domain information
>gnl|CDD|136070 PRK06823, PRK06823, ornithine cyclodeaminase; Validated Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|180556 PRK06407, PRK06407, ornithine cyclodeaminase; Provisional Back     alignment and domain information
>gnl|CDD|236064 PRK07589, PRK07589, ornithine cyclodeaminase; Validated Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 617
KOG1074|consensus958 99.95
KOG1074|consensus958 99.95
KOG3608|consensus467 99.95
KOG3608|consensus467 99.95
KOG2462|consensus279 99.93
KOG2462|consensus279 99.93
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 99.93
PRK06407301 ornithine cyclodeaminase; Provisional 99.89
PRK06823315 ornithine cyclodeaminase; Validated 99.89
KOG3623|consensus 1007 99.88
KOG3623|consensus1007 99.88
PRK07589346 ornithine cyclodeaminase; Validated 99.88
KOG3007|consensus333 99.87
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 99.86
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 99.86
PRK07340304 ornithine cyclodeaminase; Validated 99.85
PRK06046326 alanine dehydrogenase; Validated 99.84
PRK08618325 ornithine cyclodeaminase; Validated 99.83
PRK06141314 ornithine cyclodeaminase; Validated 99.79
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 99.79
PRK08291330 ectoine utilization protein EutC; Validated 99.78
PRK06199379 ornithine cyclodeaminase; Validated 99.71
KOG3576|consensus267 99.67
KOG3576|consensus267 99.66
PLN03086567 PRLI-interacting factor K; Provisional 99.26
PLN03086567 PRLI-interacting factor K; Provisional 99.23
PHA00733128 hypothetical protein 99.09
PHA00733128 hypothetical protein 99.04
KOG3993|consensus500 98.83
PHA0276855 hypothetical protein; Provisional 98.82
KOG3993|consensus500 98.81
PHA0276855 hypothetical protein; Provisional 98.75
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.44
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.38
KOG1146|consensus1406 98.37
PHA0073279 hypothetical protein 98.3
PHA0061644 hypothetical protein 98.24
PHA0061644 hypothetical protein 98.18
PHA0073279 hypothetical protein 98.17
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 98.05
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.81
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.8
KOG1146|consensus 1406 97.7
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.57
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.41
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.37
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.36
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.23
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.21
COG5189423 SFP1 Putative transcriptional repressor regulating 97.13
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.08
COG5189423 SFP1 Putative transcriptional repressor regulating 97.02
KOG2231|consensus 669 97.01
KOG2231|consensus669 97.01
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.0
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.55
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.24
smart0035526 ZnF_C2H2 zinc finger. 96.14
COG5236493 Uncharacterized conserved protein, contains RING Z 96.1
COG5236493 Uncharacterized conserved protein, contains RING Z 95.85
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.84
smart0035526 ZnF_C2H2 zinc finger. 95.84
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.79
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 95.64
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.64
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 95.62
KOG2785|consensus390 95.4
KOG2482|consensus423 95.4
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.32
PRK04860160 hypothetical protein; Provisional 95.11
PRK04860160 hypothetical protein; Provisional 94.89
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 94.85
COG5048467 FOG: Zn-finger [General function prediction only] 94.74
COG5048467 FOG: Zn-finger [General function prediction only] 94.72
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.67
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.28
KOG2482|consensus423 93.5
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 92.35
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 91.93
KOG4173|consensus253 91.83
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 91.71
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 91.2
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 91.05
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 90.22
KOG2785|consensus390 89.71
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 89.56
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 89.47
KOG4173|consensus253 89.39
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.07
KOG2893|consensus341 88.95
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.94
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 88.92
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.66
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.73
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.56
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.35
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.61
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.24
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.93
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.73
PLN00203519 glutamyl-tRNA reductase 85.72
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.69
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 85.37
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.26
KOG4230|consensus 935 85.18
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.99
KOG2893|consensus341 84.99
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.9
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 84.88
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.69
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 84.15
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 84.15
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 84.07
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 83.86
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 83.45
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 82.97
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 82.88
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.85
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.67
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.67
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.58
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.57
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.38
COG404965 Uncharacterized protein containing archaeal-type C 81.57
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 81.54
PRK13940414 glutamyl-tRNA reductase; Provisional 81.44
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 80.69
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 80.07
>KOG1074|consensus Back     alignment and domain information
Probab=99.95  E-value=5.3e-30  Score=262.88  Aligned_cols=193  Identities=24%  Similarity=0.550  Sum_probs=147.6

Q ss_pred             ceecCCCCCcCCCHHHHHHHHHhcCCCCCcccCccccccCCHHHHHHHHHHhCCCC----CccCC---ccccccCChhhH
Q psy13389        262 RYLCTMCPKCFTRKDDLNRHMRNHDGLKPFHCSVCFESFTQKALLNIHLRIHTNSK----PHACS---ICTESFSQKSNL  334 (617)
Q Consensus       262 ~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~----~~~C~---~C~~~f~~~~~l  334 (617)
                      +-.|-+|.++..-++.|+.|+++|+|++||+|.+||+.|.++.+|+.|+-+|...-    ++.|+   +|.+.|.+.-.|
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~l  684 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTL  684 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccccccc
Confidence            46799999999999999999999999999999999999999999999998886543    47799   899999999999


Q ss_pred             HHHHhhhcCCC-------------CccCCCCCCCccCChhHHHHHhhhc----------------cCCC----CcccCcc
Q psy13389        335 YIHLKLQHGVN-------------PFKCDVCPNETFEKETQLSLHMRTV----------------HGVK----PFKCSMC  381 (617)
Q Consensus       335 ~~H~~~h~~~~-------------~~~C~~C~~~~f~~~~~l~~H~~~h----------------~~~~----~~~C~~C  381 (617)
                      ..|+++|.+..             .-+|..|.+ .|.....+..++..|                ..+.    +..+..|
T Consensus       685 pQhIriH~~~~~s~g~~a~e~~~~adq~~~~qk-~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~  763 (958)
T KOG1074|consen  685 PQHIRIHLGGQISNGGTAAEGILAADQCSSCQK-TFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPENSC  763 (958)
T ss_pred             cceEEeecCCCCCCCcccccccchhcccchhhh-cccccccchhhhhccCCcccCCcccccccccccccccCCCcccccc
Confidence            99999887421             135777776 565555555554443                2222    4667777


Q ss_pred             CCcCCCchhHHHHhhhh-----------------------cCCC------------------------------------
Q psy13389        382 DEGFPKKSVLKEHLRVS-----------------------HNVN------------------------------------  402 (617)
Q Consensus       382 ~~~f~~~~~l~~H~~~h-----------------------~~~~------------------------------------  402 (617)
                      +..+.....+..+-..+                       ++++                                    
T Consensus       764 ~~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t  843 (958)
T KOG1074|consen  764 GRELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLAT  843 (958)
T ss_pred             ccccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhccccccccccccc
Confidence            77777665554442211                       0000                                    


Q ss_pred             -----------------------------------ccccccccccccChHhHHHHHHcCC---CCCCccccccccCchhH
Q psy13389        403 -----------------------------------PFKCDICFKLFTKKSNLRTHIKTHE---PIPCDKCPEIFEKKTDL  444 (617)
Q Consensus       403 -----------------------------------~~~C~~C~~~f~~~~~l~~H~~~h~---~~~C~~C~~~f~~~~~l  444 (617)
                                                         ...|.+||+.|.+.++|..|+++|.   ||.|.+|++.|..+.+|
T Consensus       844 ~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnL  923 (958)
T KOG1074|consen  844 KTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNL  923 (958)
T ss_pred             ccccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhh
Confidence                                               1569999999999999999999996   89999999999999999


Q ss_pred             HHHHhhhCCCCc
Q psy13389        445 QEHVDKCHNLHE  456 (617)
Q Consensus       445 ~~H~~~~H~~~~  456 (617)
                      +.||.+ |.+.+
T Consensus       924 KvHMgt-H~w~q  934 (958)
T KOG1074|consen  924 KVHMGT-HMWVQ  934 (958)
T ss_pred             hhhhcc-ccccC
Confidence            999997 65543



>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>KOG3007|consensus Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG4230|consensus Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query617
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 3e-37
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 3e-35
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 5e-31
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 1e-13
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 9e-19
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 6e-15
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 4e-12
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 5e-10
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 1e-15
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 9e-13
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 3e-08
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-15
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 5e-12
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-07
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-15
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-10
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-07
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 3e-15
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 5e-11
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 4e-09
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 2e-07
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 6e-15
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-11
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 7e-10
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-07
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-14
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-12
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 9e-10
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 9e-08
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 2e-14
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 8e-12
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 8e-10
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 6e-08
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 3e-14
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 2e-13
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 3e-11
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 3e-14
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 1e-12
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 4e-09
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 8e-08
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 3e-14
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 2e-12
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 5e-09
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 9e-08
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 3e-14
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 3e-12
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 5e-09
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 9e-08
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 5e-13
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 1e-10
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 7e-08
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 6e-13
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 6e-11
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 3e-07
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 2e-05
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 2e-12
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 1e-11
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 3e-11
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 7e-11
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 9e-08
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 6e-12
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 2e-11
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 1e-07
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-11
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 3e-08
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-05
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-11
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 3e-08
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-05
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 1e-10
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 5e-09
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 2e-04
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 4e-10
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 7e-06
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 2e-09
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 4e-08
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 4e-06
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 3e-04
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 3e-09
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 2e-07
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 7e-09
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 4e-06
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 4e-05
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 1e-08
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 3e-04
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 2e-08
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 5e-06
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 5e-04
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 5e-04
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 3e-08
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 8e-04
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 4e-07
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 9e-07
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 2e-05
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 8e-07
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 2e-06
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 2e-05
2i99_A312 Crystal Structure Of Human Mu_crystallin At 2.6 Ang 3e-06
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 4e-06
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 4e-05
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 5e-06
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 8e-06
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 3e-04
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 2e-05
1vll_A334 Crystal Structure Of Alanine Dehydrogenase (Af1665) 3e-05
1omo_A322 Alanine Dehydrogenase Dimer WBOUND NAD (ARCHAEAL) L 3e-05
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 4e-05
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 9e-05
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 2e-04
2ct1_A77 Solution Structure Of The Zinc Finger Domain Of Tra 2e-04
2ep2_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-04
2ep2_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-04
2eml_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 153 bits (386), Expect = 3e-37, Method: Compositional matrix adjust. Identities = 70/169 (41%), Positives = 92/169 (54%) Query: 121 KVFRCEQCRFDFYVKREYNRHMKIHDGVKVFLCSVCSKTFTDKVKFNRHMRAHEGIKPFQ 180 K + C +C F H + H G K + C C K+F+DK RH R H G KP++ Sbjct: 20 KPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYK 79 Query: 181 CSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTNKSDLNRHSRIHNGIKPFLCSMC 240 C C +SF+QR+NL H R H G +P+ C C F+ + L H R H G KP+ C C Sbjct: 80 CPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPEC 139 Query: 241 AKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNHDGLK 289 K FSR+D+L+ H + H G K Y C C K F+R+D LN H R H G K Sbjct: 140 GKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKK 188
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2I99|A Chain A, Crystal Structure Of Human Mu_crystallin At 2.6 Angstrom Length = 312 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|1VLL|A Chain A, Crystal Structure Of Alanine Dehydrogenase (Af1665) From Archaeoglobus Fulgidus At 2.80 A Resolution Length = 334 Back     alignment and structure
>pdb|1OMO|A Chain A, Alanine Dehydrogenase Dimer WBOUND NAD (ARCHAEAL) Length = 322 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure
>pdb|2CT1|A Chain A, Solution Structure Of The Zinc Finger Domain Of Transcriptional Repressor Ctcf Protein Length = 77 Back     alignment and structure
>pdb|2EP2|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 603- 635) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EP2|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 603- 635) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EML|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 752- 784) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query617
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-57
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-56
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-53
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-46
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-40
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-40
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-20
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-44
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-36
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-30
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-30
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-37
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-35
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-28
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-19
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 8e-17
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-36
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-34
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-31
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-29
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-09
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 8e-35
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-34
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-29
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-31
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-30
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-30
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 7e-25
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 9e-21
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 9e-20
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-31
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-30
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-27
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 9e-26
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-23
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-12
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-30
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-30
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 9e-29
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-27
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-23
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-21
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-18
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-13
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-06
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-30
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-30
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-29
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 8e-27
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-25
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-22
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-19
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-15
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-28
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-27
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-27
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-26
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 7e-25
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-21
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-21
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-15
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-12
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-11
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-27
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-24
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-24
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-23
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 8e-21
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-19
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-16
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-14
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-13
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-12
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-27
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-24
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-22
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-16
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-13
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-12
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-09
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 8e-26
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-25
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 9e-24
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-20
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-15
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-13
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-09
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-09
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-25
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-21
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-20
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-19
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-15
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 9e-14
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 6e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-25
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-23
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 9e-21
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-17
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-16
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-15
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-13
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-13
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 3e-24
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-23
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-21
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 8e-21
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-20
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-19
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-16
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-10
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-09
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-09
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 7e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-23
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 5e-23
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 8e-23
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-20
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-19
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 5e-18
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 8e-13
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 9e-12
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-10
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 3e-22
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 8e-22
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-21
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-20
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-18
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-16
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-14
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-10
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-08
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 1e-21
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 3e-20
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-20
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-18
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-17
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 7e-16
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-15
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-12
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-11
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-09
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-09
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-20
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-20
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-19
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 8e-18
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-16
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-15
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 8e-12
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-11
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-07
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 7e-20
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-19
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-18
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-17
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-15
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-15
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 9e-12
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-08
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 9e-05
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-19
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-18
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-18
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-18
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-16
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 6e-15
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-10
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-06
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-19
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 9e-18
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-17
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-16
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-16
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-15
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-11
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-10
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-10
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-09
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-09
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-18
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-18
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 8e-18
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-17
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-15
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 7e-14
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-12
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-08
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 7e-08
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-18
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-16
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 7e-15
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-12
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-12
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 6e-10
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-09
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-07
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 9e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 6e-18
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-14
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-13
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-12
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-08
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 6e-08
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 6e-08
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 7e-08
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-18
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-17
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-16
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-14
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-13
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-13
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-12
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-11
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-09
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-16
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-15
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-15
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-14
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 5e-11
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 4e-10
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 8e-09
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 7e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-15
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-15
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-14
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-13
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-13
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-12
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 7e-08
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 7e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 7e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-04
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-13
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-13
2epa_A72 Krueppel-like factor 10; transforming growth facto 7e-13
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-09
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-09
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-08
2epa_A72 Krueppel-like factor 10; transforming growth facto 6e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-12
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-11
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-10
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-10
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-12
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-08
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-08
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 6e-12
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-10
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 9e-10
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-09
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-08
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 5e-08
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 6e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-11
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-08
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-08
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-10
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-10
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-10
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-10
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-07
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-10
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-07
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-11
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-10
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 7e-09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-08
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 5e-08
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-11
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-11
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 8e-10
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 7e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 7e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 9e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-11
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-10
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-11
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-10
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-11
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-10
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-10
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-11
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-09
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-09
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-09
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 4e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 5e-07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 4e-11
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-10
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 4e-10
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-10
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 4e-07
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-06
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-10
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-11
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-08
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-11
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-09
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-11
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-11
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-11
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-10
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-09
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-11
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-11
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-11
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-11
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-11
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-07
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-11
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-11
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-08
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-11
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-10
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-10
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-11
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-11
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 8e-11
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 5e-10
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 6e-10
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 4e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 6e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-11
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 9e-11
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 9e-10
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-08
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-08
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 4e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 4e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 4e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-11
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-10
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-10
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-09
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-10
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-09
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-09
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-09
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-10
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-10
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-10
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-10
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-10
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 5e-10
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 7e-09
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 4e-08
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 5e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 7e-06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-10
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-10
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-09
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-10
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-09
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-09
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-06
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-06
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-10
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-07
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-07
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-09
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-09
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-09
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-08
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-08
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-10
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-10
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-09
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-10
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-10
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 8e-09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-10
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-08
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-08
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-06
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-10
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 6e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 6e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 7e-08
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 7e-06
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-08
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-10
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-09
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 4e-08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 7e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-10
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-10
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-09
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-10
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-10
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-10
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-10
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-09
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-10
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-06
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-05
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-10
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-09
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-10
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-10
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-09
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-09
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-08
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-10
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-09
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-08
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-08
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-10
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-08
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-10
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-09
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-09
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-10
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-09
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-09
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 7e-10
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 6e-07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 3e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 9e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 7e-10
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 7e-09
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 7e-10
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-08
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-08
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-06
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-06
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 7e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-10
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-08
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 9e-10
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 6e-08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 6e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 4e-05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-10
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-10
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-09
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-09
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 7e-09
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-07
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 5e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 5e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 7e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 6e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 8e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 5e-05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 9e-09
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-08
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-08
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 4e-06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 9e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 9e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 7e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 9e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-05
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-07
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-07
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-06
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 6e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 5e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-07
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 3e-07
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 3e-07
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 8e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 7e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 7e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 3e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 7e-06
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 6e-05
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 8e-06
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 9e-05
1paa_A30 Yeast transcription factor ADR1; transcription reg 4e-05
1ard_A29 Yeast transcription factor ADR1; transcription reg 2e-04
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 7e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  191 bits (488), Expect = 1e-57
 Identities = 66/179 (36%), Positives = 95/179 (53%)

Query: 159 TFTDKVKFNRHMRAHEGIKPFQCSVCSESFTQRSNLNIHLRIHDGIRPFQCNVCYICFTN 218
           +               G KP+ C  C +SF++  +L  H R H G +P++C  C   F++
Sbjct: 2   SEFGSSSSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSD 61

Query: 219 KSDLNRHSRIHNGIKPFLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDL 278
           K DL RH R H G KP+ C  C K FS++ +L  H + H G K Y C  C K F++   L
Sbjct: 62  KKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHL 121

Query: 279 NRHMRNHDGLKPFHCSVCFESFTQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIH 337
             H R H G KP+ C  C +SF+++  L+ H R HT  KP+ C  C +SFS++  L +H
Sbjct: 122 RAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVH 180


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Length = 312 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Length = 322 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Length = 350 Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Length = 313 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 30 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 45 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query617
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.97
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.97
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.94
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.94
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.89
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.88
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.88
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.87
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.87
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.87
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.87
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.87
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.87
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.87
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 99.83
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 99.76
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.75
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.74
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.74
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 99.73
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.73
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.73
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.73
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.72
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.72
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.72
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.72
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.71
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.7
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.69
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.68
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.67
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.66
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.64
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.63
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.63
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.62
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.6
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.6
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.6
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.6
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.57
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.56
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.55
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.53
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.53
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.5
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.48
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.48
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.47
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.46
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.46
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.45
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.45
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.44
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.44
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.42
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.42
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.41
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.4
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.39
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.38
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 99.37
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.37
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.36
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.36
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.36
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.36
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.35
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.34
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.33
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.31
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.3
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.29
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.29
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.27
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.25
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.24
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.23
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.23
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.23
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.18
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.17
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.16
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.1
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.1
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.05
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.03
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.03
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.03
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.03
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.03
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.02
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.02
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.02
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.02
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.02
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.01
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.01
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.01
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.0
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.99
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.99
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.98
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.96
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.95
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.94
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.94
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.92
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.92
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.92
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.91
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.91
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.91
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.9
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.89
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.89
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.88
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.88
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.88
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.88
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.88
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.88
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.87
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.87
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.87
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.87
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.87
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.87
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.87
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.87
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.86
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.86
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.86
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.86
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.86
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.86
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.85
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.85
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.85
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.85
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.85
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.85
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.85
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.85
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.85
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.85
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.84
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.84
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.84
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.84
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.83
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.83
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.83
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.82
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.82
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.81
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.81
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.81
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.81
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.8
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.8
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.8
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.8
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.79
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.79
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.79
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.79
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.78
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.77
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.76
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.74
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.74
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.74
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.73
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.72
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.72
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.7
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.68
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.65
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.63
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.51
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.48
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.47
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.45
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.45
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.39
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.39
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.36
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.35
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.33
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.33
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.32
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.32
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.29
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.21
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.2
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.18
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.17
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.16
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.16
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.15
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.15
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.14
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.14
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.13
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.13
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.12
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.12
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.11
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.11
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.1
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.09
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.04
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.04
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.99
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.98
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.95
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.94
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.91
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.91
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.89
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.87
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.87
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.87
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.86
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.86
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.85
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.84
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.83
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.82
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.81
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.8
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.8
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.8
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.78
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.77
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.77
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.76
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.76
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.76
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.75
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.74
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.74
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.73
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.9
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.9
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.71
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.7
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.87
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.69
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.68
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.85
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.64
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.8
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.75
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.56
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.26
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.25
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.13
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 96.89
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.7
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.05
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.97
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.91
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.67
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 95.35
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.08
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 94.72
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.45
2e72_A49 POGO transposable element with ZNF domain; zinc fi 93.93
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 92.79
3p2o_A285 Bifunctional protein fold; structural genomics, ce 92.58
3l07_A285 Bifunctional protein fold; structural genomics, ID 92.49
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 92.1
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 91.38
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 90.8
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 90.67
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 90.28
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 89.85
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 89.44
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 88.45
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.75
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=1.8e-37  Score=288.52  Aligned_cols=183  Identities=40%  Similarity=0.775  Sum_probs=89.2

Q ss_pred             hhhhhhhhhcCCCcccCCCCccccCChhHHHHHHhhccCCCceecCCCCCcCCCHHHHHHHHHhcCCCCCcccCcccccc
Q psy13389        221 DLNRHSRIHNGIKPFLCSMCAKCFSRKDDLNRHMKIHEGSKRYLCTMCPKCFTRKDDLNRHMRNHDGLKPFHCSVCFESF  300 (617)
Q Consensus       221 ~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f  300 (617)
                      .|..|+..|.++++|.|+.|++.|.+...|..|++.|.++++|.|++|++.|.+...|..|++.|.++++|.|+.|++.|
T Consensus         8 ~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f   87 (190)
T 2i13_A            8 SSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSF   87 (190)
T ss_dssp             -----------------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEE
T ss_pred             cchhhhhhcCCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCcc
Confidence            44455555555555555555555555555555555555555555555555555555555555555555555555555555


Q ss_pred             CCHHHHHHHHHHhCCCCCccCCccccccCChhhHHHHHhhhcCCCCccCCCCCCCccCChhHHHHHhhhccCCCCcccCc
Q psy13389        301 TQKALLNIHLRIHTNSKPHACSICTESFSQKSNLYIHLKLQHGVNPFKCDVCPNETFEKETQLSLHMRTVHGVKPFKCSM  380 (617)
Q Consensus       301 ~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~f~~~~~l~~H~~~h~~~~~~~C~~  380 (617)
                      .+...|..|+++|+++++|.|+.|++.|.+...|..|++.|+++++|.|++|++ .|.....|..|+++|+++++|.|++
T Consensus        88 ~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~-~f~~~~~L~~H~~~H~~~~~~~C~~  166 (190)
T 2i13_A           88 SQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGK-SFSREDNLHTHQRTHTGEKPYKCPE  166 (190)
T ss_dssp             SCHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCC-EESCHHHHHHHHHHHHCCCCEECTT
T ss_pred             CCHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCc-ccCCHHHHHHHHHhcCCCCCeECCC
Confidence            555555555555555555555555555555555555555555555555555555 5555555555555555556666666


Q ss_pred             cCCcCCCchhHHHHhhhhcCCCcc
Q psy13389        381 CDEGFPKKSVLKEHLRVSHNVNPF  404 (617)
Q Consensus       381 C~~~f~~~~~l~~H~~~h~~~~~~  404 (617)
                      |++.|.+...|..|+++|++++||
T Consensus       167 C~~~f~~~~~L~~H~~~H~~~k~~  190 (190)
T 2i13_A          167 CGKSFSRRDALNVHQRTHTGKKTS  190 (190)
T ss_dssp             TCCEESSHHHHHHHHTTC------
T ss_pred             CCCccCCHHHHHHHHHhcCCCCCC
Confidence            666666666666666666655554



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 617
d1x7da_340 c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomona 4e-10
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 9e-10
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-09
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 4e-09
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 8e-09
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-08
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 5e-08
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 7e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.001
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-09
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 9e-08
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 8e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-06
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.001
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-08
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-08
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 5e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 8e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.001
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-08
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 7e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 9e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 6e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 8e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.002
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.002
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 5e-08
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 4e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 7e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 6e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 6e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.003
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-08
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 7e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.003
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.004
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.002
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.002
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.004
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-06
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 6e-06
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 9e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 1e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 3e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 5e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.003
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 3e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 3e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 9e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 4e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 9e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 4e-06
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 6e-06
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 3e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 6e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.001
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.002
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 7e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 7e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 6e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 9e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 8e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.001
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 1e-05
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 2e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 4e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 8e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-05
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 6e-05
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 7e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 7e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.001
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.002
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.002
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 7e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 9e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.001
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.003
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 7e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 3e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 0.003
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 0.004
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 8e-05
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 5e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.001
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 1e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 3e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 0.003
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 3e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.003
d2adra231 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Sac 5e-04
d1a1ia328 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) 7e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 9e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.001
d2epqa132 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [ 0.001
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.003
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.003
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Length = 340 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Ornithine cyclodeaminase-like
domain: Ornithine cyclodeaminase
species: Pseudomonas putida [TaxId: 303]
 Score = 59.7 bits (144), Expect = 4e-10
 Identities = 32/148 (21%), Positives = 63/148 (42%), Gaps = 7/148 (4%)

Query: 474 FNCSKCLNIVRIPVEIKSLVEKLTSEGVPAVQAYEHGEDAARDADILVTATY--SSVPVL 531
               + +     P+    L+  L       ++      +A +  DI+ T T   +   ++
Sbjct: 151 LGIEEIVAYDTDPLATAKLIANLKEYSGLTIRRASSVAEAVKGVDIITTVTADKAYATII 210

Query: 532 KYEWLKKKDAHINAVGAGLNHHSELDAAIYSHSSIFFDSEAAARGELKGLYEQVPANM-V 590
             + L+    H+NAVG      +EL A +  ++ +F + E   R E  G  +Q+PA+  V
Sbjct: 211 TPDMLEP-GMHLNAVGGDCPGKTELHADVLRNARVFVEYEPQTRIE--GEIQQLPADFPV 267

Query: 591 GEVGGLIAANLT-RDARYPLTVFHSMGV 617
            ++  ++      R +   +TVF S+G 
Sbjct: 268 VDLWRVLRGETEGRQSDSQVTVFDSVGF 295


>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 31 Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query617
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 99.88
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 99.85
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.55
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.52
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.07
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.05
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.99
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.97
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.95
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.91
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.91
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.91
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.9
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.89
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.83
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.8
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.79
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.78
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.76
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.75
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.72
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.71
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.7
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.68
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.67
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.67
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.64
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.52
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.52
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.47
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.44
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.41
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.38
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.37
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.35
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.34
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.14
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.13
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.11
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.08
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.04
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.03
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.01
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.97
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.92
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.86
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.8
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.67
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.66
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.64
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.47
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.43
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.42
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.4
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.4
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.39
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.35
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.32
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.26
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.23
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.17
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.15
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.09
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.09
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.06
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.02
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.0
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.99
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.96
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.92
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.9
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.86
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.85
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.84
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.68
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.67
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.67
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.58
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.43
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.37
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.26
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.77
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.76
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.61
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.6
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.47
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.35
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.34
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.33
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.33
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.21
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.05
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.91
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 94.91
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 94.81
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.52
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.8
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.26
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 93.25
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 93.14
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 92.44
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 92.39
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 92.05
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.97
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 89.91
d1y0jb136 U-shaped transcription factor, different fingers { 89.58
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 89.32
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 89.31
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 88.82
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 88.59
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 88.21
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 88.06
d1y0jb136 U-shaped transcription factor, different fingers { 88.0
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 87.88
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 87.7
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 86.56
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 85.55
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 85.12
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 84.2
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 84.17
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 84.07
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 84.02
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 82.82
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 82.29
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 80.89
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Ornithine cyclodeaminase-like
domain: Ornithine cyclodeaminase
species: Pseudomonas putida [TaxId: 303]
Probab=99.88  E-value=5.7e-24  Score=207.26  Aligned_cols=130  Identities=22%  Similarity=0.323  Sum_probs=113.6

Q ss_pred             chhHHHHHhhhhcCCCCCcccccccccccccccceeeeccC--CccchhhhhcccCccccccccccccccccchhhhhcC
Q psy13389        486 PVEIKSLVEKLTSEGVPAVQAYEHGEDAARDADILVTATYS--SVPVLKYEWLKKKDAHINAVGAGLNHHSELDAAIYSH  563 (617)
Q Consensus       486 ~~~l~~H~~~~~~~~~~~~~~~~~~~~~~~~adiv~~~t~s--~~p~~~~~~~~~~g~~v~~~g~~~~~~~e~~~~~~~~  563 (617)
                      +....+....+....+..+.++.++++++++||||+|+|++  ++|+|+.+|++| |+||++||++.|+|+|||++++.+
T Consensus       163 ~~~~~~~~~~l~~~~g~~v~~~~s~~eav~~ADIi~t~Tas~s~~Pv~~~~~l~p-G~hI~aiGs~~p~~~Eld~~~l~~  241 (340)
T d1x7da_         163 PLATAKLIANLKEYSGLTIRRASSVAEAVKGVDIITTVTADKAYATIITPDMLEP-GMHLNAVGGDCPGKTELHADVLRN  241 (340)
T ss_dssp             HHHHHHHHHHHTTCTTCEEEECSSHHHHHTTCSEEEECCCCSSEEEEECGGGCCT-TCEEEECSCCBTTBEEECHHHHHT
T ss_pred             hHHHHHHHHhhhhccCCCceecCCHHHHHhcCCceeeccccCCCCcccchhhcCC-CCEEeecccchhhhhccCHHHHhc
Confidence            44555555555544456678889999999999999998854  479999999999 999999999999999999999999


Q ss_pred             ceEEEecchhhhcchhhhhhccccccccccccccccccc-cCCCCceeeeccCCC
Q psy13389        564 SSIFFDSEAAARGELKGLYEQVPANMVGEVGGLIAANLT-RDARYPLTVFHSMGV  617 (617)
Q Consensus       564 ~~~~~d~~~~~~~e~~~~~~~~~~~~~~~l~~~~~~~~~-~~~~~~~~~f~~~G~  617 (617)
                      ++||||+++|++.| |++.+...+..++|||+|++|+.+ |.++++|||||||||
T Consensus       242 a~v~VD~~~q~~~~-ge~~~~~~~~~~~eLg~vl~g~~~gR~~~~~itvfksvG~  295 (340)
T d1x7da_         242 ARVFVEYEPQTRIE-GEIQQLPADFPVVDLWRVLRGETEGRQSDSQVTVFDSVGF  295 (340)
T ss_dssp             SEEEESSHHHHHHH-SGGGGSCTTCCCEEHHHHHTTSSCSCCCTTCCEEEECCCC
T ss_pred             CcEEEecHHHHHhh-CcccccccccccccHHHHhcCCCCCCCCCCCeEEEECCCh
Confidence            99999999999866 888776666778999999999987 999999999999997



>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure