Psyllid ID: psy13390


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----
MVIMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEAFIDTAKEIYEKIQEGVFDITNEANGIKIGPQHSPNNPSLPSGSSGSSSGGGVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEAFIDTAKEIYEKIQEGVFDITNEVDLVG
cEEEEEEEcccccccccccHHHHHHHHHHccccEEEccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccEEEEEEccEEEEEEEEcccccccHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHHHHHHHcccccccccccccc
cEEEEEEEccccHHHccccHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHcHHHHccccccccccccccccccccccccccccccccccccEEcEEEEEEEEEEccEEEEEEEEEEcccHHHHHHHHcccccccEEEEEEEcccHHHHHcHHHHHHHHHHHcccccEEEEEEEccccHHHccccHHHHHHHHHHHccEEEEcEccccEcHHHHHHHHHHHHHccHccccccccccccccc
MVIMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEAFIDTAKEIYEKIQEGVFditneangikigpqhspnnpslpsgssgsssgggvefgARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEAFIDTAKEIYEKIQEGVFDITNEVDLVG
mvimlignksdldarrEVKKEEgevfarehglVFMETSAKLATNVEEAFIDTAKEIYEKIQEGVFDITNEANGIKIGPQHSPNNPSLPSGSSGSSSGGGVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDARREVKKEEgevfarehglVFMETSAKLATNVEEAFIDTAKEIYEKIQegvfditnevdlvg
MVIMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEAFIDTAKEIYEKIQEGVFDITNEANGIKIGPQHspnnpslpsgssgsssgggVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEAFIDTAKEIYEKIQEGVFDITNEVDLVG
************************VFAREHGLVFMETSAKLATNVEEAFIDTAKEIYEKIQEGVFDITNEANGI*************************VEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGN***************EVFAREHGLVFMETSAKLATNVEEAFIDTAKEIYEKIQEGVFDITNEV****
MVIMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEAFIDTAKEIY***********************SPNNPSLPSGSSGSSSGGGVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEAFIDTAKEIYEKI***************
MVIMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEAFIDTAKEIYEKIQEGVFDITNEANGIKIGPQHSPN***************GVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEAFIDTAKEIYEKIQEGVFDITNEVDLVG
MVIMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEAFIDTAKEIYEKIQEGVF**************HSPNNPSLPSGSSGSSSGGGVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEAFIDTAKEIYEKIQE*************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVIMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEAFIDTAKEIYEKIQEGVFDITNEANGIKIGPQHSPNNPSLPSGSSGSSSGGGVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEAFIDTAKEIYEKIQEGVFDITNEVDLVG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query245 2.2.26 [Sep-21-2011]
P05712212 Ras-related protein Rab-2 yes N/A 0.587 0.679 0.916 2e-74
P53994212 Ras-related protein Rab-2 yes N/A 0.587 0.679 0.916 2e-74
Q5R6B6212 Ras-related protein Rab-2 yes N/A 0.587 0.679 0.916 2e-74
Q4R4X6212 Ras-related protein Rab-2 N/A N/A 0.587 0.679 0.916 2e-74
P61019212 Ras-related protein Rab-2 no N/A 0.587 0.679 0.916 2e-74
P61105212 Ras-related protein Rab-2 yes N/A 0.587 0.679 0.916 2e-74
Q01971212 Ras-related protein Rab-2 yes N/A 0.587 0.679 0.916 2e-74
Q90965212 Ras-related protein Rab-2 yes N/A 0.587 0.679 0.916 2e-74
Q05975212 Ras-related protein Rab-2 N/A N/A 0.587 0.679 0.909 5e-74
Q8WUD1216 Ras-related protein Rab-2 no N/A 0.563 0.638 0.854 5e-71
>sp|P05712|RAB2A_RAT Ras-related protein Rab-2A OS=Rattus norvegicus GN=Rab2a PE=1 SV=1 Back     alignment and function desciption
 Score =  279 bits (713), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 132/144 (91%), Positives = 140/144 (97%)

Query: 99  GVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTT 158
           GVEFGARMITIDGKQIKLQIWDTAGQE+FRSITRSYYRGAAGALLVYDITRR+TFNHLTT
Sbjct: 40  GVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTT 99

Query: 159 WLEDARQHSNSNMVIMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEA 218
           WLEDARQHSNSNMVIMLIGNKSDL++RREVKKEEGE FAREHGL+FMETSAK A+NVEEA
Sbjct: 100 WLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEA 159

Query: 219 FIDTAKEIYEKIQEGVFDITNEVD 242
           FI+TAKEIYEKIQEGVFDI NE +
Sbjct: 160 FINTAKEIYEKIQEGVFDINNEAN 183




Required for protein transport from the endoplasmic reticulum to the Golgi complex.
Rattus norvegicus (taxid: 10116)
>sp|P53994|RAB2A_MOUSE Ras-related protein Rab-2A OS=Mus musculus GN=Rab2a PE=1 SV=1 Back     alignment and function description
>sp|Q5R6B6|RAB2A_PONAB Ras-related protein Rab-2A OS=Pongo abelii GN=RAB2A PE=2 SV=1 Back     alignment and function description
>sp|Q4R4X6|RAB2A_MACFA Ras-related protein Rab-2A OS=Macaca fascicularis GN=RAB2A PE=2 SV=1 Back     alignment and function description
>sp|P61019|RAB2A_HUMAN Ras-related protein Rab-2A OS=Homo sapiens GN=RAB2A PE=1 SV=1 Back     alignment and function description
>sp|P61105|RAB2A_CANFA Ras-related protein Rab-2A OS=Canis familiaris GN=RAB2A PE=1 SV=1 Back     alignment and function description
>sp|Q01971|RAB2A_RABIT Ras-related protein Rab-2A OS=Oryctolagus cuniculus GN=RAB2A PE=2 SV=1 Back     alignment and function description
>sp|Q90965|RAB2A_CHICK Ras-related protein Rab-2A OS=Gallus gallus GN=RAB2A PE=2 SV=1 Back     alignment and function description
>sp|Q05975|RAB2_LYMST Ras-related protein Rab-2 OS=Lymnaea stagnalis GN=RAB2 PE=2 SV=1 Back     alignment and function description
>sp|Q8WUD1|RAB2B_HUMAN Ras-related protein Rab-2B OS=Homo sapiens GN=RAB2B PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query245
156555012214 PREDICTED: ras-related protein Rab-2-lik 0.587 0.672 0.944 5e-74
170057342207 conserved hypothetical protein [Culex qu 0.583 0.690 0.951 7e-74
312382073182 hypothetical protein AND_05520 [Anophele 0.583 0.785 0.951 7e-74
158294114213 AGAP005393-PA [Anopheles gambiae str. PE 0.579 0.666 0.937 9e-74
157107937213 ras-related protein Rab-2A, putative [Ae 0.579 0.666 0.937 9e-74
195331895200 GM20894 [Drosophila sechellia] gi|194124 0.563 0.69 0.951 9e-74
17137088213 Rab2, isoform A [Drosophila melanogaster 0.587 0.676 0.937 1e-73
195028532213 GH21751 [Drosophila grimshawi] gi|195383 0.575 0.661 0.937 1e-73
195120996213 GI19298 [Drosophila mojavensis] gi|19391 0.587 0.676 0.937 1e-73
125806738213 GA17076 [Drosophila pseudoobscura pseudo 0.587 0.676 0.937 1e-73
>gi|156555012|ref|XP_001603108.1| PREDICTED: ras-related protein Rab-2-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  283 bits (723), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 139/144 (96%)

Query: 99  GVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTT 158
           GVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTT
Sbjct: 40  GVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTT 99

Query: 159 WLEDARQHSNSNMVIMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEA 218
           WLEDARQHSNSNMVIMLIGNKSDLDARREVK+EEGE FAREHGLVFMETSAK A NVEEA
Sbjct: 100 WLEDARQHSNSNMVIMLIGNKSDLDARREVKREEGEAFAREHGLVFMETSAKTAANVEEA 159

Query: 219 FIDTAKEIYEKIQEGVFDITNEVD 242
           FI+TAKEIYEKIQEGVFDI NE +
Sbjct: 160 FINTAKEIYEKIQEGVFDINNEAN 183




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|170057342|ref|XP_001864442.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167876764|gb|EDS40147.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|312382073|gb|EFR27648.1| hypothetical protein AND_05520 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|158294114|ref|XP_556035.3| AGAP005393-PA [Anopheles gambiae str. PEST] gi|157015414|gb|EAL39812.3| AGAP005393-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157107937|ref|XP_001650005.1| ras-related protein Rab-2A, putative [Aedes aegypti] gi|170056253|ref|XP_001863947.1| conserved hypothetical protein [Culex quinquefasciatus] gi|108879444|gb|EAT43669.1| AAEL004902-PA [Aedes aegypti] gi|167876016|gb|EDS39399.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195331895|ref|XP_002032634.1| GM20894 [Drosophila sechellia] gi|194124604|gb|EDW46647.1| GM20894 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|17137088|ref|NP_477090.1| Rab2, isoform A [Drosophila melanogaster] gi|442622498|ref|NP_001260732.1| Rab2, isoform B [Drosophila melanogaster] gi|194758098|ref|XP_001961299.1| GF11067 [Drosophila ananassae] gi|194864038|ref|XP_001970739.1| GG23219 [Drosophila erecta] gi|195474169|ref|XP_002089364.1| GE19072 [Drosophila yakuba] gi|195580994|ref|XP_002080319.1| GD10420 [Drosophila simulans] gi|2313035|dbj|BAA21706.1| rab2 [Drosophila melanogaster] gi|21645117|gb|AAM70817.1| Rab2, isoform A [Drosophila melanogaster] gi|27820101|gb|AAO25075.1| GH01619p [Drosophila melanogaster] gi|190622597|gb|EDV38121.1| GF11067 [Drosophila ananassae] gi|190662606|gb|EDV59798.1| GG23219 [Drosophila erecta] gi|194175465|gb|EDW89076.1| GE19072 [Drosophila yakuba] gi|194192328|gb|EDX05904.1| GD10420 [Drosophila simulans] gi|220944512|gb|ACL84799.1| Rab2-PA [synthetic construct] gi|220954388|gb|ACL89737.1| Rab2-PA [synthetic construct] gi|440214116|gb|AGB93265.1| Rab2, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195028532|ref|XP_001987130.1| GH21751 [Drosophila grimshawi] gi|195383514|ref|XP_002050471.1| GJ22175 [Drosophila virilis] gi|193903130|gb|EDW01997.1| GH21751 [Drosophila grimshawi] gi|194145268|gb|EDW61664.1| GJ22175 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195120996|ref|XP_002005007.1| GI19298 [Drosophila mojavensis] gi|193910075|gb|EDW08942.1| GI19298 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|125806738|ref|XP_001360146.1| GA17076 [Drosophila pseudoobscura pseudoobscura] gi|195149123|ref|XP_002015507.1| GL11116 [Drosophila persimilis] gi|195455130|ref|XP_002074572.1| GK23088 [Drosophila willistoni] gi|54635317|gb|EAL24720.1| GA17076 [Drosophila pseudoobscura pseudoobscura] gi|194109354|gb|EDW31397.1| GL11116 [Drosophila persimilis] gi|194170657|gb|EDW85558.1| GK23088 [Drosophila willistoni] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query245
FB|FBgn0014009213 Rab2 "Rab2" [Drosophila melano 0.583 0.671 0.937 1.2e-67
UNIPROTKB|F1N8Z3197 RAB2A "Ras-related protein Rab 0.583 0.725 0.916 6.5e-67
UNIPROTKB|Q90965212 RAB2A "Ras-related protein Rab 0.583 0.674 0.916 6.5e-67
UNIPROTKB|G1K288232 RAB2A "Ras-related protein Rab 0.583 0.616 0.916 6.5e-67
UNIPROTKB|P61105212 RAB2A "Ras-related protein Rab 0.583 0.674 0.916 6.5e-67
UNIPROTKB|P61019212 RAB2A "Ras-related protein Rab 0.583 0.674 0.916 6.5e-67
UNIPROTKB|Q01971212 RAB2A "Ras-related protein Rab 0.583 0.674 0.916 6.5e-67
UNIPROTKB|Q4R4X6212 RAB2A "Ras-related protein Rab 0.583 0.674 0.916 6.5e-67
UNIPROTKB|Q5R6B6212 RAB2A "Ras-related protein Rab 0.583 0.674 0.916 6.5e-67
MGI|MGI:1928750212 Rab2a "RAB2A, member RAS oncog 0.583 0.674 0.916 6.5e-67
FB|FBgn0014009 Rab2 "Rab2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 687 (246.9 bits), Expect = 1.2e-67, P = 1.2e-67
 Identities = 134/143 (93%), Positives = 138/143 (96%)

Query:   100 VEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTW 159
             VEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTW
Sbjct:    41 VEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTW 100

Query:   160 LEDARQHSNSNMVIMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEAF 219
             LEDARQHSNSNMVIMLIGNKSDLD+RREVKKEEGE FAREHGLVFMETSA+ A NVEEAF
Sbjct:   101 LEDARQHSNSNMVIMLIGNKSDLDSRREVKKEEGEAFAREHGLVFMETSARTAANVEEAF 160

Query:   220 IDTAKEIYEKIQEGVFDITNEVD 242
             I+TAKEIYEKIQEGVFDI NE +
Sbjct:   161 INTAKEIYEKIQEGVFDINNEAN 183


GO:0003924 "GTPase activity" evidence=ISS;NAS
GO:0005525 "GTP binding" evidence=IEA;NAS
GO:0007264 "small GTPase mediated signal transduction" evidence=IEA
GO:0015031 "protein transport" evidence=IEA
GO:0031982 "vesicle" evidence=ISS
UNIPROTKB|F1N8Z3 RAB2A "Ras-related protein Rab-2A" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q90965 RAB2A "Ras-related protein Rab-2A" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G1K288 RAB2A "Ras-related protein Rab-2A" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P61105 RAB2A "Ras-related protein Rab-2A" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P61019 RAB2A "Ras-related protein Rab-2A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q01971 RAB2A "Ras-related protein Rab-2A" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R4X6 RAB2A "Ras-related protein Rab-2A" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R6B6 RAB2A "Ras-related protein Rab-2A" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
MGI|MGI:1928750 Rab2a "RAB2A, member RAS oncogene family" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q05975RAB2_LYMSTNo assigned EC number0.90970.58770.6792N/AN/A
P61105RAB2A_CANFANo assigned EC number0.91660.58770.6792yesN/A
P92963RAB1C_ARATHNo assigned EC number0.80980.56730.6587yesN/A
P53994RAB2A_MOUSENo assigned EC number0.91660.58770.6792yesN/A
P05712RAB2A_RATNo assigned EC number0.91660.58770.6792yesN/A
Q01971RAB2A_RABITNo assigned EC number0.91660.58770.6792yesN/A
Q90965RAB2A_CHICKNo assigned EC number0.91660.58770.6792yesN/A
Q4R4X6RAB2A_MACFANo assigned EC number0.91660.58770.6792N/AN/A
Q5R6B6RAB2A_PONABNo assigned EC number0.91660.58770.6792yesN/A
P61019RAB2A_HUMANNo assigned EC number0.91660.58770.6792noN/A
P36409RAB2A_DICDINo assigned EC number0.76050.55910.6618yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
cd01866168 cd01866, Rab2, Rab GTPase family 2 (Rab2) 1e-93
PLN03108210 PLN03108, PLN03108, Rab family protein; Provisiona 2e-91
smart00175164 smart00175, RAB, Rab subfamily of small GTPases 1e-79
cd00154159 cd00154, Rab, Ras-related in brain (Rab) family of 2e-69
pfam00071162 pfam00071, Ras, Ras family 1e-68
cd04122166 cd04122, Rab14, Rab GTPase family 14 (Rab14) 1e-68
cd01868165 cd01868, Rab11_like, Rab GTPase family 11 (Rab11)- 1e-67
cd04113161 cd04113, Rab4, Rab GTPase family 4 (Rab4) 2e-61
cd01867167 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase familie 2e-60
cd04111211 cd04111, Rab39, Rab GTPase family 39 (Rab39) 2e-56
cd01860163 cd01860, Rab5_related, Rab-related GTPase family i 1e-55
cd01869166 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes t 8e-55
cd01864165 cd01864, Rab19, Rab GTPase family 19 (Rab19) 1e-53
PLN03110216 PLN03110, PLN03110, Rab GTPase; Provisional 2e-52
cd01863161 cd01863, Rab18, Rab GTPase family 18 (Rab18) 5e-51
cd04112191 cd04112, Rab26, Rab GTPase family 26 (Rab26) 3e-48
cd01861161 cd01861, Rab6, Rab GTPase family 6 (Rab6) 1e-47
cd04114169 cd04114, Rab30, Rab GTPase family 30 (Rab30) 1e-43
cd04123162 cd04123, Rab21, Rab GTPase family 21 (Rab21) 5e-42
PLN03118211 PLN03118, PLN03118, Rab family protein; Provisiona 7e-42
PLN03108210 PLN03108, PLN03108, Rab family protein; Provisiona 6e-39
cd04120202 cd04120, Rab12, Rab GTPase family 12 (Rab12) 2e-38
cd01862172 cd01862, Rab7, Rab GTPase family 7 (Rab7) 7e-38
cd00876160 cd00876, Ras, Rat sarcoma (Ras) family of small gu 5e-37
cd04115170 cd04115, Rab33B_Rab33A, Rab GTPase family 33 inclu 5e-36
cd01865165 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, 5e-34
smart00173164 smart00173, RAS, Ras subfamily of RAS small GTPase 1e-33
smart00010166 smart00010, small_GTPase, Small GTPase of the Ras 1e-33
cd04110199 cd04110, Rab35, Rab GTPase family 35 (Rab35) 1e-33
cd04117164 cd04117, Rab15, Rab GTPase family 15 (Rab15) 9e-33
cd04107201 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab1 3e-32
cd01866168 cd01866, Rab2, Rab GTPase family 2 (Rab2) 1e-30
PTZ00099176 PTZ00099, PTZ00099, rab6; Provisional 5e-30
cd04127180 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) 7e-30
cd04121189 cd04121, Rab40, Rab GTPase family 40 (Rab40) conta 3e-29
cd04119168 cd04119, RJL, Rab GTPase family J-like (RabJ-like) 8e-29
cd04139163 cd04139, RalA_RalB, Ral (Ras-like) family containi 3e-28
cd04144190 cd04144, Ras2, Rat sarcoma (Ras) family 2 of small 9e-27
cd04145164 cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3 7e-26
cd04116170 cd04116, Rab9, Rab GTPase family 9 (Rab9) 2e-25
cd04101167 cd04101, RabL4, Rab GTPase-like family 4 (Rab-like 3e-25
cd04175164 cd04175, Rap1, Rap1 family GTPase consists of Rap1 8e-25
smart00175164 smart00175, RAB, Rab subfamily of small GTPases 2e-24
cd04146166 cd04146, RERG_RasL11_like, Ras-related and Estroge 3e-24
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 3e-24
cd04177168 cd04177, RSR1, RSR1/Bud1p family GTPase 4e-24
PTZ00369189 PTZ00369, PTZ00369, Ras-like protein; Provisional 6e-24
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 6e-24
cd04138162 cd04138, H_N_K_Ras_like, Ras GTPase family contain 8e-24
cd04136164 cd04136, Rap_like, Rap-like family consists of Rap 1e-23
cd04106162 cd04106, Rab23_like, Rab GTPase family 23 (Rab23)- 1e-23
cd04118193 cd04118, Rab24, Rab GTPase family 24 (Rab24) 2e-23
cd04137180 cd04137, RheB, Ras Homolog Enriched in Brain (RheB 3e-23
cd04124161 cd04124, RabL2, Rab GTPase-like family 2 (Rab-like 4e-23
pfam00071162 pfam00071, Ras, Ras family 5e-23
cd04176163 cd04176, Rap2, Rap2 family GTPase consists of Rap2 3e-22
cd00157171 cd00157, Rho, Ras homology family (Rho) of small g 2e-21
cd04108170 cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab3 5e-21
cd01868165 cd01868, Rab11_like, Rab GTPase family 11 (Rab11)- 2e-20
smart00174174 smart00174, RHO, Rho (Ras homology) subfamily of R 2e-20
cd01860163 cd01860, Rab5_related, Rab-related GTPase family i 3e-20
cd01867167 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase familie 8e-20
cd04140165 cd04140, ARHI_like, A Ras homolog member I (ARHI) 1e-19
cd04122166 cd04122, Rab14, Rab GTPase family 14 (Rab14) 3e-19
cd04109213 cd04109, Rab28, Rab GTPase family 28 (Rab28) 5e-19
cd04141172 cd04141, Rit_Rin_Ric, Ras-like protein in all tiss 5e-19
cd00877166 cd00877, Ran, Ras-related nuclear proteins (Ran)/T 1e-18
cd00154159 cd00154, Rab, Ras-related in brain (Rab) family of 2e-18
cd00876160 cd00876, Ras, Rat sarcoma (Ras) family of small gu 2e-17
cd04111211 cd04111, Rab39, Rab GTPase family 39 (Rab39) 9e-17
cd04112191 cd04112, Rab26, Rab GTPase family 26 (Rab26) 2e-16
smart00173164 smart00173, RAS, Ras subfamily of RAS small GTPase 2e-16
smart00010166 smart00010, small_GTPase, Small GTPase of the Ras 2e-16
cd04148219 cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfam 2e-16
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 2e-16
PLN03071219 PLN03071, PLN03071, GTP-binding nuclear protein Ra 3e-16
cd01869166 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes t 8e-16
smart00176200 smart00176, RAN, Ran (Ras-related nuclear proteins 1e-15
cd01861161 cd01861, Rab6, Rab GTPase family 6 (Rab6) 8e-15
cd04144190 cd04144, Ras2, Rat sarcoma (Ras) family 2 of small 6e-14
PTZ00132215 PTZ00132, PTZ00132, GTP-binding nuclear protein Ra 6e-14
cd04113161 cd04113, Rab4, Rab GTPase family 4 (Rab4) 9e-14
cd01864165 cd01864, Rab19, Rab GTPase family 19 (Rab19) 1e-13
cd04132197 cd04132, Rho4_like, Ras homology family 4 (Rho4) o 2e-13
cd04130173 cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (W 3e-13
PLN03110216 PLN03110, PLN03110, Rab GTPase; Provisional 5e-13
cd04137180 cd04137, RheB, Ras Homolog Enriched in Brain (RheB 1e-12
cd01863161 cd01863, Rab18, Rab GTPase family 18 (Rab18) 2e-12
cd04128182 cd04128, Spg1, Septum-promoting GTPase (Spg1) 2e-12
cd04123162 cd04123, Rab21, Rab GTPase family 21 (Rab21) 6e-12
cd04139163 cd04139, RalA_RalB, Ral (Ras-like) family containi 8e-12
cd04145164 cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3 9e-12
PLN03118211 PLN03118, PLN03118, Rab family protein; Provisiona 3e-11
cd04134185 cd04134, Rho3, Ras homology family 3 (Rho3) of sma 3e-11
cd01870175 cd01870, RhoA_like, Ras homology family A (RhoA)-l 3e-11
cd04175164 cd04175, Rap1, Rap1 family GTPase consists of Rap1 4e-11
cd04126220 cd04126, Rab20, Rab GTPase family 20 (Rab20) 4e-11
cd04114169 cd04114, Rab30, Rab GTPase family 30 (Rab30) 6e-11
PTZ00369189 PTZ00369, PTZ00369, Ras-like protein; Provisional 6e-11
cd04136164 cd04136, Rap_like, Rap-like family consists of Rap 1e-10
cd04176163 cd04176, Rap2, Rap2 family GTPase consists of Rap2 1e-10
cd04140165 cd04140, ARHI_like, A Ras homolog member I (ARHI) 1e-10
cd00878158 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf 2e-10
cd04129190 cd04129, Rho2, Ras homology family 2 (Rho2) of sma 4e-10
cd01862172 cd01862, Rab7, Rab GTPase family 7 (Rab7) 7e-10
cd04177168 cd04177, RSR1, RSR1/Bud1p family GTPase 9e-10
cd04138162 cd04138, H_N_K_Ras_like, Ras GTPase family contain 9e-10
cd04173221 cd04173, Rnd2_Rho7, Rnd2/Rho7 GTPases 2e-09
pfam08477116 pfam08477, Miro, Miro-like protein 3e-09
cd04143247 cd04143, Rhes_like, Ras homolog enriched in striat 3e-09
cd04141172 cd04141, Rit_Rin_Ric, Ras-like protein in all tiss 6e-09
cd04101167 cd04101, RabL4, Rab GTPase-like family 4 (Rab-like 9e-09
cd04146166 cd04146, RERG_RasL11_like, Ras-related and Estroge 1e-08
cd04133173 cd04133, Rop_like, Rho-related protein from plants 1e-08
cd04131176 cd04131, Rnd, Rho family GTPase subfamily Rnd incl 2e-08
cd01875191 cd01875, RhoG, Ras homolog family, member G (RhoG) 2e-08
cd04127180 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) 4e-08
cd04119168 cd04119, RJL, Rab GTPase family J-like (RabJ-like) 8e-08
cd04107201 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab1 1e-07
cd04147197 cd04147, Ras_dva, Ras - dorsal-ventral anterior lo 1e-07
cd04148219 cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfam 2e-07
cd01871174 cd01871, Rac1_like, Ras-related C3 botulinum toxin 2e-07
cd04160168 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) 3e-07
cd04120202 cd04120, Rab12, Rab GTPase family 12 (Rab12) 8e-07
smart00177175 smart00177, ARF, ARF-like small GTPases; ARF, ADP- 2e-06
cd04172182 cd04172, Rnd3_RhoE_Rho8, Rnd3/RhoE/Rho8 GTPases 3e-06
PTZ00133182 PTZ00133, PTZ00133, ADP-ribosylation factor; Provi 7e-06
cd04153174 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) 7e-06
PTZ00099176 PTZ00099, PTZ00099, rab6; Provisional 1e-05
cd09914161 cd09914, RocCOR, Ras of complex proteins (Roc) C-t 1e-05
cd01865165 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, 2e-05
cd04174232 cd04174, Rnd1_Rho6, Rnd1/Rho6 GTPases 2e-05
cd04149168 cd04149, Arf6, ADP ribosylation factor 6 (Arf6) 2e-05
cd04159159 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl 3e-05
cd04152183 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) 4e-05
cd04117164 cd04117, Rab15, Rab GTPase family 15 (Rab15) 5e-05
cd00157171 cd00157, Rho, Ras homology family (Rho) of small g 6e-05
cd04143247 cd04143, Rhes_like, Ras homolog enriched in striat 8e-05
cd04110199 cd04110, Rab35, Rab GTPase family 35 (Rab35) 9e-05
cd04116170 cd04116, Rab9, Rab GTPase family 9 (Rab9) 9e-05
smart00174174 smart00174, RHO, Rho (Ras homology) subfamily of R 1e-04
cd04150159 cd04150, Arf1_5_like, ADP-ribosylation factor-1 (A 1e-04
pfam00025174 pfam00025, Arf, ADP-ribosylation factor family 1e-04
cd01893168 cd01893, Miro1, Mitochondrial Rho family 1 (Miro1) 1e-04
cd04132197 cd04132, Rho4_like, Ras homology family 4 (Rho4) o 2e-04
cd01873195 cd01873, RhoBTB, RhoBTB protein is an atypical mem 2e-04
cd04118193 cd04118, Rab24, Rab GTPase family 24 (Rab24) 4e-04
cd04151158 cd04151, Arl1, ADP ribosylation factor 1 (Arf1) 4e-04
cd04156160 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 5e-04
cd04115170 cd04115, Rab33B_Rab33A, Rab GTPase family 33 inclu 0.001
cd04109213 cd04109, Rab28, Rab GTPase family 28 (Rab28) 0.001
cd04135174 cd04135, Tc10, Rho GTPase TC10 (Tc10) 0.001
cd00877166 cd00877, Ran, Ras-related nuclear proteins (Ran)/T 0.002
cd04142198 cd04142, RRP22, Ras-related protein on chromosome 0.002
PLN00223181 PLN00223, PLN00223, ADP-ribosylation factor; Provi 0.002
pfam04670230 pfam04670, Gtr1_RagA, Gtr1/RagA G protein conserve 0.003
cd04158169 cd04158, ARD1, (ADP-ribosylation factor domain pro 0.003
COG2229187 COG2229, COG2229, Predicted GTPase [General functi 0.003
cd04121189 cd04121, Rab40, Rab GTPase family 40 (Rab40) conta 0.004
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 0.004
>gnl|CDD|206658 cd01866, Rab2, Rab GTPase family 2 (Rab2) Back     alignment and domain information
 Score =  271 bits (695), Expect = 1e-93
 Identities = 117/131 (89%), Positives = 125/131 (95%)

Query: 99  GVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTT 158
           GVEFGARMITIDGKQIKLQIWDTAGQE+FRSITRSYYRGAAGALLVYDITRRETFNHLT+
Sbjct: 38  GVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTS 97

Query: 159 WLEDARQHSNSNMVIMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEA 218
           WLEDARQHSNSNM IMLIGNK DL++RREV  EEGE FAREHGL+FMETSAK A+NVEEA
Sbjct: 98  WLEDARQHSNSNMTIMLIGNKCDLESRREVSYEEGEAFAREHGLIFMETSAKTASNVEEA 157

Query: 219 FIDTAKEIYEK 229
           FI+TAKEIY+K
Sbjct: 158 FINTAKEIYDK 168


Rab2 is localized on cis-Golgi membranes and interacts with Golgi matrix proteins. Rab2 is also implicated in the maturation of vesicular tubular clusters (VTCs), which are microtubule-associated intermediates in transport between the ER and Golgi apparatus. In plants, Rab2 regulates vesicle trafficking between the ER and the Golgi bodies and is important to pollen tube growth. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation. Length = 168

>gnl|CDD|178655 PLN03108, PLN03108, Rab family protein; Provisional Back     alignment and domain information
>gnl|CDD|197555 smart00175, RAB, Rab subfamily of small GTPases Back     alignment and domain information
>gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|215692 pfam00071, Ras, Ras family Back     alignment and domain information
>gnl|CDD|133322 cd04122, Rab14, Rab GTPase family 14 (Rab14) Back     alignment and domain information
>gnl|CDD|206660 cd01868, Rab11_like, Rab GTPase family 11 (Rab11)-like includes Rab11a, Rab11b, and Rab25 Back     alignment and domain information
>gnl|CDD|206696 cd04113, Rab4, Rab GTPase family 4 (Rab4) Back     alignment and domain information
>gnl|CDD|206659 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase families 8, 10, 13 (Rab8, Rab10, Rab13) Back     alignment and domain information
>gnl|CDD|133311 cd04111, Rab39, Rab GTPase family 39 (Rab39) Back     alignment and domain information
>gnl|CDD|206653 cd01860, Rab5_related, Rab-related GTPase family includes Rab5 and Rab22; regulates early endosome fusion Back     alignment and domain information
>gnl|CDD|206661 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes the yeast homolog Ypt1 Back     alignment and domain information
>gnl|CDD|133267 cd01864, Rab19, Rab GTPase family 19 (Rab19) Back     alignment and domain information
>gnl|CDD|178657 PLN03110, PLN03110, Rab GTPase; Provisional Back     alignment and domain information
>gnl|CDD|206656 cd01863, Rab18, Rab GTPase family 18 (Rab18) Back     alignment and domain information
>gnl|CDD|206695 cd04112, Rab26, Rab GTPase family 26 (Rab26) Back     alignment and domain information
>gnl|CDD|206654 cd01861, Rab6, Rab GTPase family 6 (Rab6) Back     alignment and domain information
>gnl|CDD|133314 cd04114, Rab30, Rab GTPase family 30 (Rab30) Back     alignment and domain information
>gnl|CDD|133323 cd04123, Rab21, Rab GTPase family 21 (Rab21) Back     alignment and domain information
>gnl|CDD|215587 PLN03118, PLN03118, Rab family protein; Provisional Back     alignment and domain information
>gnl|CDD|178655 PLN03108, PLN03108, Rab family protein; Provisional Back     alignment and domain information
>gnl|CDD|206699 cd04120, Rab12, Rab GTPase family 12 (Rab12) Back     alignment and domain information
>gnl|CDD|206655 cd01862, Rab7, Rab GTPase family 7 (Rab7) Back     alignment and domain information
>gnl|CDD|206642 cd00876, Ras, Rat sarcoma (Ras) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|133315 cd04115, Rab33B_Rab33A, Rab GTPase family 33 includes Rab33A and Rab33B Back     alignment and domain information
>gnl|CDD|206657 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, Rab3B, Rab3C and Rab3D Back     alignment and domain information
>gnl|CDD|214541 smart00173, RAS, Ras subfamily of RAS small GTPases Back     alignment and domain information
>gnl|CDD|197466 smart00010, small_GTPase, Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>gnl|CDD|133310 cd04110, Rab35, Rab GTPase family 35 (Rab35) Back     alignment and domain information
>gnl|CDD|206698 cd04117, Rab15, Rab GTPase family 15 (Rab15) Back     alignment and domain information
>gnl|CDD|206692 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab18) and 32 (Rab32) Back     alignment and domain information
>gnl|CDD|206658 cd01866, Rab2, Rab GTPase family 2 (Rab2) Back     alignment and domain information
>gnl|CDD|185444 PTZ00099, PTZ00099, rab6; Provisional Back     alignment and domain information
>gnl|CDD|206700 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) Back     alignment and domain information
>gnl|CDD|133321 cd04121, Rab40, Rab GTPase family 40 (Rab40) contains Rab40a, Rab40b and Rab40c Back     alignment and domain information
>gnl|CDD|133319 cd04119, RJL, Rab GTPase family J-like (RabJ-like) Back     alignment and domain information
>gnl|CDD|206710 cd04139, RalA_RalB, Ral (Ras-like) family containing highly homologous RalA and RalB Back     alignment and domain information
>gnl|CDD|133344 cd04144, Ras2, Rat sarcoma (Ras) family 2 of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|133345 cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3 Back     alignment and domain information
>gnl|CDD|206697 cd04116, Rab9, Rab GTPase family 9 (Rab9) Back     alignment and domain information
>gnl|CDD|206688 cd04101, RabL4, Rab GTPase-like family 4 (Rab-like4) Back     alignment and domain information
>gnl|CDD|133375 cd04175, Rap1, Rap1 family GTPase consists of Rap1a and Rap1b isoforms Back     alignment and domain information
>gnl|CDD|197555 smart00175, RAB, Rab subfamily of small GTPases Back     alignment and domain information
>gnl|CDD|206713 cd04146, RERG_RasL11_like, Ras-related and Estrogen-Regulated Growth inhibitor (RERG) and Ras-like 11 (RasL11)-like families Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|133377 cd04177, RSR1, RSR1/Bud1p family GTPase Back     alignment and domain information
>gnl|CDD|240385 PTZ00369, PTZ00369, Ras-like protein; Provisional Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|133338 cd04138, H_N_K_Ras_like, Ras GTPase family containing H-Ras,N-Ras and K-Ras4A/4B Back     alignment and domain information
>gnl|CDD|206708 cd04136, Rap_like, Rap-like family consists of Rap1, Rap2 and RSR1 Back     alignment and domain information
>gnl|CDD|133306 cd04106, Rab23_like, Rab GTPase family 23 (Rab23)-like Back     alignment and domain information
>gnl|CDD|133318 cd04118, Rab24, Rab GTPase family 24 (Rab24) Back     alignment and domain information
>gnl|CDD|206709 cd04137, RheB, Ras Homolog Enriched in Brain (RheB) is a small GTPase Back     alignment and domain information
>gnl|CDD|133324 cd04124, RabL2, Rab GTPase-like family 2 (Rab-like2) Back     alignment and domain information
>gnl|CDD|215692 pfam00071, Ras, Ras family Back     alignment and domain information
>gnl|CDD|133376 cd04176, Rap2, Rap2 family GTPase consists of Rap2a, Rap2b, and Rap2c Back     alignment and domain information
>gnl|CDD|206641 cd00157, Rho, Ras homology family (Rho) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206693 cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab34) and 36 (Rab36) Back     alignment and domain information
>gnl|CDD|206660 cd01868, Rab11_like, Rab GTPase family 11 (Rab11)-like includes Rab11a, Rab11b, and Rab25 Back     alignment and domain information
>gnl|CDD|197554 smart00174, RHO, Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>gnl|CDD|206653 cd01860, Rab5_related, Rab-related GTPase family includes Rab5 and Rab22; regulates early endosome fusion Back     alignment and domain information
>gnl|CDD|206659 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase families 8, 10, 13 (Rab8, Rab10, Rab13) Back     alignment and domain information
>gnl|CDD|206711 cd04140, ARHI_like, A Ras homolog member I (ARHI) Back     alignment and domain information
>gnl|CDD|133322 cd04122, Rab14, Rab GTPase family 14 (Rab14) Back     alignment and domain information
>gnl|CDD|206694 cd04109, Rab28, Rab GTPase family 28 (Rab28) Back     alignment and domain information
>gnl|CDD|206712 cd04141, Rit_Rin_Ric, Ras-like protein in all tissues (Rit), Ras-like protein in neurons (Rin) and Ras-related protein which interacts with calmodulin (Ric) Back     alignment and domain information
>gnl|CDD|206643 cd00877, Ran, Ras-related nuclear proteins (Ran)/TC4 family of small GTPases Back     alignment and domain information
>gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206642 cd00876, Ras, Rat sarcoma (Ras) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|133311 cd04111, Rab39, Rab GTPase family 39 (Rab39) Back     alignment and domain information
>gnl|CDD|206695 cd04112, Rab26, Rab GTPase family 26 (Rab26) Back     alignment and domain information
>gnl|CDD|214541 smart00173, RAS, Ras subfamily of RAS small GTPases Back     alignment and domain information
>gnl|CDD|197466 smart00010, small_GTPase, Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>gnl|CDD|206715 cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfamily of Ras GTPases Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|178620 PLN03071, PLN03071, GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>gnl|CDD|206661 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes the yeast homolog Ypt1 Back     alignment and domain information
>gnl|CDD|128473 smart00176, RAN, Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>gnl|CDD|206654 cd01861, Rab6, Rab GTPase family 6 (Rab6) Back     alignment and domain information
>gnl|CDD|133344 cd04144, Ras2, Rat sarcoma (Ras) family 2 of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|240284 PTZ00132, PTZ00132, GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>gnl|CDD|206696 cd04113, Rab4, Rab GTPase family 4 (Rab4) Back     alignment and domain information
>gnl|CDD|133267 cd01864, Rab19, Rab GTPase family 19 (Rab19) Back     alignment and domain information
>gnl|CDD|206704 cd04132, Rho4_like, Ras homology family 4 (Rho4) of small guanosine triphosphatases (GTPases)-like Back     alignment and domain information
>gnl|CDD|133330 cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (Wrch-1) is a Rho family GTPase similar to Cdc42 Back     alignment and domain information
>gnl|CDD|178657 PLN03110, PLN03110, Rab GTPase; Provisional Back     alignment and domain information
>gnl|CDD|206709 cd04137, RheB, Ras Homolog Enriched in Brain (RheB) is a small GTPase Back     alignment and domain information
>gnl|CDD|206656 cd01863, Rab18, Rab GTPase family 18 (Rab18) Back     alignment and domain information
>gnl|CDD|206701 cd04128, Spg1, Septum-promoting GTPase (Spg1) Back     alignment and domain information
>gnl|CDD|133323 cd04123, Rab21, Rab GTPase family 21 (Rab21) Back     alignment and domain information
>gnl|CDD|206710 cd04139, RalA_RalB, Ral (Ras-like) family containing highly homologous RalA and RalB Back     alignment and domain information
>gnl|CDD|133345 cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3 Back     alignment and domain information
>gnl|CDD|215587 PLN03118, PLN03118, Rab family protein; Provisional Back     alignment and domain information
>gnl|CDD|206706 cd04134, Rho3, Ras homology family 3 (Rho3) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206662 cd01870, RhoA_like, Ras homology family A (RhoA)-like includes RhoA, RhoB and RhoC Back     alignment and domain information
>gnl|CDD|133375 cd04175, Rap1, Rap1 family GTPase consists of Rap1a and Rap1b isoforms Back     alignment and domain information
>gnl|CDD|133326 cd04126, Rab20, Rab GTPase family 20 (Rab20) Back     alignment and domain information
>gnl|CDD|133314 cd04114, Rab30, Rab GTPase family 30 (Rab30) Back     alignment and domain information
>gnl|CDD|240385 PTZ00369, PTZ00369, Ras-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206708 cd04136, Rap_like, Rap-like family consists of Rap1, Rap2 and RSR1 Back     alignment and domain information
>gnl|CDD|133376 cd04176, Rap2, Rap2 family GTPase consists of Rap2a, Rap2b, and Rap2c Back     alignment and domain information
>gnl|CDD|206711 cd04140, ARHI_like, A Ras homolog member I (ARHI) Back     alignment and domain information
>gnl|CDD|206644 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf-like (Arl) small GTPases Back     alignment and domain information
>gnl|CDD|206702 cd04129, Rho2, Ras homology family 2 (Rho2) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206655 cd01862, Rab7, Rab GTPase family 7 (Rab7) Back     alignment and domain information
>gnl|CDD|133377 cd04177, RSR1, RSR1/Bud1p family GTPase Back     alignment and domain information
>gnl|CDD|133338 cd04138, H_N_K_Ras_like, Ras GTPase family containing H-Ras,N-Ras and K-Ras4A/4B Back     alignment and domain information
>gnl|CDD|206736 cd04173, Rnd2_Rho7, Rnd2/Rho7 GTPases Back     alignment and domain information
>gnl|CDD|219856 pfam08477, Miro, Miro-like protein Back     alignment and domain information
>gnl|CDD|133343 cd04143, Rhes_like, Ras homolog enriched in striatum (Rhes) and activator of G-protein signaling 1 (Dexras1/AGS1) Back     alignment and domain information
>gnl|CDD|206712 cd04141, Rit_Rin_Ric, Ras-like protein in all tissues (Rit), Ras-like protein in neurons (Rin) and Ras-related protein which interacts with calmodulin (Ric) Back     alignment and domain information
>gnl|CDD|206688 cd04101, RabL4, Rab GTPase-like family 4 (Rab-like4) Back     alignment and domain information
>gnl|CDD|206713 cd04146, RERG_RasL11_like, Ras-related and Estrogen-Regulated Growth inhibitor (RERG) and Ras-like 11 (RasL11)-like families Back     alignment and domain information
>gnl|CDD|206705 cd04133, Rop_like, Rho-related protein from plants (Rop)-like Back     alignment and domain information
>gnl|CDD|206703 cd04131, Rnd, Rho family GTPase subfamily Rnd includes Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8 Back     alignment and domain information
>gnl|CDD|133277 cd01875, RhoG, Ras homolog family, member G (RhoG) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206700 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) Back     alignment and domain information
>gnl|CDD|133319 cd04119, RJL, Rab GTPase family J-like (RabJ-like) Back     alignment and domain information
>gnl|CDD|206692 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab18) and 32 (Rab32) Back     alignment and domain information
>gnl|CDD|206714 cd04147, Ras_dva, Ras - dorsal-ventral anterior localization (Ras-dva) family Back     alignment and domain information
>gnl|CDD|206715 cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfamily of Ras GTPases Back     alignment and domain information
>gnl|CDD|206663 cd01871, Rac1_like, Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)-like consists of Rac1, Rac2 and Rac3 Back     alignment and domain information
>gnl|CDD|206725 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) Back     alignment and domain information
>gnl|CDD|206699 cd04120, Rab12, Rab GTPase family 12 (Rab12) Back     alignment and domain information
>gnl|CDD|128474 smart00177, ARF, ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>gnl|CDD|206735 cd04172, Rnd3_RhoE_Rho8, Rnd3/RhoE/Rho8 GTPases Back     alignment and domain information
>gnl|CDD|173423 PTZ00133, PTZ00133, ADP-ribosylation factor; Provisional Back     alignment and domain information
>gnl|CDD|133353 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) GTPases Back     alignment and domain information
>gnl|CDD|185444 PTZ00099, PTZ00099, rab6; Provisional Back     alignment and domain information
>gnl|CDD|206741 cd09914, RocCOR, Ras of complex proteins (Roc) C-terminal of Roc (COR) domain family Back     alignment and domain information
>gnl|CDD|206657 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, Rab3B, Rab3C and Rab3D Back     alignment and domain information
>gnl|CDD|206737 cd04174, Rnd1_Rho6, Rnd1/Rho6 GTPases Back     alignment and domain information
>gnl|CDD|206716 cd04149, Arf6, ADP ribosylation factor 6 (Arf6) Back     alignment and domain information
>gnl|CDD|206724 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl10) GTPases Back     alignment and domain information
>gnl|CDD|206719 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) GTPases Back     alignment and domain information
>gnl|CDD|206698 cd04117, Rab15, Rab GTPase family 15 (Rab15) Back     alignment and domain information
>gnl|CDD|206641 cd00157, Rho, Ras homology family (Rho) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|133343 cd04143, Rhes_like, Ras homolog enriched in striatum (Rhes) and activator of G-protein signaling 1 (Dexras1/AGS1) Back     alignment and domain information
>gnl|CDD|133310 cd04110, Rab35, Rab GTPase family 35 (Rab35) Back     alignment and domain information
>gnl|CDD|206697 cd04116, Rab9, Rab GTPase family 9 (Rab9) Back     alignment and domain information
>gnl|CDD|197554 smart00174, RHO, Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>gnl|CDD|206717 cd04150, Arf1_5_like, ADP-ribosylation factor-1 (Arf1) and ADP-ribosylation factor-5 (Arf5) Back     alignment and domain information
>gnl|CDD|200938 pfam00025, Arf, ADP-ribosylation factor family Back     alignment and domain information
>gnl|CDD|206680 cd01893, Miro1, Mitochondrial Rho family 1 (Miro1), N-terminal Back     alignment and domain information
>gnl|CDD|206704 cd04132, Rho4_like, Ras homology family 4 (Rho4) of small guanosine triphosphatases (GTPases)-like Back     alignment and domain information
>gnl|CDD|133275 cd01873, RhoBTB, RhoBTB protein is an atypical member of the Rho family of small GTPases Back     alignment and domain information
>gnl|CDD|133318 cd04118, Rab24, Rab GTPase family 24 (Rab24) Back     alignment and domain information
>gnl|CDD|206718 cd04151, Arl1, ADP ribosylation factor 1 (Arf1) Back     alignment and domain information
>gnl|CDD|133356 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 (ARLTS1 or Arl11) Back     alignment and domain information
>gnl|CDD|133315 cd04115, Rab33B_Rab33A, Rab GTPase family 33 includes Rab33A and Rab33B Back     alignment and domain information
>gnl|CDD|206694 cd04109, Rab28, Rab GTPase family 28 (Rab28) Back     alignment and domain information
>gnl|CDD|206707 cd04135, Tc10, Rho GTPase TC10 (Tc10) Back     alignment and domain information
>gnl|CDD|206643 cd00877, Ran, Ras-related nuclear proteins (Ran)/TC4 family of small GTPases Back     alignment and domain information
>gnl|CDD|133342 cd04142, RRP22, Ras-related protein on chromosome 22 (RRP22) family Back     alignment and domain information
>gnl|CDD|165788 PLN00223, PLN00223, ADP-ribosylation factor; Provisional Back     alignment and domain information
>gnl|CDD|218203 pfam04670, Gtr1_RagA, Gtr1/RagA G protein conserved region Back     alignment and domain information
>gnl|CDD|206723 cd04158, ARD1, (ADP-ribosylation factor domain protein 1 (ARD1) Back     alignment and domain information
>gnl|CDD|225138 COG2229, COG2229, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|133321 cd04121, Rab40, Rab GTPase family 40 (Rab40) contains Rab40a, Rab40b and Rab40c Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
2a5j_A191 Crystal Structure Of Human Rab2b Length = 191 1e-68
1z0a_A174 Gdp-Bound Rab2a Gtpase Length = 174 2e-68
4drz_A196 Crystal Structure Of Human Rab14 Length = 196 3e-48
1z0f_A179 Gdp-Bound Rab14 Gtpase Length = 179 8e-48
2bmd_A186 High Resolution Structure Of Gdp-Bound Human Rab4a 4e-45
2o52_A200 Crystal Structure Of Human Rab4b In Complex With Gd 4e-44
1yu9_A175 Gppnhp-Bound Rab4a Length = 175 7e-43
1z0k_A172 Structure Of Gtp-Bound Rab4q67l Gtpase In Complex W 5e-42
2f9l_A199 3d Structure Of Inactive Human Rab11b Gtpase Length 3e-37
1yzk_A184 Gppnhp Bound Rab11 Gtpase Length = 184 7e-37
1oiv_A191 X-Ray Structure Of The Small G Protein Rab11a In Co 8e-37
2hv8_A172 Crystal Structure Of Gtp-Bound Rab11 In Complex Wit 6e-36
1oiw_A191 X-ray Structure Of The Small G Protein Rab11a In Co 6e-36
2d7c_A167 Crystal Structure Of Human Rab11 In Complex With Fi 4e-35
2gzd_A173 Crystal Structure Of Rab11 In Complex With Rab11-Fi 4e-35
3qbt_A174 Crystal Structure Of Ocrl1 540-678 In Complex With 7e-35
2fu5_C183 Structure Of Rab8 In Complex With Mss4 Length = 183 8e-35
3cpj_B223 Crystal Structure Of Ypt31 In Complex With Yeast Ra 2e-34
3tkl_A196 Crystal Structure Of The Gtp-Bound Rab1a In Complex 8e-34
2oil_A193 Crystal Structure Of Human Rab25 In Complex With Gd 2e-33
3tso_A178 Structure Of The Cancer Associated Rab25 Protein In 2e-33
2hup_A201 Crystal Structure Of Human Rab43 In Complex With Gd 2e-33
3sfv_A181 Crystal Structure Of The Gdp-Bound Rab1a S25n Mutan 3e-33
4fmb_B171 Vira-Rab1 Complex Structure Length = 171 3e-33
4fmd_F164 Espg-Rab1 Complex Structure At 3.05 A Length = 164 3e-33
4fmc_B171 Espg-Rab1 Complex Length = 171 3e-33
2fol_A191 Crystal Structure Of Human Rab1a In Complex With Gd 4e-33
2rhd_A175 Crystal Structure Of Cryptosporidium Parvum Small G 5e-33
3l0i_B199 Complex Structure Of Sidm/drra With The Wild Type R 8e-33
4i1o_A181 Crystal Structure Of The Legionella Pneumophila Gap 9e-33
3jza_A175 Crystal Structure Of Human Rab1b In Complex With Th 1e-32
1g17_A170 Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma) 4e-32
2wwx_A175 Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Ra 5e-32
3bfk_A181 Crystal Structure Of Plasmodium Falciparum Rab11a I 7e-32
2bcg_Y206 Structure Of Doubly Prenylated Ypt1:gdi Complex Len 9e-32
1ukv_Y206 Structure Of Rabgdp-Dissociation Inhibitor In Compl 1e-31
1g16_A170 Crystal Structure Of Sec4-Gdp Length = 170 1e-31
2eqb_A174 Crystal Structure Of The Rab Gtpase Sec4p, The Sec2 1e-31
2g6b_A180 Crystal Structure Of Human Rab26 In Complex With A 1e-31
3cph_A213 Crystal Structure Of Sec4 In Complex With Rab-Gdi L 1e-31
1yzn_A185 Gppnhp-Bound Ypt1p Gtpase Length = 185 3e-31
2ocy_C170 Complex Of The Guanine Exchange Factor Sec2p And Th 3e-31
2ew1_A201 Crystal Structure Of Rab30 In Complex With A Gtp An 2e-30
3rwm_B185 Crystal Structure Of Ypt32 In Complex With Gppnhp L 8e-30
1x3s_A195 Crystal Structure Of Human Rab18 In Complex With Gp 4e-29
2efc_B181 Ara7-GdpATVPS9A Length = 181 4e-29
2il1_A192 Crystal Structure Of A Predicted Human Gtpase In Co 5e-29
2hei_A179 Crystal Structure Of Human Rab5b In Complex With Gd 2e-28
1z07_A166 Gppnhp-Bound Rab5c G55q Mutant Gtpase Length = 166 4e-28
1huq_A164 1.8a Crystal Structure Of The Monomeric Gtpase Rab5 4e-28
1yzq_A170 Gppnhp-Bound Rab6 Gtpase Length = 170 6e-28
1z0d_A167 Gdp-bound Rab5c Gtpase Length = 167 3e-27
4dkx_A216 Crystal Structure Of The Rab 6a'(Q72l) Length = 216 3e-27
1tu3_A171 Crystal Structure Of Rab5 Complex With Rabaptin5 C- 4e-27
2y8e_A179 Crystal Structure Of D. Melanogaster Rab6 Gtpase Bo 4e-27
1n6i_A170 Crystal Structure Of Human Rab5a A30p Mutant Comple 4e-27
1n6r_A170 Crystal Structure Of Human Rab5a A30l Mutant Comple 5e-27
1n6h_A170 Crystal Structure Of Human Rab5a Length = 170 5e-27
1n6p_A170 Crystal Structure Of Human Rab5a A30e Mutant Comple 5e-27
1n6o_A170 Crystal Structure Of Human Rab5a A30k Mutant Comple 5e-27
1n6n_A170 Crystal Structure Of Human Rab5a A30r Mutant Comple 5e-27
2gil_A162 Structure Of The Extremely Slow Gtpase Rab6a In The 7e-27
2fe4_A171 The Crystal Structure Of Human Neuronal Rab6b In It 9e-27
3mjh_A168 Crystal Structure Of Human Rab5a In Complex With Th 4e-26
1tu4_A171 Crystal Structure Of Rab5-Gdp Complex Length = 171 4e-26
3cwz_A188 Strucure Of Rab6(Gtp)-R6ip1 Complex Length = 188 4e-26
3bbp_A211 Rab6-Gtp:gcc185 Rab Binding Domain Complex Length = 5e-26
3tw8_B181 Gef Domain Of Dennd 1b In Complex With Rab Gtpase R 1e-25
3dz8_A191 Crystal Structure Of Human Rab3b Gtpase Bound With 2e-25
1yvd_A169 Gppnhp-Bound Rab22 Gtpase Length = 169 2e-25
1d5c_A162 Crystal Structure Of Plasmodium Falciparum Rab6 Com 2e-25
3rab_A169 Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 2e-25
2gf9_A189 Crystal Structure Of Human Rab3d In Complex With Gd 4e-25
1z0j_A170 Structure Of Gtp-Bound Rab22q64l Gtpase In Complex 1e-24
1zbd_A203 Structural Basis Of Rab Effector Specificity: Cryst 2e-24
1ek0_A170 Gppnhp-Bound Ypt51 At 1.48 A Resolution Length = 17 5e-24
2fg5_A192 Crystal Structure Of Human Rab31 In Complex With A 6e-24
2p5s_A199 Rab Domain Of Human Rasef In Complex With Gdp Lengt 1e-23
4fmc_F117 Espg-Rab1 Complex Length = 117 4e-23
1yzt_A184 Gppnhp-Bound Rab21 Gtpase At 2.05 A Resolution Leng 2e-22
1yzu_A170 Gppnhp-Bound Rab21 Gtpase At 2.50 A Resolution Leng 2e-22
1z08_A170 Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 2e-22
1z06_A189 Gppnhp-Bound Rab33 Gtpase Length = 189 7e-22
3bc1_A195 Crystal Structure Of The Complex Rab27a-slp2a Lengt 9e-22
2g77_B198 Crystal Structure Of Gyp1 Tbc Domain In Complex Wit 3e-21
2f7s_A217 The Crystal Structure Of Human Rab27b Bound To Gdp 2e-20
3clv_A208 Crystal Structure Of Rab5a From Plasmodium Falcipar 7e-20
2iez_A220 Crystal Structure Of Mouse Rab27b Bound To Gdp In M 2e-19
1vg0_B207 The Crystal Structures Of The Rep-1 Protein In Comp 3e-19
2if0_A200 Crystal Structure Of Mouse Rab27b Bound To Gdp In M 3e-19
1vg1_A185 Gdp-bound Rab7 Length = 185 4e-19
3law_A207 Structure Of Gtp-Bound L129f Mutant Rab7 Length = 2 6e-19
1wms_A177 High Resolution Crystal Structure Of Human Rab9 Gtp 7e-19
1s8f_A177 Crystal Structure Of Rab9 Complexed To Gdp Reveals 8e-19
2zet_A203 Crystal Structure Of The Small Gtpase Rab27b Comple 8e-19
2iey_A195 Crystal Structure Of Mouse Rab27b Bound To Gdp In H 2e-18
1yzl_A179 Gppnhp-Bound Rab9 Gtpase Length = 179 2e-18
2fn4_A181 The Crystal Structure Of Human Ras-Related Protein, 2e-18
2ocb_A180 Crystal Structure Of Human Rab9b In Complex With A 2e-18
1t91_A207 Crystal Structure Of Human Small Gtpase Rab7(Gtp) L 2e-18
1z22_A168 Gdp-Bound Rab23 Gtpase Crystallized In C222(1) Spac 6e-18
2a78_A187 Crystal Structure Of The C3bot-Rala Complex Reveals 8e-18
1uad_A175 Crystal Structure Of The Rala-gppnhp-sec5 Ral-bindi 8e-18
2bov_A206 Molecular Recognition Of An Adp-Ribosylating Clostr 9e-18
1u8y_A168 Crystal Structures Of Ral-Gppnhp And Ral-Gdp Reveal 1e-17
2kwi_A178 Ralb-Rlip76 (Ralbp1) Complex Length = 178 1e-17
2ke5_A174 Solution Structure And Dynamics Of The Small Gtpase 1e-17
2ery_A172 The Crystal Structure Of The Ras Related Protein Rr 2e-17
1ky2_A182 Gppnhp-Bound Ypt7p At 1.6 A Resolution Length = 182 4e-17
3brw_D167 Structure Of The Rap-Rapgap Complex Length = 167 5e-17
4dxa_A169 Co-Crystal Structure Of Rap1 In Complex With Krit1 5e-17
1zc3_A175 Crystal Structure Of The Ral-Binding Domain Of Exo8 7e-17
1c1y_A167 Crystal Structure Of Rap.Gmppnp In Complex With The 1e-16
1gua_A167 Human Rap1a, Residues 1-167, Double Mutant (E30d,K3 1e-16
2cl0_X166 Crystal Structure Analysis Of A Fluorescent Form Of 8e-16
2cld_X166 Crystal Structure Analysis Of A Fluorescent Form Of 9e-16
4q21_A189 Molecular Switch For Signal Transduction: Structura 2e-15
1clu_A166 H-Ras Complexed With Diaminobenzophenone-Beta,Gamma 2e-15
1agp_A166 Three-Dimensional Structures And Properties Of A Tr 2e-15
3kkm_A172 Crystal Structure Of H-Ras T35s In Complex With Gpp 2e-15
4efm_A171 Crystal Structure Of H-Ras G12v In Complex With Gpp 2e-15
4efl_A171 Crystal Structure Of H-Ras Wt In Complex With Gppnh 2e-15
2c5l_A173 Structure Of Plc Epsilon Ras Association Domain Wit 2e-15
421p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 2e-15
1jah_A166 H-Ras P21 Protein Mutant G12p, Complexed With Guano 2e-15
1iaq_A166 C-H-Ras P21 Protein Mutant With Thr 35 Replaced By 2e-15
3k9n_A166 Allosteric Modulation Of H-Ras Gtpase Length = 166 2e-15
1wq1_R166 Ras-Rasgap Complex Length = 166 2e-15
3lo5_A166 Crystal Structure Of The Dominant Negative S17n Mut 2e-15
1rvd_A166 H-Ras Complexed With Diaminobenzophenone-Beta,Gamma 2e-15
3ddc_A166 Crystal Structure Of Nore1a In Complex With Ras Len 2e-15
1lfd_B167 Crystal Structure Of The Active Ras Protein Complex 2e-15
221p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 2e-15
3v4f_A166 H-Ras Peg 400CACL2, ORDERED OFF Length = 166 2e-15
6q21_A171 Molecular Switch For Signal Transduction: Structura 3e-15
2q21_A171 Crystal Structures At 2.2 Angstroms Resolution Of T 3e-15
4epr_A170 Discovery Of Small Molecules That Bind To K-Ras And 3e-15
4epx_A170 Discovery Of Small Molecules That Bind To K-Ras And 3e-15
4ept_A170 Discovery Of Small Molecules That Bind To K-Ras And 3e-15
2hxs_A178 Crystal Structure Of Rab28a Gtpase In The Inactive 3e-15
3i3s_R166 Crystal Structure Of H-Ras With Thr50 Replaced By I 4e-15
2quz_A166 Crystal Structure Of The Activating H-Rask117r Muta 5e-15
4dso_A189 Small-Molecule Ligands Bind To A Distinct Pocket In 6e-15
1lf0_A166 Crystal Structure Of Rasa59g In The Gtp-Bound Form 7e-15
2x1v_A166 Crystal Structure Of The Activating H-Ras I163f Mut 7e-15
521p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 7e-15
2rgb_A166 Crystal Structure Of H-Rasq61k-Gppnhp Length = 166 7e-15
3con_A190 Crystal Structure Of The Human Nras Gtpase Bound Wi 8e-15
621p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 1e-14
1nvv_Q166 Structural Evidence For Feedback Activation By Rasg 1e-14
4efn_A171 Crystal Structure Of H-Ras Q61l In Complex With Gpp 2e-14
1xcm_A167 Crystal Structure Of The Gppnhp-Bound H-Ras G60a Mu 2e-14
1xj0_A166 Crystal Structure Of The Gdp-Bound Form Of The Rasg 2e-14
721p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 2e-14
2rgc_A166 Crystal Structure Of H-Rasq61v-Gppnhp Length = 166 2e-14
1zvq_A166 Structure Of The Q61g Mutant Of Ras In The Gdp-Boun 2e-14
2rga_A166 Crystal Structure Of H-Rasq61i-Gppnhp Length = 166 2e-14
2bku_A177 Kap95p:rangtp Complex Length = 177 3e-14
1zw6_A166 Crystal Structure Of The Gtp-Bound Form Of Rasq61g 3e-14
1rrp_A204 Structure Of The Ran-Gppnhp-Ranbd1 Complex Length = 3e-14
1wa5_A176 Crystal Structure Of The Exportin Cse1p Complexed W 4e-14
1byu_A216 Canine Gdp-Ran Length = 216 4e-14
3gft_A187 Human K-Ras In Complex With A Gtp Analogue Length = 4e-14
1a2k_C216 Gdpran-Ntf2 Complex Length = 216 4e-14
3ea5_A216 Kap95p Binding Induces The Switch Loops Of Rangdp T 4e-14
1qg2_A216 Canine Gdp-Ran R76e Mutant Length = 216 4e-14
3gj0_A221 Crystal Structure Of Human Rangdp Length = 221 5e-14
3gj4_A221 Crystal Structure Of Human Rangdp-Nup153znf3 Comple 5e-14
2erx_A172 Crystal Structure Of Diras2 In Complex With Gdp And 6e-14
1qbk_C216 Structure Of The Karyopherin Beta2-ran Gppnhp Nucle 7e-14
1qg4_A216 Canine Gdp-Ran F72y Mutant Length = 216 9e-14
3nby_C176 Crystal Structure Of The Pki Nes-Crm1-Rangtp Nuclea 2e-13
3nc1_C182 Crystal Structure Of The Crm1-Rangtp Complex Length 3e-13
3ran_A216 Canine Gdp-Ran Q69l Mutant Length = 216 3e-13
2atv_A196 The Crystal Structure Of Human Rerg In The Gdp Boun 5e-13
3oes_A201 Crystal Structure Of The Small Gtpase Rhebl1 Length 7e-13
3icq_B171 Karyopherin Nuclear State Length = 171 1e-12
2x19_A172 Crystal Structure Of Importin13 - Rangtp Complex Le 1e-12
3m1i_A219 Crystal Structure Of Yeast Crm1 (Xpo1p) In Complex 1e-12
4djt_A218 Crystal Structure Of A Nuclear Gtp-Binding Protein 3e-12
3rap_R167 The Small G Protein Rap2 In A Non Catalytic Complex 4e-12
1tx4_B177 RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 177 6e-12
1xcg_B178 Crystal Structure Of Human Rhoa In Complex With DhP 6e-12
3msx_A180 Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With 6e-12
1cxz_A182 Crystal Structure Of Human Rhoa Complexed With The 7e-12
3kz1_E182 Crystal Structure Of The Complex Of Pdz-Rhogef DhPH 7e-12
3lw8_A185 Shigella Ipgb2 In Complex With Human Rhoa, Gdp And 7e-12
1s1c_A183 Crystal Structure Of The Complex Between The Human 7e-12
3tvd_A193 Crystal Structure Of Mouse Rhoa-Gtp Complex Length 7e-12
1ow3_B193 Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With 8e-12
1x86_B196 Crystal Structure Of The DhPH DOMAINS OF LEUKEMIA-A 8e-12
1cc0_A190 Crystal Structure Of The Rhoa.Gdp-Rhogdi Complex Le 8e-12
1lb1_B192 Crystal Structure Of The Dbl And Pleckstrin Homolog 9e-12
4f38_A195 Crystal Structure Of Geranylgeranylated Rhoa In Com 9e-12
3pir_A183 Crystal Structure Of M-Rasd41e In Complex With Gppn 9e-12
1x1r_A178 Crystal Structure Of M-Ras In Complex With Gdp Leng 9e-12
3kkp_A183 Crystal Structure Of M-Ras P40d In Complex With Gpp 1e-11
3kko_A183 Crystal Structure Of M-Ras P40dD41EL51R IN COMPLEX 1e-11
1kmq_A184 Crystal Structure Of A Constitutively Activated Rho 5e-11
1z2c_A193 Crystal Structure Of Mdia1 Gbd-Fh3 In Complex With 7e-11
2gcn_A201 Crystal Structure Of The Human Rhoc-Gdp Complex Len 7e-11
2gco_A201 Crystal Structure Of The Human Rhoc-gppnhp Complex 7e-11
2gf0_A199 The Crystal Structure Of The Human Diras1 Gtpase In 8e-11
1xtq_A177 Structure Of Small Gtpase Human Rheb In Complex Wit 8e-11
2l0x_A169 Solution Structure Of The 21 Kda Gtpase Rheb Bound 9e-11
2j1l_A214 Crystal Structure Of Human Rho-Related Gtp-Binding 9e-11
3sea_A167 Structure Of Rheb-Y35a Mutant In Gdp- And Gmppnp-Bo 9e-11
3t5g_A181 Structure Of Fully Modified Farnesylated Rheb In Co 1e-10
2j0v_A212 The Crystal Structure Of Arabidopsis Thaliana Rac7- 4e-10
1dpf_A180 Crystal Structure Of A Mg-Free Form Of Rhoa Complex 4e-10
2nzj_A175 The Crystal Structure Of Rem1 In Complex With Gdp L 7e-10
3q72_A166 Crystal Structure Of Rad G-Domain-Gtp Analog Comple 7e-10
2dpx_A174 Crystal Structure Of Human Rad Gtpase Length = 174 7e-10
2gjs_A176 The Crystal Structure Of Human Rrad In Complex With 8e-10
2wbl_C180 Three-Dimensional Structure Of A Binary Rop-Prone C 2e-09
2fv8_A207 The Crystal Structure Of Rhob In The Gdp-Bound Stat 2e-09
2q3h_A201 The Crystal Structure Of Rhoua In The Gdp-bound Sta 4e-09
2yc2_C208 Intraflagellar Transport Complex 25-27 From Chlamyd 1e-08
2nty_C180 Rop4-Gdp-Prone8 Length = 180 1e-08
1mh1_A186 Small G-Protein Length = 186 3e-08
1g4u_R184 Crystal Structure Of The Salmonella Tyrosine Phosph 3e-08
2h7v_A188 Co-crystal Structure Of Ypka-rac1 Length = 188 3e-08
2g3y_A211 Crystal Structure Of The Human Small Gtpase Gem Len 3e-08
1hh4_A192 Rac1-Rhogdi Complex Involved In Nadph Oxidase Activ 3e-08
2ht6_A174 Crystal Structure Of Human Gem G-Domain Bound To Gd 3e-08
3ref_B194 Crystal Structure Of Ehrho1 Bound To Gdp And Magnes 4e-08
4dvg_A188 Crystal Structure Of E. Histolytica Formin1 Bound T 5e-08
2cjw_B192 Crystal Structure Of The Small Gtpase Gem (Gemdndca 5e-08
2cjw_A192 Crystal Structure Of The Small Gtpase Gem (Gemdndca 7e-08
2vrw_A184 Critical Structural Role For The Ph And C1 Domains 8e-08
2wkr_A332 Structure Of A Photoactivatable Rac1 Containing The 9e-08
2wkp_A332 Structure Of A Photoactivatable Rac1 Containing Lov 9e-08
2wkq_A332 Structure Of A Photoactivatable Rac1 Containing The 9e-08
1he1_C176 Crystal Structure Of The Complex Between The Gap Do 9e-08
3sua_A184 Crystal Structure Of The Intracellular Domain Of Pl 1e-07
1i4d_D192 Crystal Structure Analysis Of Rac1-Gdp Complexed Wi 1e-07
2fju_A178 Activated Rac1 Bound To Its Effector Phospholipase 1e-07
1foe_B177 Crystal Structure Of Rac1 In Complex With The Guani 1e-07
2yin_C196 Structure Of The Complex Between Dock2 And Rac1. Le 1e-07
4gzm_A204 Crystal Structure Of Rac1 F28l Mutant Length = 204 1e-07
3b13_B184 Crystal Structure Of The Dhr-2 Domain Of Dock2 In C 1e-07
3th5_A204 Crystal Structure Of Wild-Type Rac1 Length = 204 1e-07
3sbd_A187 Crystal Structure Of Rac1 P29s Mutant Length = 187 1e-07
3cbq_A195 Crystal Structure Of The Human Rem2 Gtpase With Bou 3e-07
3a58_B188 Crystal Structure Of Sec3p - Rho1p Complex From Sac 3e-07
2c2h_A192 Crystal Structure Of The Human Rac3 In Complex With 4e-07
2ic5_A180 Crystal Structure Of Human Rac3 Grown In The Presen 4e-07
2g0n_A179 The Crystal Structure Of The Human Rac3 In Complex 4e-07
3c5c_A187 Crystal Structure Of Human Ras-Like, Family 12 Prot 7e-07
3bwd_D182 Crystal Structure Of The Plant Rho Protein Rop5 Len 7e-07
1e96_A192 Structure Of The RacP67PHOX COMPLEX Length = 192 7e-07
1i4t_D192 Crystal Structure Analysis Of Rac1-Gmppnp In Comple 8e-07
3q85_A169 Crystal Structure Of Rem2 G-Domain -Gtp Analog Comp 8e-07
3ryt_C180 The Plexin A1 Intracellular Region In Complex With 8e-07
4aii_A180 Crystal Structure Of The Rat Rem2 Gtpase - G Domain 9e-07
4gzl_A204 Crystal Structure Of Rac1 Q61l Mutant Length = 204 9e-07
1m7b_A184 Crystal Structure Of Rnd3RHOE: FUNCTIONAL IMPLICATI 1e-06
2v55_B200 Mechanism Of Multi-site Phosphorylation From A Rock 1e-06
1gwn_A205 The Crystal Structure Of The Core Domain Of RhoeRND 1e-06
2rex_B197 Crystal Structure Of The Effector Domain Of Plxnb1 4e-06
2cls_A198 The Crystal Structure Of The Human Rnd1 Gtpase In T 4e-06
3q3j_B214 Crystal Structure Of Plexin A2 Rbd In Complex With 5e-06
1ryf_A203 Alternative Splicing Of Rac1 Generates Rac1b, A Sel 5e-06
2atx_A194 Crystal Structure Of The Tc10 Gppnhp Complex Length 7e-06
1ds6_A192 Crystal Structure Of A Rac-Rhogdi Complex Length = 8e-06
2w2t_A185 Rac2 (G12v) In Complex With Gdp Length = 185 9e-06
2w2v_A184 Rac2 (G12v) In Complex With Gtpgs Length = 184 9e-06
3pcr_B162 Structure Of Espg-Arf6 Complex Length = 162 1e-05
2a5d_A175 Structural Basis For The Activation Of Cholera Toxi 2e-05
1e0s_A174 Small G Protein Arf6-Gdp Length = 174 2e-05
4fme_C160 Espg-Rab1-Arf6 Complex Length = 160 2e-05
3n5c_A162 Crystal Structure Of Arf6delta13 Complexed With Gdp 2e-05
3lvr_E497 The Crystal Structure Of Asap3 In Complex With Arf6 3e-05
2a5g_A175 Cholera Toxin A1 Subunit Bound To Arf6(Q67l) Length 1e-04
2w83_A165 Crystal Structure Of The Arf6 Gtpase In Complex Wit 1e-04
3vhx_A172 The Crystal Structure Of Arf6-Mklp1 (Mitotic Kinesi 1e-04
3lrp_A181 Crystal Structure Of Plasmodium Falciparum Adp-Ribo 3e-04
1zd9_A188 Structure Of Human Adp-Ribosylation Factor-Like 10b 6e-04
1moz_A183 Adp-Ribosylation Factor-Like 1 (Arl1) From Saccharo 6e-04
3doe_A192 Complex Of Arl2 And Bart, Crystal Form 1 Length = 1 6e-04
2al7_A186 Structure Of Human Adp-Ribosylation Factor-Like 10c 6e-04
1mr3_F181 Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 7e-04
2k5u_A181 Solution Structure Of Myirstoylated Yeast Arf1 Prot 7e-04
3tjz_A164 Crystal Structure Of Arf1 Bound To The GammaZETA-Co 7e-04
1ksg_A186 Complex Of Arl2 And Pde Delta, Crystal Form 1 Lengt 8e-04
1ksh_A186 Complex Of Arl2 And Pde Delta, Crystal Form 2 (Nati 8e-04
>pdb|2A5J|A Chain A, Crystal Structure Of Human Rab2b Length = 191 Back     alignment and structure

Iteration: 1

Score = 255 bits (652), Expect = 1e-68, Method: Compositional matrix adjust. Identities = 119/136 (87%), Positives = 131/136 (96%) Query: 100 VEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTW 159 VEFGARM+ IDGKQIKLQIWDTAGQE+FRSITRSYYRGAAGALLVYDITRRETFNHLT+W Sbjct: 56 VEFGARMVNIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTSW 115 Query: 160 LEDARQHSNSNMVIMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEAF 219 LEDARQHS+SNMVIMLIGNKSDL++RR+VK+EEGE FAREHGL+FMETSAK A NVEEAF Sbjct: 116 LEDARQHSSSNMVIMLIGNKSDLESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAF 175 Query: 220 IDTAKEIYEKIQEGVF 235 I+TAKEIY KIQ+G+F Sbjct: 176 INTAKEIYRKIQQGLF 191
>pdb|1Z0A|A Chain A, Gdp-Bound Rab2a Gtpase Length = 174 Back     alignment and structure
>pdb|4DRZ|A Chain A, Crystal Structure Of Human Rab14 Length = 196 Back     alignment and structure
>pdb|1Z0F|A Chain A, Gdp-Bound Rab14 Gtpase Length = 179 Back     alignment and structure
>pdb|2BMD|A Chain A, High Resolution Structure Of Gdp-Bound Human Rab4a Length = 186 Back     alignment and structure
>pdb|2O52|A Chain A, Crystal Structure Of Human Rab4b In Complex With Gdp Length = 200 Back     alignment and structure
>pdb|1YU9|A Chain A, Gppnhp-Bound Rab4a Length = 175 Back     alignment and structure
>pdb|1Z0K|A Chain A, Structure Of Gtp-Bound Rab4q67l Gtpase In Complex With The Central Rab Binding Domain Of Rabenosyn-5 Length = 172 Back     alignment and structure
>pdb|2F9L|A Chain A, 3d Structure Of Inactive Human Rab11b Gtpase Length = 199 Back     alignment and structure
>pdb|1YZK|A Chain A, Gppnhp Bound Rab11 Gtpase Length = 184 Back     alignment and structure
>pdb|1OIV|A Chain A, X-Ray Structure Of The Small G Protein Rab11a In Complex With Gdp Length = 191 Back     alignment and structure
>pdb|2HV8|A Chain A, Crystal Structure Of Gtp-Bound Rab11 In Complex With Fip3 Length = 172 Back     alignment and structure
>pdb|1OIW|A Chain A, X-ray Structure Of The Small G Protein Rab11a In Complex With Gtpgammas Length = 191 Back     alignment and structure
>pdb|2D7C|A Chain A, Crystal Structure Of Human Rab11 In Complex With Fip3 Rab- Binding Domain Length = 167 Back     alignment and structure
>pdb|2GZD|A Chain A, Crystal Structure Of Rab11 In Complex With Rab11-Fip2 Length = 173 Back     alignment and structure
>pdb|3QBT|A Chain A, Crystal Structure Of Ocrl1 540-678 In Complex With Rab8a:gppnhp Length = 174 Back     alignment and structure
>pdb|2FU5|C Chain C, Structure Of Rab8 In Complex With Mss4 Length = 183 Back     alignment and structure
>pdb|3CPJ|B Chain B, Crystal Structure Of Ypt31 In Complex With Yeast Rab-Gdi Length = 223 Back     alignment and structure
>pdb|3TKL|A Chain A, Crystal Structure Of The Gtp-Bound Rab1a In Complex With The Coiled- Coil Domain Of Lida From Legionella Pneumophila Length = 196 Back     alignment and structure
>pdb|2OIL|A Chain A, Crystal Structure Of Human Rab25 In Complex With Gdp Length = 193 Back     alignment and structure
>pdb|3TSO|A Chain A, Structure Of The Cancer Associated Rab25 Protein In Complex With Fip2 Length = 178 Back     alignment and structure
>pdb|2HUP|A Chain A, Crystal Structure Of Human Rab43 In Complex With Gdp Length = 201 Back     alignment and structure
>pdb|3SFV|A Chain A, Crystal Structure Of The Gdp-Bound Rab1a S25n Mutant In Complex With The Coiled-Coil Domain Of Lida From Legionella Pneumophila Length = 181 Back     alignment and structure
>pdb|4FMB|B Chain B, Vira-Rab1 Complex Structure Length = 171 Back     alignment and structure
>pdb|4FMD|F Chain F, Espg-Rab1 Complex Structure At 3.05 A Length = 164 Back     alignment and structure
>pdb|4FMC|B Chain B, Espg-Rab1 Complex Length = 171 Back     alignment and structure
>pdb|2FOL|A Chain A, Crystal Structure Of Human Rab1a In Complex With Gdp Length = 191 Back     alignment and structure
>pdb|2RHD|A Chain A, Crystal Structure Of Cryptosporidium Parvum Small Gtpase Rab1a Length = 175 Back     alignment and structure
>pdb|3L0I|B Chain B, Complex Structure Of Sidm/drra With The Wild Type Rab1 Length = 199 Back     alignment and structure
>pdb|4I1O|A Chain A, Crystal Structure Of The Legionella Pneumophila Gap Domain Of Lepb In Complex With Rab1b Bound To Gdp And Bef3 Length = 181 Back     alignment and structure
>pdb|3JZA|A Chain A, Crystal Structure Of Human Rab1b In Complex With The Gef Domain Of DrraSIDM FROM LEGIONELLA PNEUMOPHILA Length = 175 Back     alignment and structure
>pdb|1G17|A Chain A, Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma)- Imidotriphosphate Length = 170 Back     alignment and structure
>pdb|2WWX|A Chain A, Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Rab1 (Gtpase Domain) Complex Length = 175 Back     alignment and structure
>pdb|3BFK|A Chain A, Crystal Structure Of Plasmodium Falciparum Rab11a In Complex With Gdp Length = 181 Back     alignment and structure
>pdb|2BCG|Y Chain Y, Structure Of Doubly Prenylated Ypt1:gdi Complex Length = 206 Back     alignment and structure
>pdb|1UKV|Y Chain Y, Structure Of Rabgdp-Dissociation Inhibitor In Complex With Prenylated Ypt1 Gtpase Length = 206 Back     alignment and structure
>pdb|1G16|A Chain A, Crystal Structure Of Sec4-Gdp Length = 170 Back     alignment and structure
>pdb|2EQB|A Chain A, Crystal Structure Of The Rab Gtpase Sec4p, The Sec2p Gef Domain, And Phosphate Complex Length = 174 Back     alignment and structure
>pdb|2G6B|A Chain A, Crystal Structure Of Human Rab26 In Complex With A Gtp Analogue Length = 180 Back     alignment and structure
>pdb|3CPH|A Chain A, Crystal Structure Of Sec4 In Complex With Rab-Gdi Length = 213 Back     alignment and structure
>pdb|1YZN|A Chain A, Gppnhp-Bound Ypt1p Gtpase Length = 185 Back     alignment and structure
>pdb|2OCY|C Chain C, Complex Of The Guanine Exchange Factor Sec2p And The Rab Gtpase Sec4p Length = 170 Back     alignment and structure
>pdb|2EW1|A Chain A, Crystal Structure Of Rab30 In Complex With A Gtp Analogue Length = 201 Back     alignment and structure
>pdb|3RWM|B Chain B, Crystal Structure Of Ypt32 In Complex With Gppnhp Length = 185 Back     alignment and structure
>pdb|1X3S|A Chain A, Crystal Structure Of Human Rab18 In Complex With Gppnhp Length = 195 Back     alignment and structure
>pdb|2EFC|B Chain B, Ara7-GdpATVPS9A Length = 181 Back     alignment and structure
>pdb|2IL1|A Chain A, Crystal Structure Of A Predicted Human Gtpase In Complex With Gdp Length = 192 Back     alignment and structure
>pdb|2HEI|A Chain A, Crystal Structure Of Human Rab5b In Complex With Gdp Length = 179 Back     alignment and structure
>pdb|1Z07|A Chain A, Gppnhp-Bound Rab5c G55q Mutant Gtpase Length = 166 Back     alignment and structure
>pdb|1HUQ|A Chain A, 1.8a Crystal Structure Of The Monomeric Gtpase Rab5c (Mouse) Length = 164 Back     alignment and structure
>pdb|1YZQ|A Chain A, Gppnhp-Bound Rab6 Gtpase Length = 170 Back     alignment and structure
>pdb|1Z0D|A Chain A, Gdp-bound Rab5c Gtpase Length = 167 Back     alignment and structure
>pdb|4DKX|A Chain A, Crystal Structure Of The Rab 6a'(Q72l) Length = 216 Back     alignment and structure
>pdb|1TU3|A Chain A, Crystal Structure Of Rab5 Complex With Rabaptin5 C-Terminal Domain Length = 171 Back     alignment and structure
>pdb|2Y8E|A Chain A, Crystal Structure Of D. Melanogaster Rab6 Gtpase Bound To Gmppnp Length = 179 Back     alignment and structure
>pdb|1N6I|A Chain A, Crystal Structure Of Human Rab5a A30p Mutant Complex With Gdp Length = 170 Back     alignment and structure
>pdb|1N6R|A Chain A, Crystal Structure Of Human Rab5a A30l Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1N6H|A Chain A, Crystal Structure Of Human Rab5a Length = 170 Back     alignment and structure
>pdb|1N6P|A Chain A, Crystal Structure Of Human Rab5a A30e Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1N6O|A Chain A, Crystal Structure Of Human Rab5a A30k Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1N6N|A Chain A, Crystal Structure Of Human Rab5a A30r Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|2GIL|A Chain A, Structure Of The Extremely Slow Gtpase Rab6a In The Gtp Bound Form At 1.8 Resolution Length = 162 Back     alignment and structure
>pdb|2FE4|A Chain A, The Crystal Structure Of Human Neuronal Rab6b In Its Inactive Gdp-Bound Form Length = 171 Back     alignment and structure
>pdb|3MJH|A Chain A, Crystal Structure Of Human Rab5a In Complex With The C2h2 Zinc Finger Of Eea1 Length = 168 Back     alignment and structure
>pdb|1TU4|A Chain A, Crystal Structure Of Rab5-Gdp Complex Length = 171 Back     alignment and structure
>pdb|3CWZ|A Chain A, Strucure Of Rab6(Gtp)-R6ip1 Complex Length = 188 Back     alignment and structure
>pdb|3BBP|A Chain A, Rab6-Gtp:gcc185 Rab Binding Domain Complex Length = 211 Back     alignment and structure
>pdb|3TW8|B Chain B, Gef Domain Of Dennd 1b In Complex With Rab Gtpase Rab35 Length = 181 Back     alignment and structure
>pdb|3DZ8|A Chain A, Crystal Structure Of Human Rab3b Gtpase Bound With Gdp Length = 191 Back     alignment and structure
>pdb|1YVD|A Chain A, Gppnhp-Bound Rab22 Gtpase Length = 169 Back     alignment and structure
>pdb|1D5C|A Chain A, Crystal Structure Of Plasmodium Falciparum Rab6 Complexed With Gdp Length = 162 Back     alignment and structure
>pdb|3RAB|A Chain A, Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 Back     alignment and structure
>pdb|2GF9|A Chain A, Crystal Structure Of Human Rab3d In Complex With Gdp Length = 189 Back     alignment and structure
>pdb|1Z0J|A Chain A, Structure Of Gtp-Bound Rab22q64l Gtpase In Complex With The Minimal Rab Binding Domain Of Rabenosyn-5 Length = 170 Back     alignment and structure
>pdb|1ZBD|A Chain A, Structural Basis Of Rab Effector Specificity: Crystal Structure Of The Small G Protein Rab3a Complexed With The Effector Domain Of Rabphilin-3a Length = 203 Back     alignment and structure
>pdb|1EK0|A Chain A, Gppnhp-Bound Ypt51 At 1.48 A Resolution Length = 170 Back     alignment and structure
>pdb|2FG5|A Chain A, Crystal Structure Of Human Rab31 In Complex With A Gtp Analogue Length = 192 Back     alignment and structure
>pdb|2P5S|A Chain A, Rab Domain Of Human Rasef In Complex With Gdp Length = 199 Back     alignment and structure
>pdb|4FMC|F Chain F, Espg-Rab1 Complex Length = 117 Back     alignment and structure
>pdb|1YZT|A Chain A, Gppnhp-Bound Rab21 Gtpase At 2.05 A Resolution Length = 184 Back     alignment and structure
>pdb|1YZU|A Chain A, Gppnhp-Bound Rab21 Gtpase At 2.50 A Resolution Length = 170 Back     alignment and structure
>pdb|1Z08|A Chain A, Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 Back     alignment and structure
>pdb|1Z06|A Chain A, Gppnhp-Bound Rab33 Gtpase Length = 189 Back     alignment and structure
>pdb|3BC1|A Chain A, Crystal Structure Of The Complex Rab27a-slp2a Length = 195 Back     alignment and structure
>pdb|2G77|B Chain B, Crystal Structure Of Gyp1 Tbc Domain In Complex With Rab33 Gtpase Bound To Gdp And Alf3 Length = 198 Back     alignment and structure
>pdb|2F7S|A Chain A, The Crystal Structure Of Human Rab27b Bound To Gdp Length = 217 Back     alignment and structure
>pdb|3CLV|A Chain A, Crystal Structure Of Rab5a From Plasmodium Falciparum, Pfb0500c Length = 208 Back     alignment and structure
>pdb|2IEZ|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 220 Back     alignment and structure
>pdb|1VG0|B Chain B, The Crystal Structures Of The Rep-1 Protein In Complex With Monoprenylated Rab7 Protein Length = 207 Back     alignment and structure
>pdb|2IF0|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 200 Back     alignment and structure
>pdb|1VG1|A Chain A, Gdp-bound Rab7 Length = 185 Back     alignment and structure
>pdb|3LAW|A Chain A, Structure Of Gtp-Bound L129f Mutant Rab7 Length = 207 Back     alignment and structure
>pdb|1WMS|A Chain A, High Resolution Crystal Structure Of Human Rab9 Gtpase: A Novel Antiviral Drug Target Length = 177 Back     alignment and structure
>pdb|1S8F|A Chain A, Crystal Structure Of Rab9 Complexed To Gdp Reveals A Dimer With An Active Conformation Of Switch Ii Length = 177 Back     alignment and structure
>pdb|2ZET|A Chain A, Crystal Structure Of The Small Gtpase Rab27b Complexed With The Slp Homology Domain Of Slac2-AMELANOPHILIN Length = 203 Back     alignment and structure
>pdb|2IEY|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Hexagonal Space Group Length = 195 Back     alignment and structure
>pdb|1YZL|A Chain A, Gppnhp-Bound Rab9 Gtpase Length = 179 Back     alignment and structure
>pdb|2FN4|A Chain A, The Crystal Structure Of Human Ras-Related Protein, Rras, In The Gdp- Bound State Length = 181 Back     alignment and structure
>pdb|2OCB|A Chain A, Crystal Structure Of Human Rab9b In Complex With A Gtp Analogue Length = 180 Back     alignment and structure
>pdb|1T91|A Chain A, Crystal Structure Of Human Small Gtpase Rab7(Gtp) Length = 207 Back     alignment and structure
>pdb|1Z22|A Chain A, Gdp-Bound Rab23 Gtpase Crystallized In C222(1) Space Group Length = 168 Back     alignment and structure
>pdb|2A78|A Chain A, Crystal Structure Of The C3bot-Rala Complex Reveals A Novel Type Of Action Of A Bacterial Exoenzyme Length = 187 Back     alignment and structure
>pdb|1UAD|A Chain A, Crystal Structure Of The Rala-gppnhp-sec5 Ral-binding Domain Complex Length = 175 Back     alignment and structure
>pdb|2BOV|A Chain A, Molecular Recognition Of An Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme By Rala Gtpase Length = 206 Back     alignment and structure
>pdb|1U8Y|A Chain A, Crystal Structures Of Ral-Gppnhp And Ral-Gdp Reveal Two Novel Binding Sites That Are Also Present In Ras And Rap Length = 168 Back     alignment and structure
>pdb|2KWI|A Chain A, Ralb-Rlip76 (Ralbp1) Complex Length = 178 Back     alignment and structure
>pdb|2KE5|A Chain A, Solution Structure And Dynamics Of The Small Gtpase Ralb In Its Active Conformation: Significance For Effector Protein Binding Length = 174 Back     alignment and structure
>pdb|2ERY|A Chain A, The Crystal Structure Of The Ras Related Protein Rras2 (Rras2) In The Gdp Bound State Length = 172 Back     alignment and structure
>pdb|1KY2|A Chain A, Gppnhp-Bound Ypt7p At 1.6 A Resolution Length = 182 Back     alignment and structure
>pdb|3BRW|D Chain D, Structure Of The Rap-Rapgap Complex Length = 167 Back     alignment and structure
>pdb|4DXA|A Chain A, Co-Crystal Structure Of Rap1 In Complex With Krit1 Length = 169 Back     alignment and structure
>pdb|1ZC3|A Chain A, Crystal Structure Of The Ral-Binding Domain Of Exo84 In Complex With The Active Rala Length = 175 Back     alignment and structure
>pdb|1C1Y|A Chain A, Crystal Structure Of Rap.Gmppnp In Complex With The Ras- Binding-Domain Of C-Raf1 Kinase (Rafrbd) Length = 167 Back     alignment and structure
>pdb|1GUA|A Chain A, Human Rap1a, Residues 1-167, Double Mutant (E30d,K31e) Complexed With Gppnhp And The Ras-Binding-Domain Of Human C-Raf1, Residues 51-131 Length = 167 Back     alignment and structure
>pdb|2CL0|X Chain X, Crystal Structure Analysis Of A Fluorescent Form Of H-Ras P21 In Complex With Gppnhp Length = 166 Back     alignment and structure
>pdb|4Q21|A Chain A, Molecular Switch For Signal Transduction: Structural Differences Between Active And Inactive Forms Of Protooncogenic Ras Proteins Length = 189 Back     alignment and structure
>pdb|1CLU|A Chain A, H-Ras Complexed With Diaminobenzophenone-Beta,Gamma-Imido- Gtp Length = 166 Back     alignment and structure
>pdb|1AGP|A Chain A, Three-Dimensional Structures And Properties Of A Transforming And A Nontransforming Gly-12 Mutant Of P21-H-Ras Length = 166 Back     alignment and structure
>pdb|3KKM|A Chain A, Crystal Structure Of H-Ras T35s In Complex With Gppnhp Length = 172 Back     alignment and structure
>pdb|4EFM|A Chain A, Crystal Structure Of H-Ras G12v In Complex With Gppnhp (State 1) Length = 171 Back     alignment and structure
>pdb|4EFL|A Chain A, Crystal Structure Of H-Ras Wt In Complex With Gppnhp (State 1) Length = 171 Back     alignment and structure
>pdb|2C5L|A Chain A, Structure Of Plc Epsilon Ras Association Domain With Hras Length = 173 Back     alignment and structure
>pdb|421P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|1JAH|A Chain A, H-Ras P21 Protein Mutant G12p, Complexed With Guanosine-5'- [beta,Gamma-Methylene] Triphosphate And Magnesium Length = 166 Back     alignment and structure
>pdb|1IAQ|A Chain A, C-H-Ras P21 Protein Mutant With Thr 35 Replaced By Ser (T35s) Complexed With Guanosine-5'-[b,G-Imido] Triphosphate Length = 166 Back     alignment and structure
>pdb|3K9N|A Chain A, Allosteric Modulation Of H-Ras Gtpase Length = 166 Back     alignment and structure
>pdb|1WQ1|R Chain R, Ras-Rasgap Complex Length = 166 Back     alignment and structure
>pdb|3LO5|A Chain A, Crystal Structure Of The Dominant Negative S17n Mutant Of Ras Length = 166 Back     alignment and structure
>pdb|1RVD|A Chain A, H-Ras Complexed With Diaminobenzophenone-Beta,Gamma-Imido- Gtp Length = 166 Back     alignment and structure
>pdb|3DDC|A Chain A, Crystal Structure Of Nore1a In Complex With Ras Length = 166 Back     alignment and structure
>pdb|1LFD|B Chain B, Crystal Structure Of The Active Ras Protein Complexed With The Ras-interacting Domain Of Ralgds Length = 167 Back     alignment and structure
>pdb|221P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|3V4F|A Chain A, H-Ras Peg 400CACL2, ORDERED OFF Length = 166 Back     alignment and structure
>pdb|6Q21|A Chain A, Molecular Switch For Signal Transduction: Structural Differences Between Active And Inactive Forms Of Protooncogenic Ras Proteins Length = 171 Back     alignment and structure
>pdb|2Q21|A Chain A, Crystal Structures At 2.2 Angstroms Resolution Of The Catalytic Domains Of Normal Ras Protein And An Oncogenic Mutant Complexed With Gsp Length = 171 Back     alignment and structure
>pdb|4EPR|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 Back     alignment and structure
>pdb|4EPX|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 Back     alignment and structure
>pdb|4EPT|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 Back     alignment and structure
>pdb|2HXS|A Chain A, Crystal Structure Of Rab28a Gtpase In The Inactive (Gdp-3'p- Bound) Form Length = 178 Back     alignment and structure
>pdb|3I3S|R Chain R, Crystal Structure Of H-Ras With Thr50 Replaced By Isoleucine Length = 166 Back     alignment and structure
>pdb|2QUZ|A Chain A, Crystal Structure Of The Activating H-Rask117r Mutant In Costello Syndrome, Bound To Mg-Gdp Length = 166 Back     alignment and structure
>pdb|4DSO|A Chain A, Small-Molecule Ligands Bind To A Distinct Pocket In Ras And Inhibit Sos-Mediated Nucleotide Exchange Activity Length = 189 Back     alignment and structure
>pdb|1LF0|A Chain A, Crystal Structure Of Rasa59g In The Gtp-Bound Form Length = 166 Back     alignment and structure
>pdb|2X1V|A Chain A, Crystal Structure Of The Activating H-Ras I163f Mutant In Costello Syndrome, Bound To Mg-Gdp Length = 166 Back     alignment and structure
>pdb|521P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|2RGB|A Chain A, Crystal Structure Of H-Rasq61k-Gppnhp Length = 166 Back     alignment and structure
>pdb|3CON|A Chain A, Crystal Structure Of The Human Nras Gtpase Bound With Gdp Length = 190 Back     alignment and structure
>pdb|621P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|1NVV|Q Chain Q, Structural Evidence For Feedback Activation By Rasgtp Of The Ras-specific Nucleotide Exchange Factor Sos Length = 166 Back     alignment and structure
>pdb|4EFN|A Chain A, Crystal Structure Of H-Ras Q61l In Complex With Gppnhp (State 1) Length = 171 Back     alignment and structure
>pdb|1XCM|A Chain A, Crystal Structure Of The Gppnhp-Bound H-Ras G60a Mutant Length = 167 Back     alignment and structure
>pdb|1XJ0|A Chain A, Crystal Structure Of The Gdp-Bound Form Of The Rasg60a Mutant Length = 166 Back     alignment and structure
>pdb|721P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|2RGC|A Chain A, Crystal Structure Of H-Rasq61v-Gppnhp Length = 166 Back     alignment and structure
>pdb|1ZVQ|A Chain A, Structure Of The Q61g Mutant Of Ras In The Gdp-Bound Form Length = 166 Back     alignment and structure
>pdb|2RGA|A Chain A, Crystal Structure Of H-Rasq61i-Gppnhp Length = 166 Back     alignment and structure
>pdb|2BKU|A Chain A, Kap95p:rangtp Complex Length = 177 Back     alignment and structure
>pdb|1ZW6|A Chain A, Crystal Structure Of The Gtp-Bound Form Of Rasq61g Length = 166 Back     alignment and structure
>pdb|1RRP|A Chain A, Structure Of The Ran-Gppnhp-Ranbd1 Complex Length = 204 Back     alignment and structure
>pdb|1WA5|A Chain A, Crystal Structure Of The Exportin Cse1p Complexed With Its Cargo (Kap60p) And Rangtp Length = 176 Back     alignment and structure
>pdb|1BYU|A Chain A, Canine Gdp-Ran Length = 216 Back     alignment and structure
>pdb|3GFT|A Chain A, Human K-Ras In Complex With A Gtp Analogue Length = 187 Back     alignment and structure
>pdb|1A2K|C Chain C, Gdpran-Ntf2 Complex Length = 216 Back     alignment and structure
>pdb|3EA5|A Chain A, Kap95p Binding Induces The Switch Loops Of Rangdp To Adopt The Gtp- Bound Conformation: Implications For Nuclear Import Complex Assembly Dynamics Length = 216 Back     alignment and structure
>pdb|1QG2|A Chain A, Canine Gdp-Ran R76e Mutant Length = 216 Back     alignment and structure
>pdb|3GJ0|A Chain A, Crystal Structure Of Human Rangdp Length = 221 Back     alignment and structure
>pdb|3GJ4|A Chain A, Crystal Structure Of Human Rangdp-Nup153znf3 Complex Length = 221 Back     alignment and structure
>pdb|2ERX|A Chain A, Crystal Structure Of Diras2 In Complex With Gdp And Inorganic Phosphate Length = 172 Back     alignment and structure
>pdb|1QBK|C Chain C, Structure Of The Karyopherin Beta2-ran Gppnhp Nuclear Transport Complex Length = 216 Back     alignment and structure
>pdb|1QG4|A Chain A, Canine Gdp-Ran F72y Mutant Length = 216 Back     alignment and structure
>pdb|3NBY|C Chain C, Crystal Structure Of The Pki Nes-Crm1-Rangtp Nuclear Export Complex Length = 176 Back     alignment and structure
>pdb|3NC1|C Chain C, Crystal Structure Of The Crm1-Rangtp Complex Length = 182 Back     alignment and structure
>pdb|3RAN|A Chain A, Canine Gdp-Ran Q69l Mutant Length = 216 Back     alignment and structure
>pdb|2ATV|A Chain A, The Crystal Structure Of Human Rerg In The Gdp Bound State Length = 196 Back     alignment and structure
>pdb|3OES|A Chain A, Crystal Structure Of The Small Gtpase Rhebl1 Length = 201 Back     alignment and structure
>pdb|3ICQ|B Chain B, Karyopherin Nuclear State Length = 171 Back     alignment and structure
>pdb|2X19|A Chain A, Crystal Structure Of Importin13 - Rangtp Complex Length = 172 Back     alignment and structure
>pdb|3M1I|A Chain A, Crystal Structure Of Yeast Crm1 (Xpo1p) In Complex With Yeas (Yrb1p) And Yeast Rangtp (Gsp1pgtp) Length = 219 Back     alignment and structure
>pdb|4DJT|A Chain A, Crystal Structure Of A Nuclear Gtp-Binding Protein From Encephalitozoon Cuniculi Bound To Gdp-Mg2+ Length = 218 Back     alignment and structure
>pdb|3RAP|R Chain R, The Small G Protein Rap2 In A Non Catalytic Complex With Gtp Length = 167 Back     alignment and structure
>pdb|1TX4|B Chain B, RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 177 Back     alignment and structure
>pdb|1XCG|B Chain B, Crystal Structure Of Human Rhoa In Complex With DhPH Fragment Of Pdzrhogef Length = 178 Back     alignment and structure
>pdb|3MSX|A Chain A, Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With Gap Domain Of Arhgap20 Length = 180 Back     alignment and structure
>pdb|1CXZ|A Chain A, Crystal Structure Of Human Rhoa Complexed With The Effector Domain Of The Protein Kinase PknPRK1 Length = 182 Back     alignment and structure
>pdb|3KZ1|E Chain E, Crystal Structure Of The Complex Of Pdz-Rhogef DhPH DOMAINS WITH GTP- Gamma-S Activated Rhoa Length = 182 Back     alignment and structure
>pdb|3LW8|A Chain A, Shigella Ipgb2 In Complex With Human Rhoa, Gdp And Mg2+ (Complex A) Length = 185 Back     alignment and structure
>pdb|1S1C|A Chain A, Crystal Structure Of The Complex Between The Human Rhoa And Rho-Binding Domain Of Human Rocki Length = 183 Back     alignment and structure
>pdb|3TVD|A Chain A, Crystal Structure Of Mouse Rhoa-Gtp Complex Length = 193 Back     alignment and structure
>pdb|1OW3|B Chain B, Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With Rhogap Length = 193 Back     alignment and structure
>pdb|1X86|B Chain B, Crystal Structure Of The DhPH DOMAINS OF LEUKEMIA-Associated Rhogef In Complex With Rhoa Length = 196 Back     alignment and structure
>pdb|1CC0|A Chain A, Crystal Structure Of The Rhoa.Gdp-Rhogdi Complex Length = 190 Back     alignment and structure
>pdb|1LB1|B Chain B, Crystal Structure Of The Dbl And Pleckstrin Homology Domains Of Dbs In Complex With Rhoa Length = 192 Back     alignment and structure
>pdb|4F38|A Chain A, Crystal Structure Of Geranylgeranylated Rhoa In Complex With Rhogdi In Its Active Gppnhp-Bound Form Length = 195 Back     alignment and structure
>pdb|3PIR|A Chain A, Crystal Structure Of M-Rasd41e In Complex With Gppnhp (Type 1) Length = 183 Back     alignment and structure
>pdb|1X1R|A Chain A, Crystal Structure Of M-Ras In Complex With Gdp Length = 178 Back     alignment and structure
>pdb|3KKP|A Chain A, Crystal Structure Of M-Ras P40d In Complex With Gppnhp Length = 183 Back     alignment and structure
>pdb|3KKO|A Chain A, Crystal Structure Of M-Ras P40dD41EL51R IN COMPLEX WITH GP Length = 183 Back     alignment and structure
>pdb|1KMQ|A Chain A, Crystal Structure Of A Constitutively Activated Rhoa Mutant (Q63l) Length = 184 Back     alignment and structure
>pdb|1Z2C|A Chain A, Crystal Structure Of Mdia1 Gbd-Fh3 In Complex With Rhoc- Gmppnp Length = 193 Back     alignment and structure
>pdb|2GCN|A Chain A, Crystal Structure Of The Human Rhoc-Gdp Complex Length = 201 Back     alignment and structure
>pdb|2GCO|A Chain A, Crystal Structure Of The Human Rhoc-gppnhp Complex Length = 201 Back     alignment and structure
>pdb|2GF0|A Chain A, The Crystal Structure Of The Human Diras1 Gtpase In The Inactive Gdp Bound State Length = 199 Back     alignment and structure
>pdb|1XTQ|A Chain A, Structure Of Small Gtpase Human Rheb In Complex With Gdp Length = 177 Back     alignment and structure
>pdb|2L0X|A Chain A, Solution Structure Of The 21 Kda Gtpase Rheb Bound To Gdp Length = 169 Back     alignment and structure
>pdb|2J1L|A Chain A, Crystal Structure Of Human Rho-Related Gtp-Binding Protein Rhod Length = 214 Back     alignment and structure
>pdb|3SEA|A Chain A, Structure Of Rheb-Y35a Mutant In Gdp- And Gmppnp-Bound Forms Length = 167 Back     alignment and structure
>pdb|3T5G|A Chain A, Structure Of Fully Modified Farnesylated Rheb In Complex With Pde6d Length = 181 Back     alignment and structure
>pdb|2J0V|A Chain A, The Crystal Structure Of Arabidopsis Thaliana Rac7-Rop9: The First Ras Superfamily Gtpase From The Plant Kingdom Length = 212 Back     alignment and structure
>pdb|1DPF|A Chain A, Crystal Structure Of A Mg-Free Form Of Rhoa Complexed With Gdp Length = 180 Back     alignment and structure
>pdb|2NZJ|A Chain A, The Crystal Structure Of Rem1 In Complex With Gdp Length = 175 Back     alignment and structure
>pdb|3Q72|A Chain A, Crystal Structure Of Rad G-Domain-Gtp Analog Complex Length = 166 Back     alignment and structure
>pdb|2DPX|A Chain A, Crystal Structure Of Human Rad Gtpase Length = 174 Back     alignment and structure
>pdb|2GJS|A Chain A, The Crystal Structure Of Human Rrad In Complex With Gdp Length = 176 Back     alignment and structure
>pdb|2WBL|C Chain C, Three-Dimensional Structure Of A Binary Rop-Prone Complex Length = 180 Back     alignment and structure
>pdb|2FV8|A Chain A, The Crystal Structure Of Rhob In The Gdp-Bound State Length = 207 Back     alignment and structure
>pdb|2Q3H|A Chain A, The Crystal Structure Of Rhoua In The Gdp-bound State Length = 201 Back     alignment and structure
>pdb|2YC2|C Chain C, Intraflagellar Transport Complex 25-27 From Chlamydomonas Length = 208 Back     alignment and structure
>pdb|2NTY|C Chain C, Rop4-Gdp-Prone8 Length = 180 Back     alignment and structure
>pdb|1MH1|A Chain A, Small G-Protein Length = 186 Back     alignment and structure
>pdb|1G4U|R Chain R, Crystal Structure Of The Salmonella Tyrosine Phosphatase And Gtpase Activating Protein Sptp Bound To Rac1 Length = 184 Back     alignment and structure
>pdb|2H7V|A Chain A, Co-crystal Structure Of Ypka-rac1 Length = 188 Back     alignment and structure
>pdb|2G3Y|A Chain A, Crystal Structure Of The Human Small Gtpase Gem Length = 211 Back     alignment and structure
>pdb|1HH4|A Chain A, Rac1-Rhogdi Complex Involved In Nadph Oxidase Activation Length = 192 Back     alignment and structure
>pdb|2HT6|A Chain A, Crystal Structure Of Human Gem G-Domain Bound To Gdp Length = 174 Back     alignment and structure
>pdb|3REF|B Chain B, Crystal Structure Of Ehrho1 Bound To Gdp And Magnesium Length = 194 Back     alignment and structure
>pdb|4DVG|A Chain A, Crystal Structure Of E. Histolytica Formin1 Bound To Ehrho1-Gtpgammas Length = 188 Back     alignment and structure
>pdb|2CJW|B Chain B, Crystal Structure Of The Small Gtpase Gem (Gemdndcam) In Complex To Mg.Gdp Length = 192 Back     alignment and structure
>pdb|2CJW|A Chain A, Crystal Structure Of The Small Gtpase Gem (Gemdndcam) In Complex To Mg.Gdp Length = 192 Back     alignment and structure
>pdb|2VRW|A Chain A, Critical Structural Role For The Ph And C1 Domains Of The Vav1 Exchange Factor Length = 184 Back     alignment and structure
>pdb|2WKR|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450m Mutant Length = 332 Back     alignment and structure
>pdb|2WKP|A Chain A, Structure Of A Photoactivatable Rac1 Containing Lov2 Wildtype Length = 332 Back     alignment and structure
>pdb|2WKQ|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450a Mutant Length = 332 Back     alignment and structure
>pdb|1HE1|C Chain C, Crystal Structure Of The Complex Between The Gap Domain Of The Pseudomonas Aeruginosa Exos Toxin And Human Rac Length = 176 Back     alignment and structure
>pdb|3SUA|A Chain A, Crystal Structure Of The Intracellular Domain Of Plexin-B1 In Complex With Rac1 Length = 184 Back     alignment and structure
>pdb|1I4D|D Chain D, Crystal Structure Analysis Of Rac1-Gdp Complexed With Arfaptin (P21) Length = 192 Back     alignment and structure
>pdb|2FJU|A Chain A, Activated Rac1 Bound To Its Effector Phospholipase C Beta 2 Length = 178 Back     alignment and structure
>pdb|1FOE|B Chain B, Crystal Structure Of Rac1 In Complex With The Guanine Nucleotide Exchange Region Of Tiam1 Length = 177 Back     alignment and structure
>pdb|2YIN|C Chain C, Structure Of The Complex Between Dock2 And Rac1. Length = 196 Back     alignment and structure
>pdb|4GZM|A Chain A, Crystal Structure Of Rac1 F28l Mutant Length = 204 Back     alignment and structure
>pdb|3B13|B Chain B, Crystal Structure Of The Dhr-2 Domain Of Dock2 In Complex With Rac1 (T17n Mutant) Length = 184 Back     alignment and structure
>pdb|3TH5|A Chain A, Crystal Structure Of Wild-Type Rac1 Length = 204 Back     alignment and structure
>pdb|3SBD|A Chain A, Crystal Structure Of Rac1 P29s Mutant Length = 187 Back     alignment and structure
>pdb|3CBQ|A Chain A, Crystal Structure Of The Human Rem2 Gtpase With Bound Gdp Length = 195 Back     alignment and structure
>pdb|3A58|B Chain B, Crystal Structure Of Sec3p - Rho1p Complex From Saccharomyces Cerevisiae Length = 188 Back     alignment and structure
>pdb|2C2H|A Chain A, Crystal Structure Of The Human Rac3 In Complex With Gdp Length = 192 Back     alignment and structure
>pdb|2IC5|A Chain A, Crystal Structure Of Human Rac3 Grown In The Presence Of Gpp(Nh)p. Length = 180 Back     alignment and structure
>pdb|2G0N|A Chain A, The Crystal Structure Of The Human Rac3 In Complex With Gdp And Chloride Length = 179 Back     alignment and structure
>pdb|3C5C|A Chain A, Crystal Structure Of Human Ras-Like, Family 12 Protein In Complex With Gdp Length = 187 Back     alignment and structure
>pdb|3BWD|D Chain D, Crystal Structure Of The Plant Rho Protein Rop5 Length = 182 Back     alignment and structure
>pdb|1E96|A Chain A, Structure Of The RacP67PHOX COMPLEX Length = 192 Back     alignment and structure
>pdb|1I4T|D Chain D, Crystal Structure Analysis Of Rac1-Gmppnp In Complex With Arfaptin Length = 192 Back     alignment and structure
>pdb|3Q85|A Chain A, Crystal Structure Of Rem2 G-Domain -Gtp Analog Complex Length = 169 Back     alignment and structure
>pdb|3RYT|C Chain C, The Plexin A1 Intracellular Region In Complex With Rac1 Length = 180 Back     alignment and structure
>pdb|4AII|A Chain A, Crystal Structure Of The Rat Rem2 Gtpase - G Domain Bound To Gdp Length = 180 Back     alignment and structure
>pdb|4GZL|A Chain A, Crystal Structure Of Rac1 Q61l Mutant Length = 204 Back     alignment and structure
>pdb|1M7B|A Chain A, Crystal Structure Of Rnd3RHOE: FUNCTIONAL IMPLICATIONS Length = 184 Back     alignment and structure
>pdb|2V55|B Chain B, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 200 Back     alignment and structure
>pdb|1GWN|A Chain A, The Crystal Structure Of The Core Domain Of RhoeRND3 - A Constitutively Activated Small G Protein Length = 205 Back     alignment and structure
>pdb|2REX|B Chain B, Crystal Structure Of The Effector Domain Of Plxnb1 Bound With Rnd1 Gtpase Length = 197 Back     alignment and structure
>pdb|2CLS|A Chain A, The Crystal Structure Of The Human Rnd1 Gtpase In The Active Gtp Bound State Length = 198 Back     alignment and structure
>pdb|3Q3J|B Chain B, Crystal Structure Of Plexin A2 Rbd In Complex With Rnd1 Length = 214 Back     alignment and structure
>pdb|1RYF|A Chain A, Alternative Splicing Of Rac1 Generates Rac1b, A Self-Activating Gtpase Length = 203 Back     alignment and structure
>pdb|2ATX|A Chain A, Crystal Structure Of The Tc10 Gppnhp Complex Length = 194 Back     alignment and structure
>pdb|1DS6|A Chain A, Crystal Structure Of A Rac-Rhogdi Complex Length = 192 Back     alignment and structure
>pdb|2W2T|A Chain A, Rac2 (G12v) In Complex With Gdp Length = 185 Back     alignment and structure
>pdb|2W2V|A Chain A, Rac2 (G12v) In Complex With Gtpgs Length = 184 Back     alignment and structure
>pdb|3PCR|B Chain B, Structure Of Espg-Arf6 Complex Length = 162 Back     alignment and structure
>pdb|2A5D|A Chain A, Structural Basis For The Activation Of Cholera Toxin By Human Arf6-Gtp Length = 175 Back     alignment and structure
>pdb|1E0S|A Chain A, Small G Protein Arf6-Gdp Length = 174 Back     alignment and structure
>pdb|4FME|C Chain C, Espg-Rab1-Arf6 Complex Length = 160 Back     alignment and structure
>pdb|3N5C|A Chain A, Crystal Structure Of Arf6delta13 Complexed With Gdp Length = 162 Back     alignment and structure
>pdb|3LVR|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Soaked With Calcium Length = 497 Back     alignment and structure
>pdb|2A5G|A Chain A, Cholera Toxin A1 Subunit Bound To Arf6(Q67l) Length = 175 Back     alignment and structure
>pdb|2W83|A Chain A, Crystal Structure Of The Arf6 Gtpase In Complex With A Specific Effector, Jip4 Length = 165 Back     alignment and structure
>pdb|3VHX|A Chain A, The Crystal Structure Of Arf6-Mklp1 (Mitotic Kinesin-Like Protein 1) Complex Length = 172 Back     alignment and structure
>pdb|3LRP|A Chain A, Crystal Structure Of Plasmodium Falciparum Adp-Ribosylation Factor 1 Length = 181 Back     alignment and structure
>pdb|1ZD9|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10b Length = 188 Back     alignment and structure
>pdb|1MOZ|A Chain A, Adp-Ribosylation Factor-Like 1 (Arl1) From Saccharomyces Cerevisiae Length = 183 Back     alignment and structure
>pdb|3DOE|A Chain A, Complex Of Arl2 And Bart, Crystal Form 1 Length = 192 Back     alignment and structure
>pdb|2AL7|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10c Length = 186 Back     alignment and structure
>pdb|1MR3|F Chain F, Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 (Scarf2) Complexed With Gdp-3'p At 1.6a Resolution Length = 181 Back     alignment and structure
>pdb|2K5U|A Chain A, Solution Structure Of Myirstoylated Yeast Arf1 Protein, Gdp- Bound Length = 181 Back     alignment and structure
>pdb|3TJZ|A Chain A, Crystal Structure Of Arf1 Bound To The GammaZETA-Cop Core Complex Length = 164 Back     alignment and structure
>pdb|1KSG|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 1 Length = 186 Back     alignment and structure
>pdb|1KSH|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 2 (Native) Length = 186 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query245
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 1e-90
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 8e-32
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 8e-90
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 1e-30
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 7e-89
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 3e-30
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 3e-86
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 9e-28
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 3e-86
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 2e-31
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 5e-86
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 8e-29
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 8e-86
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 1e-27
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 1e-85
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 2e-29
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 3e-85
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 5e-31
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 3e-85
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 1e-31
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 2e-84
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 2e-28
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 3e-84
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 4e-28
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 5e-84
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 3e-27
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 1e-83
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 1e-31
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 8e-83
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 2e-27
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 1e-82
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 2e-27
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 1e-82
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 3e-27
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 3e-82
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 1e-27
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 8e-82
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 4e-28
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 9e-82
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 4e-27
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 1e-81
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 2e-27
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 2e-81
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 4e-26
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 2e-81
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 1e-25
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 5e-81
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 1e-26
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 5e-81
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 8e-27
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 1e-80
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 2e-28
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 4e-80
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 1e-28
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 1e-79
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 9e-29
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 2e-79
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 6e-26
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 4e-79
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 6e-28
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 4e-79
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 2e-24
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 7e-79
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 2e-27
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 2e-78
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 5e-26
3bbp_A211 RAB-6, RAS-related protein RAB-6A; golgi complex, 2e-78
3bbp_A211 RAB-6, RAS-related protein RAB-6A; golgi complex, 3e-27
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 2e-78
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 1e-24
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 3e-78
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 3e-26
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 7e-77
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 7e-27
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 1e-75
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 7e-25
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 1e-74
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 2e-25
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 6e-74
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 7e-22
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 1e-69
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 4e-22
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 1e-69
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 2e-26
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 2e-69
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 1e-21
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 2e-65
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 9e-25
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 4e-64
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 1e-24
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 4e-62
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 1e-24
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 6e-62
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 2e-23
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 7e-62
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 5e-24
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 4e-61
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 1e-23
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 3e-60
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 4e-23
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 4e-60
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 4e-23
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 9e-60
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 1e-15
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 1e-59
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 2e-23
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 1e-58
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 4e-22
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 2e-57
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 5e-22
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 2e-57
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 2e-21
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 2e-55
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 1e-21
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 3e-55
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 7e-20
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 4e-55
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 4e-23
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 8e-55
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 5e-20
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 1e-54
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 1e-21
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 7e-54
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 4e-20
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 9e-54
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 6e-21
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 2e-53
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 1e-19
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 8e-53
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 4e-20
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 1e-52
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 2e-19
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 4e-51
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 1e-10
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 1e-46
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 2e-17
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 8e-43
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 6e-14
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 1e-42
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 8e-14
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 6e-34
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 9e-11
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 1e-30
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 7e-08
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 1e-29
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 6e-09
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 1e-29
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 3e-07
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 2e-28
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 9e-07
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 2e-28
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 6e-18
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 4e-28
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 8e-07
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 1e-27
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 1e-06
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 6e-27
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 3e-06
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 1e-25
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 4e-05
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 2e-25
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 1e-06
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 5e-25
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 5e-05
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 2e-23
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 6e-04
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 2e-23
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 6e-05
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 1e-20
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 2e-05
3t1o_A198 Gliding protein MGLA; G domain containing protein, 2e-14
3llu_A196 RAS-related GTP-binding protein C; structural geno 1e-10
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 7e-10
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 9e-10
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 1e-09
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 2e-09
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 3e-09
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 4e-09
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 5e-09
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 6e-09
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 1e-08
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 1e-08
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 2e-08
3o47_A329 ADP-ribosylation factor GTPase-activating protein 1e-07
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-07
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 1e-07
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 4e-07
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 2e-06
2ged_A193 SR-beta, signal recognition particle receptor beta 8e-05
1nrj_B218 SR-beta, signal recognition particle receptor beta 1e-04
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Length = 191 Back     alignment and structure
 Score =  264 bits (677), Expect = 1e-90
 Identities = 120/137 (87%), Positives = 132/137 (96%)

Query: 99  GVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTT 158
           GVEFGARM+ IDGKQIKLQIWDTAGQE+FRSITRSYYRGAAGALLVYDITRRETFNHLT+
Sbjct: 55  GVEFGARMVNIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTS 114

Query: 159 WLEDARQHSNSNMVIMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEA 218
           WLEDARQHS+SNMVIMLIGNKSDL++RR+VK+EEGE FAREHGL+FMETSAK A NVEEA
Sbjct: 115 WLEDARQHSSSNMVIMLIGNKSDLESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEA 174

Query: 219 FIDTAKEIYEKIQEGVF 235
           FI+TAKEIY KIQ+G+F
Sbjct: 175 FINTAKEIYRKIQQGLF 191


>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Length = 191 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Length = 186 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Length = 186 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Length = 200 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Length = 200 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Length = 179 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Length = 179 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Length = 223 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Length = 223 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Length = 193 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Length = 193 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Length = 191 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Length = 191 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Length = 199 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Length = 199 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Length = 206 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Length = 206 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Length = 196 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Length = 196 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 201 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 201 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 180 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 180 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Length = 201 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Length = 201 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Length = 203 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Length = 203 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Length = 183 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Length = 183 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} Length = 191 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} Length = 191 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Length = 199 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Length = 199 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Length = 189 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Length = 189 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Length = 181 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Length = 181 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Length = 181 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Length = 181 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Length = 170 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Length = 170 Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Length = 170 Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Length = 170 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Length = 192 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Length = 192 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Length = 170 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Length = 170 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Length = 170 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Length = 170 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 213 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 213 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Length = 195 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Length = 195 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Length = 217 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Length = 217 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Length = 192 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Length = 192 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Length = 195 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Length = 195 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Length = 199 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Length = 199 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Length = 208 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Length = 208 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Length = 179 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Length = 179 Back     alignment and structure
>3bbp_A RAB-6, RAS-related protein RAB-6A; golgi complex, GRIP domain, RAB GTPase, ARL GTPase, golgin, RAB effector, clAsp protein; HET: GTP; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>3bbp_A RAB-6, RAS-related protein RAB-6A; golgi complex, GRIP domain, RAB GTPase, ARL GTPase, golgin, RAB effector, clAsp protein; HET: GTP; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Length = 189 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Length = 189 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Length = 168 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Length = 168 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Length = 178 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Length = 178 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Length = 218 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Length = 218 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Length = 207 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Length = 207 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Length = 177 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Length = 177 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Length = 182 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Length = 182 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Length = 208 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Length = 208 Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 1qg4_A* 3ea5_A* 1qg2_A* 1byu_A* 3ran_A* 3gjx_C* ... Length = 221 Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 1qg4_A* 3ea5_A* 1qg2_A* 1byu_A* 3ran_A* 3gjx_C* ... Length = 221 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} Length = 169 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} Length = 169 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Length = 195 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Length = 195 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Length = 175 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Length = 175 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Length = 181 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Length = 181 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Length = 168 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Length = 168 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Length = 187 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Length = 187 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Length = 206 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Length = 206 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 170 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 170 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Length = 166 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Length = 166 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* Length = 181 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* Length = 181 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Length = 167 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Length = 167 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Length = 183 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Length = 183 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Length = 172 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Length = 172 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Length = 166 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Length = 166 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Length = 211 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Length = 211 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Length = 167 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Length = 167 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 196 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 196 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 199 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 199 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Length = 187 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Length = 187 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Length = 189 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Length = 189 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Length = 192 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Length = 192 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Length = 190 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Length = 190 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Length = 184 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Length = 184 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} Length = 184 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} Length = 184 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Length = 178 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Length = 178 Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Length = 535 Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Length = 535 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* Length = 194 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* Length = 194 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Length = 182 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Length = 182 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Length = 212 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Length = 212 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Length = 214 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Length = 214 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Length = 201 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Length = 201 Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Length = 255 Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Length = 255 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 207 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 207 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Length = 204 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Length = 204 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Length = 186 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Length = 186 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Length = 184 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Length = 184 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Length = 201 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Length = 201 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Length = 205 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Length = 205 Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Length = 214 Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Length = 214 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Length = 194 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Length = 194 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Length = 332 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Length = 332 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Length = 198 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Length = 196 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Length = 192 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Length = 171 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Length = 190 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Length = 189 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Length = 164 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Length = 186 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Length = 188 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 187 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Length = 181 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 183 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Length = 181 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Length = 329 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Length = 190 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Length = 198 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 307 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Length = 193 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 218 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query245
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.97
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.94
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.94
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.94
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.94
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.94
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.94
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.93
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.93
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.93
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.93
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.93
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.93
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.93
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.93
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.93
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.93
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.93
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.93
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.93
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.93
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.93
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.93
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.93
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.92
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.92
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.92
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.92
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.92
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.92
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.92
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.92
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.92
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.92
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.92
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.92
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.92
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.92
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.92
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.92
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.92
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.92
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.92
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.92
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.92
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.92
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.92
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.92
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.92
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.91
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.91
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.91
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.91
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.91
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.91
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.91
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.91
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.91
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.91
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.91
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.91
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.91
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.91
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.91
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.91
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.91
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.9
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.9
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.9
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.9
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.9
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.9
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.9
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.9
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.9
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.89
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.89
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.89
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.89
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.89
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.89
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.88
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.88
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.88
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.88
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.87
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.87
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.87
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.87
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.86
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.86
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.86
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.85
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.85
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.85
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 99.85
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.85
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.85
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.76
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.85
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.85
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.84
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.84
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.84
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.84
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 99.83
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 99.82
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 99.82
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 99.81
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.81
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 99.81
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.8
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.79
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.79
1u0l_A 301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.78
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.78
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.78
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.76
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.75
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.73
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.72
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.72
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.71
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.71
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.71
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.7
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.69
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.68
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.67
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.66
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.65
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.63
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.63
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.62
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.61
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.6
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 99.6
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.59
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 99.59
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.59
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.59
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.57
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.56
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 99.53
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 99.53
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.52
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 99.51
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.51
2yv5_A 302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.5
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.5
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 99.5
1wb1_A 482 Translation elongation factor SELB; selenocysteine 99.49
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.48
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 99.48
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 99.48
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 99.48
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.48
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.47
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.47
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.46
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 99.45
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 99.44
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 99.44
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 99.43
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.42
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 99.42
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.41
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 99.4
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 99.39
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.36
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.36
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 99.36
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.33
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 99.33
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 99.3
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 99.3
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.3
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.29
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.29
2ged_A193 SR-beta, signal recognition particle receptor beta 99.28
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 99.24
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 99.21
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 99.2
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.2
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.2
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.19
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.17
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.17
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.16
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.16
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 99.15
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.14
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.14
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.13
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 99.13
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.12
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.12
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 99.12
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.11
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.1
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.1
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.1
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.1
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.1
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.1
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.09
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 99.08
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.08
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.07
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 99.07
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.06
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.05
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.05
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.05
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.04
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.04
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.04
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.04
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.04
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.03
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.03
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.03
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.02
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.02
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.01
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.01
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.01
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.01
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.01
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.01
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.01
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.0
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.0
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.0
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 98.99
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 98.99
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 98.99
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 98.98
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 98.98
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 98.97
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 98.96
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 98.96
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 98.96
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 98.95
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 98.95
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 98.94
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 98.94
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 98.94
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 98.93
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 98.93
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 98.92
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 98.92
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 98.92
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 98.92
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 98.91
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 98.91
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 98.91
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 98.9
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 98.89
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 98.89
2wji_A165 Ferrous iron transport protein B homolog; membrane 98.89
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 98.88
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 98.87
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 98.87
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 98.86
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 98.86
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 98.84
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 98.83
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 98.83
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 98.83
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 98.83
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 98.82
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 98.81
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 98.78
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 98.76
1wxq_A 397 GTP-binding protein; structural genomics, riken st 98.74
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 98.74
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 98.71
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 98.69
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 98.67
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 98.66
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 98.64
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 98.64
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 98.63
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 98.63
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 98.61
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 98.6
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 98.6
2hf9_A226 Probable hydrogenase nickel incorporation protein 98.57
2www_A349 Methylmalonic aciduria type A protein, mitochondri 98.56
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 98.54
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 98.53
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 98.51
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 98.48
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 98.47
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 98.47
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 98.46
1jal_A363 YCHF protein; nucleotide-binding fold, structural 98.46
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 98.45
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 98.44
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 98.43
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 98.42
2hf9_A226 Probable hydrogenase nickel incorporation protein 98.42
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 98.41
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 98.38
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 98.38
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 98.38
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 98.38
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 98.35
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 98.31
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.31
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 98.3
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 98.29
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 98.28
3o47_A329 ADP-ribosylation factor GTPase-activating protein 98.27
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.27
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 98.27
1t9h_A 307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 98.24
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 98.23
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 98.22
3cnl_A262 YLQF, putative uncharacterized protein; circular p 98.22
3cnl_A 262 YLQF, putative uncharacterized protein; circular p 98.22
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 98.19
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 98.19
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 98.15
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 98.15
3iby_A256 Ferrous iron transport protein B; G protein, G dom 98.14
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 98.11
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 98.09
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 98.09
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 98.06
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 98.0
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 97.99
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 97.95
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 97.95
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 97.93
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 97.92
2rcn_A 358 Probable GTPase ENGC; YJEQ, circularly permuted, G 97.9
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 97.86
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 97.84
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 97.83
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 97.72
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 97.66
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 97.63
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 97.63
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 97.62
1nrj_B218 SR-beta, signal recognition particle receptor beta 97.53
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 97.53
1wb1_A 482 Translation elongation factor SELB; selenocysteine 97.48
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 97.44
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 97.43
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 97.41
4a9a_A 376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 97.35
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 97.35
2fh5_B214 SR-beta, signal recognition particle receptor beta 97.33
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 97.29
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 97.27
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 97.26
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 97.21
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 97.11
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 97.05
2elf_A370 Protein translation elongation factor 1A; tRNA, py 97.02
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 96.98
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 96.92
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 96.91
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 96.91
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 96.9
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 96.89
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 96.84
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 96.82
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 96.78
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 96.78
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 96.68
3lxx_A239 GTPase IMAP family member 4; structural genomics c 96.67
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 96.63
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 96.63
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 96.6
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 96.48
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 96.45
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 96.31
1f60_A458 Elongation factor EEF1A; protein-protein complex, 96.27
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 96.23
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 96.22
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 96.01
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 95.98
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 95.92
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 95.65
2www_A349 Methylmalonic aciduria type A protein, mitochondri 95.63
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 95.61
3lxw_A247 GTPase IMAP family member 1; immunity, structural 95.58
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 95.49
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 95.46
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 95.44
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 95.43
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 95.31
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 95.3
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 95.15
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 94.91
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 94.7
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 94.66
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 94.62
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 94.57
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 94.32
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 94.18
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 93.51
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 93.14
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 92.95
3llu_A196 RAS-related GTP-binding protein C; structural geno 92.94
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 92.89
1wxq_A397 GTP-binding protein; structural genomics, riken st 92.73
3cwq_A209 Para family chromosome partitioning protein; alpha 92.4
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 92.0
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 91.66
3end_A307 Light-independent protochlorophyllide reductase ir 91.56
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 89.7
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 89.42
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 89.4
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 89.13
3pg5_A361 Uncharacterized protein; structural genomics, PSI- 88.51
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 88.27
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 87.79
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 87.6
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 87.35
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 87.21
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 86.62
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 86.06
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 85.78
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 85.77
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 84.46
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 84.23
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 84.03
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 83.29
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 83.23
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 83.2
3vqt_A548 RF-3, peptide chain release factor 3; translation, 81.79
1jal_A363 YCHF protein; nucleotide-binding fold, structural 81.67
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
Probab=99.97  E-value=3.5e-31  Score=206.63  Aligned_cols=142  Identities=40%  Similarity=0.658  Sum_probs=122.2

Q ss_pred             CCCCCCCCCCcceeeEEEEEECCeEEEEEEEcCCChhhhhhhhHhhccCCcEEEEEEeCCChhhHHHHHHHHHHHHhhcC
Q psy13390         89 SGSSGSSSGGGVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSN  168 (245)
Q Consensus        89 ~~~~~~~~tig~~~~~~~~~~~~~~~~~~l~Dt~G~~~~~~~~~~~~~~~d~vi~v~d~~~~~s~~~~~~~~~~~~~~~~  168 (245)
                      .....|.||+|.++..+.+.+++..+.+.||||+|+++|+.+++.|+++++++++|||++++.||+.+..|+..+.....
T Consensus        37 ~f~~~~~~Tig~d~~~k~~~~~~~~v~l~iwDtaGqe~~~~l~~~~~~~a~~~ilv~di~~~~Sf~~i~~~~~~i~~~~~  116 (216)
T 4dkx_A           37 SFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGLERFRSLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERG  116 (216)
T ss_dssp             CCC----------CEEEEEECSSCEEEEEEECCSCTTTCGGGHHHHHTTCSEEEEEEETTCHHHHHTHHHHHHHHHHHHT
T ss_pred             CCCCCcCCccceEEEEEEEEecceEEEEEEEECCCchhhhhHHHHHhccccEEEEEeecchhHHHHHHHHHHHHHHHhcC
Confidence            34567899999999999999999999999999999999999999999999999999999999999999999999988877


Q ss_pred             CCCeEEEEEeCCCCccCcccCHHHHHHHHHHcCCcEEEeccCCCCCHHHHHHHHHHHHHHHH
Q psy13390        169 SNMVIMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEAFIDTAKEIYEKI  230 (245)
Q Consensus       169 ~~~piivv~nK~Dl~~~~~~~~~~~~~~~~~~~~~~~~~Sa~~~~~i~~~~~~i~~~i~~~~  230 (245)
                      +++|++|||||+|+...+.++.+++..++..+++++++|||++|.||+++|+++++.+....
T Consensus       117 ~~~piilVgNK~Dl~~~r~V~~~e~~~~a~~~~~~~~e~SAktg~nV~e~F~~i~~~i~~~~  178 (216)
T 4dkx_A          117 SDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGME  178 (216)
T ss_dssp             TSSEEEEEEECTTCGGGCCSCHHHHHHHHHHHTCEEEEEBTTTTBSHHHHHHHHHHHC----
T ss_pred             CCCeEEEEeeccchHhcCcccHHHHhhHHHHhCCeeEEEeCCCCcCHHHHHHHHHHHHHhhh
Confidence            88999999999999888899999999999999999999999999999999999999886543



>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 245
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 3e-40
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 8e-11
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 1e-37
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 6e-10
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 3e-36
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 9e-12
d2a5ja1173 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta 4e-35
d2a5ja1173 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta 2e-17
d1z0fa1166 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta 8e-35
d1z0fa1166 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta 1e-13
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 4e-33
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 6e-12
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 4e-33
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 2e-08
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 7e-33
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 4e-11
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 3e-32
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 2e-07
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 3e-32
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 2e-06
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 2e-31
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 5e-09
d2f7sa1186 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T 4e-30
d2f7sa1186 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T 1e-11
d1yzqa1164 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta 8e-27
d1yzqa1164 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta 1e-10
d1z08a1167 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T 1e-25
d1z08a1167 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T 2e-09
d1r2qa_170 c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 4e-25
d1r2qa_170 c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 2e-09
d1kaoa_167 c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 5e-23
d1kaoa_167 c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 2e-14
d1u8za_168 c.37.1.8 (A:) Ras-related protein RalA {Cotton-top 1e-21
d1u8za_168 c.37.1.8 (A:) Ras-related protein RalA {Cotton-top 4e-12
d1z0ja1167 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [ 7e-21
d1z0ja1167 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [ 4e-10
d1mh1a_183 c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 96 8e-21
d1mh1a_183 c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 96 1e-10
d2ngra_191 c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 1e-20
d2ngra_191 c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 8e-09
d1ek0a_170 c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces 2e-20
d1ek0a_170 c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces 1e-08
d1wmsa_174 c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 8e-20
d1wmsa_174 c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9e-09
d1e0sa_173 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 1e-19
d1e0sa_173 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 3e-06
d2fn4a1173 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [T 1e-19
d2fn4a1173 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [T 3e-11
d1moza_182 c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea 2e-19
d1moza_182 c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea 2e-06
d2erya1171 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [ 3e-19
d2erya1171 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [ 3e-11
d1z06a1165 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) 3e-19
d1z06a1165 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) 2e-09
d1ctqa_166 c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi 3e-19
d1ctqa_166 c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi 1e-09
d1c1ya_167 c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9e-19
d1c1ya_167 c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 1e-08
d1x1ra1169 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRa 2e-18
d1x1ra1169 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRa 8e-11
d2atxa1185 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [Tax 3e-18
d2atxa1185 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [Tax 5e-09
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 4e-18
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 8e-06
d1z2aa1164 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta 6e-17
d1z2aa1164 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta 2e-07
d1vg8a_184 c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId 3e-16
d1vg8a_184 c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId 7e-09
d1kmqa_177 c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9 5e-16
d1kmqa_177 c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9 9e-07
d1ky3a_175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 5e-16
d1ky3a_175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 5e-07
d2atva1168 c.37.1.8 (A:5-172) Ras-like estrogen-regulated gro 5e-16
d2atva1168 c.37.1.8 (A:5-172) Ras-like estrogen-regulated gro 1e-09
d1m7ba_179 c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [T 6e-16
d1m7ba_179 c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [T 7e-08
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 3e-15
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 2e-07
d2erxa1171 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [ 8e-15
d2erxa1171 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [ 9e-12
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 6e-14
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 3e-07
d1xtqa1167 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human 6e-13
d1xtqa1167 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human 1e-08
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 9e-13
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 2e-04
d1i2ma_170 c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 96 3e-12
d1i2ma_170 c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 96 3e-08
d2bmja1175 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {H 9e-12
d2bmja1175 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {H 6e-09
d2gjsa1168 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [Tax 2e-11
d2gjsa1168 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [Tax 1e-09
d2g3ya1172 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human 2e-11
d2g3ya1172 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human 2e-09
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 7e-11
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 1e-06
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 2e-10
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 8e-10
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 9e-07
d1zcba2200 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha sub 4e-08
d1f6ba_186 c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr 7e-07
d1svsa1195 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha sub 2e-06
d2bcjq2200 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha sub 4e-06
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab8a
species: Mouse (Mus musculus) [TaxId: 10090]
 Score =  134 bits (338), Expect = 3e-40
 Identities = 66/134 (49%), Positives = 99/134 (73%)

Query: 99  GVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTT 158
           G++F  R I +DGK+IKLQIWDTAGQE FR+IT +YYRGA G +LVYDIT  ++F+++  
Sbjct: 40  GIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRN 99

Query: 159 WLEDARQHSNSNMVIMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEA 218
           W+ +  +H+++++  M++GNK D++ +R+V KE GE  A ++G+ FMETSAK   NVE A
Sbjct: 100 WIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENA 159

Query: 219 FIDTAKEIYEKIQE 232
           F   A++I  K+ +
Sbjct: 160 FFTLARDIKAKMDK 173


>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Length = 167 Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Length = 167 Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Length = 169 Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Length = 169 Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 195 Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query245
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.96
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.95
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.95
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.95
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.95
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.94
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.94
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.94
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.94
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.94
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.94
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.93
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.93
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.92
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.92
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.92
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.91
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.91
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.91
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.9
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.86
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.86
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.86
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.85
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.83
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.76
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.69
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.68
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.65
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.62
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.6
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.59
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.58
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.54
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.53
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.52
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.47
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.47
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.46
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.45
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.45
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.45
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.43
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.43
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.41
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.4
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.4
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.4
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.39
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.39
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.39
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.39
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.38
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.38
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.37
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.37
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.36
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.36
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.35
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.35
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.34
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.32
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.3
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.3
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.29
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.28
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.28
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.26
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.21
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.19
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.13
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.12
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.11
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.11
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.09
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.09
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.09
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.06
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.05
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.05
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.02
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 98.98
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 98.97
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 98.97
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 98.91
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 98.86
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 98.8
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 98.79
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 98.76
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 98.75
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 98.75
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.66
d1nrjb_209 Signal recognition particle receptor beta-subunit 98.59
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 98.58
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.53
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.51
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.51
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 98.48
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 98.4
d1u0la2 225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.39
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.35
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 98.32
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 98.23
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 98.13
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.11
d1t9ha2 231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 98.11
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 98.01
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 97.99
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 97.92
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 97.92
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 97.84
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 97.8
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 97.74
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 97.74
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 97.67
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 97.63
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 97.47
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 97.36
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 97.23
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 96.94
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 96.64
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 96.54
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.49
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 96.36
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 96.18
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 95.8
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 95.29
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 95.2
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.08
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 94.05
d1okkd2207 GTPase domain of the signal recognition particle r 94.04
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 93.68
d2qy9a2211 GTPase domain of the signal recognition particle r 93.48
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 92.77
d1j8yf2211 GTPase domain of the signal sequence recognition p 90.88
d1vmaa2213 GTPase domain of the signal recognition particle r 90.69
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 89.27
d1ls1a2207 GTPase domain of the signal sequence recognition p 89.18
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 88.46
d2fh5b1207 Signal recognition particle receptor beta-subunit 88.23
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 87.81
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 87.76
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 83.94
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 82.89
d1nrjb_209 Signal recognition particle receptor beta-subunit 82.38
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 80.88
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rad
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96  E-value=7.4e-28  Score=179.21  Aligned_cols=138  Identities=28%  Similarity=0.418  Sum_probs=114.1

Q ss_pred             CCCCCcceeeEEEEEECCeEEEEEEEcCCChhhhhhhhHhhccCCcEEEEEEeCCChhhHHHHHHHHHHHHhhcC-CCCe
Q psy13390         94 SSSGGGVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSN-SNMV  172 (245)
Q Consensus        94 ~~~tig~~~~~~~~~~~~~~~~~~l~Dt~G~~~~~~~~~~~~~~~d~vi~v~d~~~~~s~~~~~~~~~~~~~~~~-~~~p  172 (245)
                      +.||.+.++ ...+.+++..+.+.+|||+|++.+..++..+++++|++++|||++++.|++.+..|+..+..... ..+|
T Consensus        29 ~~~~~~~~~-~~~i~~~~~~~~l~i~D~~g~e~~~~~~~~~~~~~d~~ilv~d~t~~~s~~~~~~~~~~i~~~~~~~~~p  107 (168)
T d2gjsa1          29 EAEAAGHTY-DRSIVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVP  107 (168)
T ss_dssp             -----CEEE-EEEEEETTEEEEEEEEECC-------CHHHHHTSCSEEEEEEETTCHHHHHHHHHHHHHHHHHCC--CCC
T ss_pred             cCCeeeeee-cceeeccccccceeeeecccccccceecccchhhhhhhceeccccccccccccccccchhhcccccccce
Confidence            345565555 56778899999999999999999999999999999999999999999999999999999877653 6789


Q ss_pred             EEEEEeCCCCccCcccCHHHHHHHHHHcCCcEEEeccCCCCCHHHHHHHHHHHHHHHHhc
Q psy13390        173 IMLIGNKSDLDARREVKKEEGEVFAREHGLVFMETSAKLATNVEEAFIDTAKEIYEKIQE  232 (245)
Q Consensus       173 iivv~nK~Dl~~~~~~~~~~~~~~~~~~~~~~~~~Sa~~~~~i~~~~~~i~~~i~~~~~~  232 (245)
                      +++||||+|+...++++..++..++..+++++++|||++|.||+++|.++++.+..++++
T Consensus       108 iilvgnK~Dl~~~~~v~~~~~~~~~~~~~~~~~e~Sak~~~~v~~~f~~l~~~i~~~~~~  167 (168)
T d2gjsa1         108 IILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDS  167 (168)
T ss_dssp             EEEEEECTTCGGGCCSCHHHHHHHHHHHTSEEEECBTTTTBSHHHHHHHHHHHHHHHHHH
T ss_pred             EEEeecccchhhhcchhHHHHHHHHHhcCCEEEEEeCCCCcCHHHHHHHHHHHHHHHhhC
Confidence            999999999988888999999999999999999999999999999999999998776643



>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure