Psyllid ID: psy1340
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 51 | ||||||
| 345497419 | 2064 | PREDICTED: hypothetical protein LOC10011 | 0.921 | 0.022 | 0.808 | 5e-16 | |
| 307213135 | 2046 | Contactin-associated protein-like 2 [Har | 0.921 | 0.022 | 0.808 | 5e-16 | |
| 332019922 | 2026 | Neurexin-4 [Acromyrmex echinatior] | 0.921 | 0.023 | 0.808 | 6e-16 | |
| 383852936 | 1951 | PREDICTED: uncharacterized protein LOC10 | 0.921 | 0.024 | 0.808 | 7e-16 | |
| 307184317 | 1984 | Contactin associated protein like 5-1 [C | 0.921 | 0.023 | 0.808 | 7e-16 | |
| 380015075 | 1897 | PREDICTED: neurexin-4-like [Apis florea] | 0.921 | 0.024 | 0.808 | 8e-16 | |
| 328780915 | 1917 | PREDICTED: axotactin [Apis mellifera] | 0.921 | 0.024 | 0.808 | 8e-16 | |
| 442630275 | 2047 | axotactin, isoform I [Drosophila melanog | 0.882 | 0.021 | 0.822 | 9e-16 | |
| 442630269 | 2147 | axotactin, isoform F [Drosophila melanog | 0.882 | 0.020 | 0.822 | 9e-16 | |
| 386770608 | 2070 | axotactin, isoform D [Drosophila melanog | 0.882 | 0.021 | 0.822 | 9e-16 |
| >gi|345497419|ref|XP_003427983.1| PREDICTED: hypothetical protein LOC100115644 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 88.6 bits (218), Expect = 5e-16, Method: Composition-based stats.
Identities = 38/47 (80%), Positives = 43/47 (91%)
Query: 2 YEGELCDIYTATILTLRGASYVSYRVYDWKDRVHSSQNRISVQFKLQ 48
YEGE CD+YTATILTLRG+SYVS+RVYDWKDRVHSS NRIS+ FK +
Sbjct: 422 YEGERCDVYTATILTLRGSSYVSFRVYDWKDRVHSSVNRISLAFKTK 468
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307213135|gb|EFN88657.1| Contactin-associated protein-like 2 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|332019922|gb|EGI60382.1| Neurexin-4 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|383852936|ref|XP_003701981.1| PREDICTED: uncharacterized protein LOC100875110 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|307184317|gb|EFN70775.1| Contactin associated protein like 5-1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|380015075|ref|XP_003691537.1| PREDICTED: neurexin-4-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328780915|ref|XP_394721.4| PREDICTED: axotactin [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|442630275|ref|NP_524656.5| axotactin, isoform I [Drosophila melanogaster] gi|440215312|gb|AAF47929.5| axotactin, isoform I [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|442630269|ref|NP_001261422.1| axotactin, isoform F [Drosophila melanogaster] gi|440215309|gb|AGB94117.1| axotactin, isoform F [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|386770608|ref|NP_001246632.1| axotactin, isoform D [Drosophila melanogaster] gi|442630273|ref|NP_001261424.1| axotactin, isoform H [Drosophila melanogaster] gi|383291766|gb|AFH04303.1| axotactin, isoform D [Drosophila melanogaster] gi|440215311|gb|AGB94119.1| axotactin, isoform H [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 51 | ||||||
| FB|FBgn0262870 | 1685 | axo "axotactin" [Drosophila me | 0.862 | 0.026 | 0.711 | 2.2e-10 |
| FB|FBgn0262870 axo "axotactin" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 162 (62.1 bits), Expect = 2.2e-10, P = 2.2e-10
Identities = 32/45 (71%), Positives = 36/45 (80%)
Query: 2 YEGELCDIYTATILTLRGASYVSYRVYDWKDRVHSSQNRISVQFK 46
YEGE YT I+TLRGASYVSYR+YDWKDRVHSS RIS+ F+
Sbjct: 469 YEGEALRHYTH-IITLRGASYVSYRIYDWKDRVHSSTRRISLMFR 512
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.323 0.134 0.403 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 51 51 0.00091 102 3 11 22 0.35 27
29 0.44 26
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 460 (49 KB)
Total size of DFA: 83 KB (2065 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 5.23u 0.09s 5.32t Elapsed: 00:00:17
Total cpu time: 5.23u 0.09s 5.32t Elapsed: 00:00:17
Start: Thu Aug 15 14:44:25 2013 End: Thu Aug 15 14:44:42 2013
|
|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 51 | |||
| KOG3514|consensus | 1591 | 91.26 | ||
| cd00110 | 151 | LamG Laminin G domain; Laminin G-like domains are | 88.95 | |
| KOG3516|consensus | 1306 | 85.52 | ||
| cd07279 | 112 | PX_SNX20_21_like The phosphoinositide binding Phox | 80.8 | |
| PF07067 | 236 | DUF1340: Protein of unknown function (DUF1340); In | 80.43 |
| >KOG3514|consensus | Back alignment and domain information |
|---|
Probab=91.26 E-value=0.28 Score=42.73 Aligned_cols=46 Identities=20% Similarity=0.468 Sum_probs=39.5
Q ss_pred Cccceecee-eeeEEEEecceeeEEEEeecccccccccceeEEEEEecc
Q psy1340 2 YEGELCDIY-TATILTLRGASYVSYRVYDWKDRVHSSQNRISVQFKLQN 49 (51)
Q Consensus 2 YEge~Cd~y-taT~ltLRG~sYVsyrvydwkdrvhs~~nRiSl~Fkt~~ 49 (51)
|.|+.|++- ..-+.|.+|..|++|-+- .+-+.|+..-|+|.|||.|
T Consensus 239 ~dgq~cekeK~~~eaTF~G~ef~~YDls--~npI~s~~d~itl~FrT~q 285 (1591)
T KOG3514|consen 239 HDGQNCEKEKNDGEATFGGDEFVGYDLS--QNPIRSKKDNITLTFRTVQ 285 (1591)
T ss_pred cCccccccccCcceEEecCceEEEeecc--CCcccccccceEEEEEEec
Confidence 678889885 457899999999999875 3688999999999999986
|
|
| >cd00110 LamG Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans | Back alignment and domain information |
|---|
| >KOG3516|consensus | Back alignment and domain information |
|---|
| >cd07279 PX_SNX20_21_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 20 and 21 | Back alignment and domain information |
|---|
| >PF07067 DUF1340: Protein of unknown function (DUF1340); InterPro: IPR009774 This family consists of several hypothetical Streptococcus thermophilus bacteriophage proteins of around 235 residues in length | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 51 | |||
| 2r1d_A | 226 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 6e-05 | |
| 3bod_A | 178 | Neurexin-1-alpha; neurexin1D, LNS6, alternative sp | 1e-04 | |
| 2h0b_A | 184 | Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A | 3e-04 |
| >2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Length = 226 | Back alignment and structure |
|---|
Score = 36.9 bits (85), Expect = 6e-05
Identities = 7/46 (15%), Positives = 18/46 (39%), Gaps = 1/46 (2%)
Query: 1 MYEGELCDIYTATILTLRGASYVSYRVYDWKDRVHSSQNRISVQFK 46
T + +G ++Y+ + DR + +R+++ F
Sbjct: 28 SPASLRGGHAGTTYIFSKGGGQITYK-WPPNDRPSTRADRLAIGFS 72
|
| >3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Length = 178 | Back alignment and structure |
|---|
| >2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 51 | |||
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 97.45 | |
| 1pz7_A | 204 | Agrin; structural protein; 1.42A {Gallus gallus} S | 97.33 | |
| 2r1d_A | 226 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 97.0 | |
| 3v64_A | 191 | Low-density lipoprotein receptor-related protein; | 96.87 | |
| 2r16_A | 182 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sp | 96.59 | |
| 2h0b_A | 184 | Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A | 96.18 | |
| 2r1b_A | 220 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 96.06 | |
| 3sh4_A | 195 | LG3 peptide; actin disassambly, integrin alpha12 B | 96.04 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 95.98 | |
| 3pve_A | 189 | Agrin, AGRN protein; mRNA splicing, structural gen | 95.49 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 95.48 | |
| 3bod_A | 178 | Neurexin-1-alpha; neurexin1D, LNS6, alternative sp | 95.11 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 93.7 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 93.13 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 92.89 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 91.32 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 90.79 | |
| 1d2s_A | 170 | SHBG, sex hormone-binding globulin; steroid transp | 81.81 | |
| 1qwr_A | 319 | Mannose-6-phosphate isomerase; structural genomics | 81.55 |
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
Probab=97.45 E-value=7.7e-05 Score=56.76 Aligned_cols=46 Identities=26% Similarity=0.569 Sum_probs=30.7
Q ss_pred Cccceece-eeeeEEEEecceeeEEEEeecccccccccceeEEEEEecc
Q psy1340 2 YEGELCDI-YTATILTLRGASYVSYRVYDWKDRVHSSQNRISVQFKLQN 49 (51)
Q Consensus 2 YEge~Cd~-ytaT~ltLRG~sYVsyrvydwkdrvhs~~nRiSl~Fkt~~ 49 (51)
|+|++|+. ..+.+++..|++|+.|+.. ++.+++..+.|+|.|||.+
T Consensus 220 ~~G~~Ce~~~~~~~~~F~G~~~~~y~~~--~~~~~~~~~~i~l~FrT~~ 266 (1245)
T 3qcw_A 220 FRGKDCSQGKEEYIATFKGSEYFCYDLS--QNPIQSSSDEITLSFKTLQ 266 (1245)
T ss_dssp -----------CCEEEECSSCEEEEECT--TSCEEESEEEEEEEEECSC
T ss_pred ccCCccccCcccceeeeCCcEEEEEccc--cCcccccccEEEEEEEeCC
Confidence 89999996 4578899999999999975 4567788899999999964
|
| >1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A | Back alignment and structure |
|---|
| >2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* | Back alignment and structure |
|---|
| >3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A | Back alignment and structure |
|---|
| >2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} | Back alignment and structure |
|---|
| >2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} | Back alignment and structure |
|---|
| >2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* | Back alignment and structure |
|---|
| >3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* | Back alignment and structure |
|---|
| >1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 51 | |||
| d2r1da1 | 177 | Ligand-binding domain of neurexin 1beta {Rat (Ratt | 97.73 | |
| d1h30a2 | 218 | Growth-arrest-specific protein Gas6 {Human (Homo s | 91.62 | |
| d1dyka2 | 185 | Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: | 88.36 | |
| d1pz7a_ | 195 | Agrin {Chicken (Gallus gallus) [TaxId: 9031]} | 86.32 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 84.68 | |
| d1d2sa_ | 170 | Sex hormone-binding globulin {Human (Homo sapiens) | 84.18 | |
| d1dyka1 | 189 | Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: | 84.18 |
| >d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Concanavalin A-like lectins/glucanases superfamily: Concanavalin A-like lectins/glucanases family: Laminin G-like module domain: Ligand-binding domain of neurexin 1beta species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=97.73 E-value=2.1e-05 Score=45.16 Aligned_cols=37 Identities=19% Similarity=0.452 Sum_probs=30.9
Q ss_pred eeEEEEecceeeEEEEeecccccccccceeEEEEEecc
Q psy1340 12 ATILTLRGASYVSYRVYDWKDRVHSSQNRISVQFKLQN 49 (51)
Q Consensus 12 aT~ltLRG~sYVsyrvydwkdrvhs~~nRiSl~Fkt~~ 49 (51)
+|.+..+|.+|++|+ +.+.++..+...+||+.|||.+
T Consensus 4 ~t~~F~~g~~~i~y~-~~~~~~~~~~~~~is~~FrT~~ 40 (177)
T d2r1da1 4 TTYIFSKGGGQITYK-WPPNDRPSTRADRLAIGFSTVQ 40 (177)
T ss_dssp SEEEEEEEEEEEEEE-CCGGGCCCBSEEEEEEEEECCC
T ss_pred ccEEeCCCCeEEEEE-CCCccCCCccccEEEEEEEeCC
Confidence 566777999999998 5566777788889999999975
|
| >d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|