Psyllid ID: psy13500

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390------
MNDILMSRACGNCTSKGVCKGDTIVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVCKGDTIVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVTQCPILEGNVFRYKFLADAAGTYFWHSHDGFQKMDGIIGNLIIRQPRTSDPNSRYYEYDNPSHVVLVTDWYHNTTSDERWPGLRLHDVGQLPDTFLINGKGSYPVKGERYDFVIETSKAVSSYWIHIKGLGPCEDNKPFQLGVLKYDGSLFQKPPSSNPGYKGYPVNRIFNRPNADCNPDNTSNVCISHLNNKDFVKPVLLAKKPDVFNRPNADCNPDNTSNVCISHLNNKDFVKPVLLSKKPDVRILLAPGFYNYKLPEVFQPDTYPRHVGKWCLFQQELMVPTPRGFPRCGDFLND
ccccccccccccccccccccccEEEEEEccccccccEEEEEccEEEcccccccccEEEEcccEEEEEEEEcccccccEEEEccccccccccccccccccccccccccEEEEEEEccccccEEEccccccccccccEEEEEEEcccccccccccccccccccEEEEccccccccccccccccccccccccccEEEEccccccccccccEEEEEEEcccccEEEEEEEEcccccccccEEEEEEEEcccccccccccccccccccEEEEEccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccEEEccccccccccccccccccccccccEEEEcccccccccccccccc
ccHHHHHHHHHHHHHHHHccccEEEEccccccccccEcEEEEcccccccHHHccEEEEEcccEEEEEEEEccccccEcEEEEcccccccHHHcccEcccEccEccccEEEEEEEccccEEEEEEEccccHHHHccEEEEEEEccccccccccccccccccEEEEEcHHHcccHHHHHHHHHcccccccccccEEEcccccccccccEEEEEEEEEcccccEEEEEEccccEEEEccccEEEEEEccEEcccccEEEEEEEEEcccEEEEEEEcccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccEEEEEEEcEEEEcccccccccccccccc
mndilmsracgnctskgvckgdTIVVDLhnkmpgrsttihwhgltqrltphmdgvpmvckgDTIVVDlhnkmpgrsttihwhgltqrltphmdgvpmvtqcpilegnvfRYKFLADAagtyfwhshdgfqkMDGIIGNliirqprtsdpnsryyeydnpshVVLVTDWyhnttsderwpglrlhdvgqlpdtflingkgsypvkgerydFVIETSKAVSSYWIhikglgpcednkpfqlgvlkydgslfqkppssnpgykgypvnrifnrpnadcnpdntsnvcishlnnkdfvkpvllakkpdvfnrpnadcnpdntsnvcishlnnkdfvkpvllskkpdvrillapgfynyklpevfqpdtyprhvgkwclfqqelmvptprgfprcgdflnd
mndilmsracgnctskgvckGDTIVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVCKGDTIVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVTQCPILEGNVFRYKFLADAAGTYFWHSHDGFQKMDGIIGNLIIRQPRTSDPNSRYYEYDNPSHVVLVTDWYHNTTSDERWPGLRLHDVGQLPDTflingkgsypvkGERYDFVIETSKAVSSYWIHIKGLGPCEDNKPFQLGVLKYDGSLFQKPPSSNPGYKGYPVNRIFNRPNADCNPDNTSNVCISHLNNKDFVKPVLLAKKPDVFNRPNADCNPDNTSNVCISHLNNKDFVKPVLLSKKPDVRILLAPGFYNYKLPEVFQPDTYPRHVGKWCLFQQelmvptprgfprcgdflnd
MNDILMSRACGNCTSKGVCKGDTIVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVCKGDTIVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVTQCPILEGNVFRYKFLADAAGTYFWHSHDGFQKMDGIIGNLIIRQPRTSDPNSRYYEYDNPSHVVLVTDWYHNTTSDERWPGLRLHDVGQLPDTFLINGKGSYPVKGERYDFVIETSKAVSSYWIHIKGLGPCEDNKPFQLGVLKYDGSLFQKPPSSNPGYKGYPVNRIFNRPNADCNPDNTSNVCISHLNNKDFVKPVLLAKKPDVFNRPNADCNPDNTSNVCISHLNNKDFVKPVLLSKKPDVRILLAPGFYNYKLPEVFQPDTYPRHVGKWCLFQQELMVPTPRGFPRCGDFLND
*****MSRACGNCTSKGVCKGDTIVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVCKGDTIVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVTQCPILEGNVFRYKFLADAAGTYFWHSHDGFQKMDGIIGNLIIRQP******SRYYEYDNPSHVVLVTDWYHNTTSDERWPGLRLHDVGQLPDTFLINGKGSYPVKGERYDFVIETSKAVSSYWIHIKGLGPCEDNKPFQLGVLKYDGSLF*********YKGYPVNRIFNRPNADCNPDNTSNVCISHLNNKDFVKPVLLAKKPDVFNRPNADCNPDNTSNVCISHLNNKDFVKPVLLSKKPDVRILLAPGFYNYKLPEVFQPDTYPRHVGKWCLFQQELMVPTPRGFPRC******
**DILMSRACGNCTSKGVCKGDTIVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVCKGDTIVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVTQCPILEGNVFRYKFLADAAGTYFWHSHDGFQKMDGIIGNLIIRQPRTSDPNSRYYEYDNPSHVVLVTDWYHNTTSDERWPGLRLHDVGQLPDTFLINGKGSYPVKGERYDFVIETSKAVSSYWIHIKGLGPCEDNKPFQLGVLKYDGSLFQKPPSSNPGYKGYPVNRIFNRPNADCNPDNTSNVCISHLNNKDFVKPVLLAKKPDVFNRPNADCNPDNTSNVCISHLNNKDFVKPVLLSKKPDVRILLAPGFYNYKLPEVFQPDTYPRHVGKWCLFQQELMVPTPRGFPR**DF***
MNDILMSRACGNCTSKGVCKGDTIVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVCKGDTIVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVTQCPILEGNVFRYKFLADAAGTYFWHSHDGFQKMDGIIGNLIIRQPRTSDPNSRYYEYDNPSHVVLVTDWYHNTTSDERWPGLRLHDVGQLPDTFLINGKGSYPVKGERYDFVIETSKAVSSYWIHIKGLGPCEDNKPFQLGVLKYDGSLFQKPPSSNPGYKGYPVNRIFNRPNADCNPDNTSNVCISHLNNKDFVKPVLLAKKPDVFNRPNADCNPDNTSNVCISHLNNKDFVKPVLLSKKPDVRILLAPGFYNYKLPEVFQPDTYPRHVGKWCLFQQELMVPTPRGFPRCGDFLND
*NDILMSRACGNCTSKGVCKGDTIVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVCKGDTIVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVTQCPILEGNVFRYKFLADAAGTYFWHSHDGFQKMDGIIGNLIIRQPRTSDPNSRYYEYDNPSHVVLVTDWYHNTTSDERWPGLRLHDVGQLPDTFLINGKGSYPVKGERYDFVIETSKAVSSYWIHIKGLGPCEDNKPFQLGVLKYDGSLFQKPPSSNPGYKGYPVNRIFNRPNADCNPDNTSNVCISHLNNKD**********PDVFNRPNADCNPDNTSNVCISHLNNKDFVKPVLLSKKPDVRILLAPGFYNYKLPEVFQPDTYPRHVGKWCLFQQELMVPTPRGFPRC******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNDILMSRACGNCTSKGVCKGDTIVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVCKGDTIVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVTQCPILEGNVFRYKFLADAAGTYFWHSHDGFQKMDGIIGNLIIRQPRTSDPNSRYYEYDNPSHVVLVTDWYHNTTSDERWPGLRLHDVGQLPDTFLINGKGSYPVKGERYDFVIETSKAVSSYWIHIKGLGPCEDNKPFQLGVLKYDGSLFQKPPSSNPGYKGYPVNRIFNRPNADCNPDNTSNVCISHLNNKDFVKPVLLAKKPDVFNRPNADCNPDNTSNVCISHLNNKDFVKPVLLSKKPDVRILLAPGFYNYKLPEVFQPDTYPRHVGKWCLFQQELMVPTPRGFPRCGDFLND
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query396 2.2.26 [Sep-21-2011]
Q02079 572 Laccase-3 OS=Thanatephoru N/A N/A 0.411 0.284 0.354 7e-23
P14133 587 L-ascorbate oxidase OS=Cu N/A N/A 0.340 0.229 0.395 1e-22
Q02075 599 Laccase-2 OS=Thanatephoru N/A N/A 0.409 0.270 0.352 6e-22
Q02081 531 Laccase-4 OS=Thanatephoru N/A N/A 0.462 0.344 0.336 1e-21
Q12719 520 Laccase-4 OS=Trametes ver N/A N/A 0.424 0.323 0.349 2e-21
Q99055 520 Laccase-4 OS=Trametes vil N/A N/A 0.424 0.323 0.349 3e-21
P24792 579 L-ascorbate oxidase OS=Cu N/A N/A 0.398 0.272 0.350 5e-21
P56193 576 Laccase-1 OS=Thanatephoru N/A N/A 0.411 0.282 0.338 8e-21
Q40588 578 L-ascorbate oxidase OS=Ni N/A N/A 0.325 0.223 0.36 2e-20
Q99056 527 Laccase-5 OS=Trametes vil N/A N/A 0.345 0.259 0.397 2e-20
>sp|Q02079|LAC3_THACU Laccase-3 OS=Thanatephorus cucumeris GN=LCC3 PE=2 SV=1 Back     alignment and function desciption
 Score =  108 bits (270), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 99/189 (52%), Gaps = 26/189 (13%)

Query: 60  KGDTIVVDLHNKMPG----RSTTIHWHGLTQRLTPHMDGVPMVTQCPILEGNVFRYKF-L 114
           KGDT+ V + NK+      R+T+IHWHGL Q      DG   VTQCPI+    + Y   L
Sbjct: 58  KGDTLKVKVQNKLTNPDMYRTTSIHWHGLLQHRNADDDGPAFVTQCPIVPQASYTYTMPL 117

Query: 115 ADAAGTYFWHSHDGFQKMDGIIGNLIIRQPRTSDPNSRYYEYDNPSHVVLVTDWYHNTTS 174
            D  GTY++HSH   Q +DG+ G L+I  P+  DP+ R Y+ D+   V+++ DWYH ++ 
Sbjct: 118 GDQTGTYWYHSHLSSQYVDGLRGPLVIYDPK--DPHRRLYDIDDEKTVLIIGDWYHTSSK 175

Query: 175 DERWPGLRLHDVGQLPDTFLINGKGSYP----------------VKGERYDFVIETSKAV 218
                G   +   Q PD+  INGKG +                  +G+RY   +  S A+
Sbjct: 176 AILATG---NITLQQPDSATINGKGRFDPDNTPANPNTLYTLKVKRGKRYRLRVINSSAI 232

Query: 219 SSYWIHIKG 227
           +S+ + I+G
Sbjct: 233 ASFRMSIQG 241
Lignin degradation and detoxification of lignin-derived products.
Thanatephorus cucumeris (taxid: 107832)
EC: 1EC: .EC: 1EC: 0EC: .EC: 3EC: .EC: 2
>sp|P14133|ASO_CUCSA L-ascorbate oxidase OS=Cucumis sativus PE=1 SV=1 Back     alignment and function description
>sp|Q02075|LAC2_THACU Laccase-2 OS=Thanatephorus cucumeris GN=LCC2 PE=2 SV=1 Back     alignment and function description
>sp|Q02081|LAC4_THACU Laccase-4 OS=Thanatephorus cucumeris GN=LCC4 PE=1 SV=1 Back     alignment and function description
>sp|Q12719|LAC4_TRAVE Laccase-4 OS=Trametes versicolor GN=LCC4 PE=3 SV=1 Back     alignment and function description
>sp|Q99055|LAC4_TRAVI Laccase-4 OS=Trametes villosa GN=LCC4 PE=3 SV=1 Back     alignment and function description
>sp|P24792|ASO_CUCMA L-ascorbate oxidase OS=Cucurbita maxima GN=AAO PE=1 SV=2 Back     alignment and function description
>sp|P56193|LAC1_THACU Laccase-1 OS=Thanatephorus cucumeris GN=LCC1 PE=1 SV=1 Back     alignment and function description
>sp|Q40588|ASO_TOBAC L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO PE=2 SV=1 Back     alignment and function description
>sp|Q99056|LAC5_TRAVI Laccase-5 OS=Trametes villosa GN=LCC5 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query396
242022888 616 L-ascorbate oxidase, putative [Pediculus 0.621 0.399 0.393 2e-52
295292761 729 laccase 2 [Nephotettix cincticeps] 0.785 0.426 0.338 6e-50
307212121 711 Laccase-4 [Harpegnathos saltator] 0.772 0.430 0.354 1e-49
270004718 717 hypothetical protein TcasGA2_TC010489 [T 0.686 0.379 0.335 2e-49
193211474 717 laccase 2 precursor [Tribolium castaneum 0.686 0.379 0.335 2e-49
357619776 758 laccase 2A [Danaus plexippus] 0.760 0.397 0.340 1e-47
26190491 760 laccase 2 [Manduca sexta] 0.772 0.402 0.337 1e-46
307176396 704 Laccase-4 [Camponotus floridanus] 0.689 0.387 0.328 4e-46
325302576 729 laccase 2 [Megacopta punctatissima] 0.621 0.337 0.374 4e-46
285803814 573 laccase 2 [Apis mellifera] 0.689 0.476 0.323 7e-46
>gi|242022888|ref|XP_002431869.1| L-ascorbate oxidase, putative [Pediculus humanus corporis] gi|212517210|gb|EEB19131.1| L-ascorbate oxidase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  212 bits (540), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 118/300 (39%), Positives = 166/300 (55%), Gaps = 54/300 (18%)

Query: 58  VCKGDTIVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVTQCPILEGNVFRYKFLADA 117
           VC+GD +V+D+ N+M G++ +IHWHG+ QR T + DGVP VTQCPI EGN FRY++ A+ 
Sbjct: 96  VCEGDKVVIDVENRMEGQAASIHWHGVWQRGTQYSDGVPFVTQCPIQEGNTFRYQWNAEN 155

Query: 118 AGTYFWHSHDGFQKMDGIIGNLIIRQPRTSDPNSRYYEYDNPSHVVLVTDWYHNTTSDER 177
           AGT+FWH+H G  K+DG+ G+++IRQ  + DPNS  Y+YD  +HV+L++DW H   + ER
Sbjct: 156 AGTHFWHAHTGLHKLDGLYGSIVIRQAPSKDPNSHLYDYDLTTHVMLLSDWLHE-DALER 214

Query: 178 WPGLRLHDVGQLPDTFLINGKGSY-----------PVK------GERYDF---------- 210
           +PG    + GQ PDT LINGKG +           P++      G RY F          
Sbjct: 215 FPGRLAVNQGQTPDTLLINGKGQFRDPNTGYMTNTPLEVFTITPGRRYRFRMINSMASVC 274

Query: 211 ------------------------VIETSKAVSSYWIHIKGLGPCEDNKPFQLGVLKYDG 246
                                   V+ T  + S+YWI  +GLG C   +  QL VL+Y  
Sbjct: 275 PVQLTIQGHSLILIATDGEPVHPVVVNTIISFSAYWIQARGLGECGIARAQQLAVLRYAR 334

Query: 247 SLFQKPPSSNPGYK-GYPVNRIFNRPNADCNPDNTSNVCISHLNNKDFVKPVLLAKKPDV 305
             +Q P S+ P Y  G P   + N  +A CN + +  VC+S L N   V   +L ++PDV
Sbjct: 335 GPYQ-PDSAMPSYDVGLPQGVVLNPLDAVCNRERSDAVCVSQLKNAKPVDEGILQQRPDV 393

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|295292761|dbj|BAJ06133.1| laccase 2 [Nephotettix cincticeps] Back     alignment and taxonomy information
>gi|307212121|gb|EFN87980.1| Laccase-4 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|270004718|gb|EFA01166.1| hypothetical protein TcasGA2_TC010489 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|193211474|ref|NP_001034487.2| laccase 2 precursor [Tribolium castaneum] gi|193126110|gb|AAX84202.2| laccase 2A [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357619776|gb|EHJ72220.1| laccase 2A [Danaus plexippus] Back     alignment and taxonomy information
>gi|26190491|gb|AAN17507.1| laccase 2 [Manduca sexta] Back     alignment and taxonomy information
>gi|307176396|gb|EFN65980.1| Laccase-4 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|325302576|dbj|BAJ83488.1| laccase 2 [Megacopta punctatissima] Back     alignment and taxonomy information
>gi|285803814|gb|ACK57559.2| laccase 2 [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query396
FB|FBgn0259247 784 laccase2 "laccase 2" [Drosophi 0.358 0.181 0.493 2.6e-61
FB|FBgn0032116 959 Mco1 "Multicopper oxidase-1" [ 0.358 0.148 0.503 4e-50
FB|FBgn0052557 645 CG32557 [Drosophila melanogast 0.285 0.175 0.508 4.5e-37
FB|FBgn0039387 677 MCO3 "multicopper oxidase 3" [ 0.335 0.196 0.369 8e-28
TAIR|locus:2135242 582 AT4G39830 [Arabidopsis thalian 0.343 0.233 0.441 2.9e-26
ASPGD|ASPL0000035520 570 lccB [Emericella nidulans (tax 0.373 0.259 0.360 3e-25
TAIR|locus:2178973 573 AT5G21100 [Arabidopsis thalian 0.335 0.232 0.398 3.2e-25
UNIPROTKB|G4NBF8 747 MGG_17429 "Uncharacterized pro 0.343 0.182 0.374 2.6e-22
UNIPROTKB|G5EGX4 595 MGCH7_ch7g635 "Laccase-1" [Mag 0.335 0.223 0.385 4.9e-21
UNIPROTKB|G4ND85 597 MGG_11608 "Laccase-2" [Magnapo 0.345 0.229 0.365 2.1e-19
FB|FBgn0259247 laccase2 "laccase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 430 (156.4 bits), Expect = 2.6e-61, Sum P(3) = 2.6e-61
 Identities = 71/144 (49%), Positives = 104/144 (72%)

Query:    58 VCKGDTIVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVTQCPILEGNVFRYKFLADA 117
             VC+ D +V+D+ N M G   TIHWHG+ QR + + DGVP VTQCPI +GN FRY++  +A
Sbjct:   250 VCENDKVVIDVENHMEGMEVTIHWHGIWQRGSQYYDGVPFVTQCPIQQGNTFRYQWTGNA 309

Query:   118 AGTYFWHSHDGFQKMDGIIGNLIIRQPRTSDPNSRYYEYDNPSHVVLVTDWYHNTTSDER 177
              GT+FWH+H G QK+DG+ G++++RQP + DPNS  Y++D  +H++L++DW H   + ER
Sbjct:   310 -GTHFWHAHTGLQKLDGLYGSVVVRQPPSRDPNSHLYDFDLTTHIMLISDWLHEDAA-ER 367

Query:   178 WPGLRLHDVGQLPDTFLINGKGSY 201
             +PG    + GQ P++ LINGKG +
Sbjct:   368 YPGRLAVNTGQDPESMLINGKGQF 391
GO:0052716 "hydroquinone:oxygen oxidoreductase activity" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005507 "copper ion binding" evidence=IEA
GO:0040003 "chitin-based cuticle development" evidence=IMP
FB|FBgn0032116 Mco1 "Multicopper oxidase-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0052557 CG32557 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039387 MCO3 "multicopper oxidase 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2135242 AT4G39830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000035520 lccB [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TAIR|locus:2178973 AT5G21100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4NBF8 MGG_17429 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|G5EGX4 MGCH7_ch7g635 "Laccase-1" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|G4ND85 MGG_11608 "Laccase-2" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query396
TIGR03388 541 TIGR03388, ascorbase, L-ascorbate oxidase, plant t 1e-31
PLN02604 566 PLN02604, PLN02604, oxidoreductase 3e-31
pfam07732119 pfam07732, Cu-oxidase_3, Multicopper oxidase 1e-29
PLN02191 574 PLN02191, PLN02191, L-ascorbate oxidase 2e-24
COG2132451 COG2132, SufI, Putative multicopper oxidases [Seco 5e-20
TIGR01480 587 TIGR01480, copper_res_A, copper-resistance protein 1e-18
TIGR03390 538 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fu 9e-18
TIGR03389 539 TIGR03389, laccase, laccase, plant 1e-11
PLN02354 552 PLN02354, PLN02354, copper ion binding / oxidoredu 8e-11
PLN02792 536 PLN02792, PLN02792, oxidoreductase 1e-08
PLN02168 545 PLN02168, PLN02168, copper ion binding / pectinest 5e-08
PLN02835 539 PLN02835, PLN02835, oxidoreductase 4e-07
PLN02991 543 PLN02991, PLN02991, oxidoreductase 5e-07
PRK10965 523 PRK10965, PRK10965, multicopper oxidase; Provision 3e-06
PLN00044 596 PLN00044, PLN00044, multi-copper oxidase-related p 3e-04
>gnl|CDD|234193 TIGR03388, ascorbase, L-ascorbate oxidase, plant type Back     alignment and domain information 
 Score =  125 bits (315), Expect = 1e-31
 Identities = 55/150 (36%), Positives = 80/150 (53%), Gaps = 21/150 (14%)

Query: 61  GDTIVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVTQCPILEGNVFRYKFLADAAGT 120
           GDTIVV+L NK+      IHWHG+ Q  TP  DG   VTQC I  G  F Y F+ D  GT
Sbjct: 39  GDTIVVELTNKLHTEGVVIHWHGIRQIGTPWADGTAGVTQCAINPGETFIYNFVVDRPGT 98

Query: 121 YFWHSHDGFQKMDGIIGNLIIRQPRTSDPNSRYYEYDNPSHVVLVTDWYHNTTSDE---- 176
           YF+H H G Q+  G+ G+LI+      +    +Y+ +     +L++DW+H +  ++    
Sbjct: 99  YFYHGHYGMQRSAGLYGSLIVD-VPDGEKEPFHYDGE---FNLLLSDWWHKSIHEQEVGL 154

Query: 177 -----RWPGLRLHDVGQLPDTFLINGKGSY 201
                RW       +G+ P + LING+G +
Sbjct: 155 SSKPMRW-------IGE-PQSLLINGRGQF 176

Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases. Length = 541
>gnl|CDD|215324 PLN02604, PLN02604, oxidoreductase Back     alignment and domain information
>gnl|CDD|219542 pfam07732, Cu-oxidase_3, Multicopper oxidase Back     alignment and domain information
>gnl|CDD|177843 PLN02191, PLN02191, L-ascorbate oxidase Back     alignment and domain information
>gnl|CDD|225043 COG2132, SufI, Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|233432 TIGR01480, copper_res_A, copper-resistance protein, CopA family Back     alignment and domain information
>gnl|CDD|132431 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fungal type Back     alignment and domain information
>gnl|CDD|234194 TIGR03389, laccase, laccase, plant Back     alignment and domain information
>gnl|CDD|177987 PLN02354, PLN02354, copper ion binding / oxidoreductase Back     alignment and domain information
>gnl|CDD|178389 PLN02792, PLN02792, oxidoreductase Back     alignment and domain information
>gnl|CDD|215113 PLN02168, PLN02168, copper ion binding / pectinesterase Back     alignment and domain information
>gnl|CDD|178429 PLN02835, PLN02835, oxidoreductase Back     alignment and domain information
>gnl|CDD|215536 PLN02991, PLN02991, oxidoreductase Back     alignment and domain information
>gnl|CDD|236810 PRK10965, PRK10965, multicopper oxidase; Provisional Back     alignment and domain information
>gnl|CDD|165622 PLN00044, PLN00044, multi-copper oxidase-related protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query396
1hfu_A 503 Type-2 Cu-Depleted Laccase From Coprinus Cinereus A 7e-23
1a65_A 504 Type-2 Cu-depleted Laccase From Coprinus Cinereus L 7e-23
1aoz_A 552 Refined Crystal Structure Of Ascorbate Oxidase At 1 2e-21
3kw7_A 502 Crystal Structure Of Lacb From Trametes Sp. Ah28-2 4e-21
3sqr_A 580 Crystal Structure Of Laccase From Botrytis Aclada A 3e-20
3v9e_A 580 Structure Of The L513m Mutant Of The Laccase From B 3e-20
3fpx_A 499 Native Fungus Laccase From Trametes Hirsuta Length 1e-19
3pxl_A 499 Type-2 Cu-Depleted Fungus Laccase From Trametes Hir 1e-19
1kya_A499 Active Laccase From Trametes Versicolor Complexed W 2e-19
1gyc_A 499 Crystal Structure Determination At Room Temperature 3e-19
2qt6_A 498 Crystal Structure Determination Of A Blue Laccase F 1e-18
1v10_A 521 Structure Of Rigidoporus Lignosus Laccase From Hemi 1e-18
2hzh_A 499 Crystal Structure Of Laccase From Coriolus Zonatus 3e-18
3div_A499 Crystal Structure Of Laccase From Cerrena Maxima At 3e-18
4a2f_A497 Coriolopsis Gallica Laccase Collected At 12.65 Kev 8e-18
4a2d_A496 Coriolopsis Gallica Laccase T2 Copper Depleted At P 8e-18
2h5u_A 499 Crystal Structure Of Laccase From Cerrena Maxima At 1e-17
2hrg_A 496 Crystal Structure Of Blue Laccase From Trametes Tro 3e-17
3t6v_A 495 Crystal Structure Of Laccase From Steccherinum Ochr 5e-17
1zpu_A 534 Crystal Structure Of Fet3p, A Multicopper Oxidase T 1e-16
2xyb_A 497 Crystal Structure Of A Fully Functional Laccase Fro 1e-16
2q9o_A 559 Near-Atomic Resolution Structure Of A Melanocarpus 4e-12
3g5w_A318 Crystal Structure Of Blue Copper Oxidase From Nitro 4e-12
3pps_A 604 Crystal Structure Of An Ascomycete Fungal Laccase F 6e-12
1gw0_A 559 Crystal Structure Of Laccase From Melanocarpus Albo 6e-12
3dkh_A 559 L559a Mutant Of Melanocarpus Albomyces Laccase Leng 6e-12
3zx1_A481 Multicopper Oxidase From Campylobacter Jejuni: A Me 5e-07
2xu9_A439 Crystal Structure Of Laccase From Thermus Thermophi 4e-04
3gdc_A288 Crystal Structure Of Multicopper Oxidase Length = 2 9e-04
>pdb|1HFU|A Chain A, Type-2 Cu-Depleted Laccase From Coprinus Cinereus At 1.68 A Resolution Length = 503 Back     alignment and structure 
Iteration: 1

 Score =  104 bits (260), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 71/193 (36%), Positives = 100/193 (51%), Gaps = 18/193 (9%)
Query: 64  IVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVTQCPILEGNVFRYKFL-ADAAGTYF 122
           +V DL N    R T+IHWHGL QR T   DG   V QCPI  G+ F YKF  A  AGT++
Sbjct: 48  VVNDLDNPTMLRPTSIHWHGLFQRGTNWADGADGVNQCPISPGHAFLYKFTPAGHAGTFW 107
Query: 123 WHSHDGFQKMDGIIGNLIIRQPRTSDPNSRYYEYDNPSHVVLVTDWYHNTTSDERWPGLR 182
           +HSH G Q  DG+ G ++I     +DP++  Y+ D+ + ++ + DWYH        P   
Sbjct: 108 YHSHFGTQYCDGLRGPMVIYD--DNDPHAALYDEDDENTIITLADWYH-------IPAPS 158
Query: 183 LHDVGQLPDTFLINGKGSYPVKGERYDFVIETSKAVSSYWIHIKGLGPCEDNKPF----- 237
           +    Q PD  LINGKG Y V G   +  I   +    Y + +  L  C+ N  F     
Sbjct: 159 IQGAAQ-PDATLINGKGRY-VGGPAAELSIVNVEQGKKYRMRLISLS-CDPNWQFSIDGH 215
Query: 238 QLGVLKYDGSLFQ 250
           +L +++ DG L +
Sbjct: 216 ELTIIEVDGELTE 228
>pdb|1A65|A Chain A, Type-2 Cu-depleted Laccase From Coprinus Cinereus Length = 504 Back     alignment and structure
>pdb|1AOZ|A Chain A, Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution Length = 552 Back     alignment and structure
>pdb|3KW7|A Chain A, Crystal Structure Of Lacb From Trametes Sp. Ah28-2 Length = 502 Back     alignment and structure
>pdb|3SQR|A Chain A, Crystal Structure Of Laccase From Botrytis Aclada At 1.67 A Resolution Length = 580 Back     alignment and structure
>pdb|3V9E|A Chain A, Structure Of The L513m Mutant Of The Laccase From B.aclada Length = 580 Back     alignment and structure
>pdb|3FPX|A Chain A, Native Fungus Laccase From Trametes Hirsuta Length = 499 Back     alignment and structure
>pdb|3PXL|A Chain A, Type-2 Cu-Depleted Fungus Laccase From Trametes Hirsuta Length = 499 Back     alignment and structure
>pdb|1KYA|A Chain A, Active Laccase From Trametes Versicolor Complexed With 2,5-Xylidine Length = 499 Back     alignment and structure
>pdb|1GYC|A Chain A, Crystal Structure Determination At Room Temperature Of A Laccase From Trametes Versicolor In Its Oxidised Form Containing A Full Complement Of Copper Ions Length = 499 Back     alignment and structure
>pdb|2QT6|A Chain A, Crystal Structure Determination Of A Blue Laccase From Lentinus Tigrinus Length = 498 Back     alignment and structure
>pdb|1V10|A Chain A, Structure Of Rigidoporus Lignosus Laccase From Hemihedrally Twinned Crystals Length = 521 Back     alignment and structure
>pdb|2HZH|A Chain A, Crystal Structure Of Laccase From Coriolus Zonatus At 2.6 A Resolution Length = 499 Back     alignment and structure
>pdb|3DIV|A Chain A, Crystal Structure Of Laccase From Cerrena Maxima At 1.76a Resolution Length = 499 Back     alignment and structure
>pdb|4A2F|A Chain A, Coriolopsis Gallica Laccase Collected At 12.65 Kev Length = 497 Back     alignment and structure
>pdb|4A2D|A Chain A, Coriolopsis Gallica Laccase T2 Copper Depleted At Ph 4.5 Length = 496 Back     alignment and structure
>pdb|2H5U|A Chain A, Crystal Structure Of Laccase From Cerrena Maxima At 1.9a Resolution Length = 499 Back     alignment and structure
>pdb|2HRG|A Chain A, Crystal Structure Of Blue Laccase From Trametes Trogii Complexed With P-Methylbenzoate Length = 496 Back     alignment and structure
>pdb|3T6V|A Chain A, Crystal Structure Of Laccase From Steccherinum Ochraceum Length = 495 Back     alignment and structure
>pdb|1ZPU|A Chain A, Crystal Structure Of Fet3p, A Multicopper Oxidase That Functions In Iron Import Length = 534 Back     alignment and structure
>pdb|2XYB|A Chain A, Crystal Structure Of A Fully Functional Laccase From The Ligninolytic Fungus Pycnoporus Cinnabarinus Length = 497 Back     alignment and structure
>pdb|2Q9O|A Chain A, Near-Atomic Resolution Structure Of A Melanocarpus Albomyces Laccase Length = 559 Back     alignment and structure
>pdb|3G5W|A Chain A, Crystal Structure Of Blue Copper Oxidase From Nitrosomonas Europaea Length = 318 Back     alignment and structure
>pdb|3PPS|A Chain A, Crystal Structure Of An Ascomycete Fungal Laccase From Thielavia Arenaria Length = 604 Back     alignment and structure
>pdb|1GW0|A Chain A, Crystal Structure Of Laccase From Melanocarpus Albomyces In Four Copper Form Length = 559 Back     alignment and structure
>pdb|3DKH|A Chain A, L559a Mutant Of Melanocarpus Albomyces Laccase Length = 559 Back     alignment and structure
>pdb|3ZX1|A Chain A, Multicopper Oxidase From Campylobacter Jejuni: A Metallo-Oxidase Length = 481 Back     alignment and structure
>pdb|2XU9|A Chain A, Crystal Structure Of Laccase From Thermus Thermophilus Hb27 Length = 439 Back     alignment and structure
>pdb|3GDC|A Chain A, Crystal Structure Of Multicopper Oxidase Length = 288 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query396
2q9o_A 559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 2e-54
3pxl_A499 Laccase; 4-copper protein, metal-binding, oxidored 1e-52
3t6v_A495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 2e-52
1aoz_A 552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 3e-52
1aoz_A 552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 3e-04
1hfu_A503 Laccase 1; oxidoreductase, blue multi-copper oxida 7e-52
3sqr_A580 Laccase; multicopper oxidase, glycosylation, oxido 9e-52
1v10_A521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 1e-50
1zpu_A 534 Iron transport multicopper oxidase FET3; ferroxida 8e-50
1zpu_A 534 Iron transport multicopper oxidase FET3; ferroxida 2e-40
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 6e-47
2zwn_A339 Two-domain type laccase; muticopper oxidase, oxido 2e-42
2xu9_A439 Laccase; oxidoreductase, multicopper oxidases; 1.5 4e-27
3aw5_A448 Multicopper oxidase; beta barrel, oxidoreductase; 6e-27
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 2e-23
3od3_A 488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 3e-23
3zx1_A481 Oxidoreductase, putative; laccase, metallo-oxidase 8e-23
3abg_A 534 Bilirubin oxidase; cleavage on PAIR of basic resid 1e-22
2g23_A 612 PHS, phenoxazinone synthase; copper, metalloprotei 6e-21
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 3e-19
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 2e-04
2uxt_A451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 2e-17
2wsd_A513 Spore coat protein A; oxidoreductase, multi-copper 5e-17
2zoo_A442 Probable nitrite reductase; electron transfer, ele 3e-16
2r7e_A742 Coagulation factor VIII; ceruloplasmin fold, cuppe 2e-15
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 9e-14
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 4e-05
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 3e-14
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 5e-10
2j5w_A1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 6e-07
2j5w_A1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 1e-05
1kbv_A327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 5e-13
3kw8_A276 Laccase, putative copper oxidase; two-domain lacca 6e-13
2dv6_A447 Nitrite reductase; electron transfer, reduction, d 6e-13
2dv6_A447 Nitrite reductase; electron transfer, reduction, d 1e-04
3cg8_A343 Laccase; oxidoreductase, multicopper blue protein; 4e-12
2bw4_A340 Copper-containing nitrite reductase; oxidoreductas 4e-11
1oe1_A336 Dissimilatory copper-containing nitrite reductase; 4e-10
1mzy_A333 Copper-containing nitrite reductase; mutant M182T, 5e-09
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Length = 559 Back     alignment and structure
 Score =  187 bits (478), Expect = 2e-54
 Identities = 73/345 (21%), Positives = 111/345 (32%), Gaps = 90/345 (26%)

Query: 58  VCKGDTIVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVTQCPIL-EGNVFRYKFLAD 116
              GDT+ V + N +    T+IHWHG+ Q+ T   DG   VT+CPI  +G    Y++ A 
Sbjct: 71  ANWGDTVEVTVINNLVTNGTSIHWHGIXQKDTNLHDGANGVTECPIPPKGGQRTYRWRAR 130

Query: 117 AAGTYFWHSHDGFQKMDGIIGNLIIRQPRTSDPNSRYYEYDNPSHVVLVTDWYHNTTSDE 176
             GT ++HSH   Q  +G++G + I  P +         YD    V  +TD+Y+    D 
Sbjct: 131 QYGTSWYHSHFSAQYGNGVVGTIQINGPAS-------LPYDIDLGVFPITDYYYRAADD- 182

Query: 177 RWPGLRLHDVGQLPDTFLINGKGSYP------------VKGERY---------------- 208
                  ++     D  LING    P              G+R+                
Sbjct: 183 -LVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVS 241

Query: 209 --------------------------------DFVIETSKAVSSYWIHIKGLGPC---ED 233
                                           D VI+ S+A  +YW ++   G       
Sbjct: 242 LVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGS 301

Query: 234 NKPFQLGVLKYDGSLFQKPPSSNPGYKGYPVNRIFNRPNADCNPDNTSNVCISHLNNKDF 293
             P    +  Y G+    P                  P  D    +T +V          
Sbjct: 302 LNPHPAAIFHYAGAPGGLPTDEGT-------------PPVDHQCLDTLDV---RPVVPRS 345

Query: 294 VKPVLLAKKPDVFNRPNADCNPDNTSNVCI-SHLNNKDFVKPVLL 337
           V      K+PD       D          +     N D+ KP++ 
Sbjct: 346 VPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIID 390
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Length = 499 Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Length = 495 Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Length = 552 Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Length = 552 Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Length = 503 Back     alignment and structure
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Length = 580 Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Length = 521 Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Length = 534 Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Length = 534 Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Length = 318 Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Length = 339 Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Length = 439 Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Length = 448 Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Length = 288 Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Length = 488 Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Length = 481 Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Length = 534 Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Length = 306 Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Length = 306 Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Length = 451 Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Length = 513 Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Length = 442 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Length = 327 Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} Length = 276 Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Length = 447 Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Length = 447 Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Length = 343 Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Length = 340 Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Length = 336 Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Length = 333 Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Length = 647 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query396
3t6v_A495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 100.0
3pxl_A499 Laccase; 4-copper protein, metal-binding, oxidored 100.0
3sqr_A580 Laccase; multicopper oxidase, glycosylation, oxido 100.0
1aoz_A 552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 100.0
1v10_A521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 100.0
1zpu_A 534 Iron transport multicopper oxidase FET3; ferroxida 100.0
1hfu_A503 Laccase 1; oxidoreductase, blue multi-copper oxida 100.0
2q9o_A559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 100.0
2uxt_A451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 100.0
2wsd_A513 Spore coat protein A; oxidoreductase, multi-copper 100.0
3aw5_A448 Multicopper oxidase; beta barrel, oxidoreductase; 100.0
3abg_A534 Bilirubin oxidase; cleavage on PAIR of basic resid 100.0
2xu9_A439 Laccase; oxidoreductase, multicopper oxidases; 1.5 100.0
3zx1_A481 Oxidoreductase, putative; laccase, metallo-oxidase 100.0
3gyr_A 612 PHS, phenoxazinone synthase; metalloprotein, lacca 100.0
3od3_A488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 100.0
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 100.0
2zwn_A339 Two-domain type laccase; muticopper oxidase, oxido 100.0
2g23_A 612 PHS, phenoxazinone synthase; copper, metalloprotei 100.0
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 99.97
1oe1_A336 Dissimilatory copper-containing nitrite reductase; 99.97
1kbv_A327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 99.97
1mzy_A333 Copper-containing nitrite reductase; mutant M182T, 99.97
3kw8_A276 Laccase, putative copper oxidase; two-domain lacca 99.96
2bw4_A340 Copper-containing nitrite reductase; oxidoreductas 99.96
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 99.96
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 99.96
3t9w_A299 Small laccase, multi-copper oxidase; two-domain co 99.96
3tas_A313 Small laccase, multi-copper oxidase; two-domain la 99.96
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 99.95
2zoo_A442 Probable nitrite reductase; electron transfer, ele 99.95
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.94
3cg8_A343 Laccase; oxidoreductase, multicopper blue protein; 99.93
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.92
2r7e_A742 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.91
2dv6_A447 Nitrite reductase; electron transfer, reduction, d 99.9
2j5w_A1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 99.86
2dv6_A447 Nitrite reductase; electron transfer, reduction, d 99.85
3kw8_A276 Laccase, putative copper oxidase; two-domain lacca 99.66
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 99.45
3cg8_A343 Laccase; oxidoreductase, multicopper blue protein; 99.44
3t9w_A299 Small laccase, multi-copper oxidase; two-domain co 99.4
3tas_A313 Small laccase, multi-copper oxidase; two-domain la 99.39
2cal_A154 Rusticyanin; iron respiratory electron transport c 99.21
3sqr_A 580 Laccase; multicopper oxidase, glycosylation, oxido 99.18
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 99.17
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 99.15
1aoz_A 552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 99.14
1zpu_A 534 Iron transport multicopper oxidase FET3; ferroxida 99.1
3t6v_A495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 99.1
3pxl_A499 Laccase; 4-copper protein, metal-binding, oxidored 99.08
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 99.07
2zwn_A339 Two-domain type laccase; muticopper oxidase, oxido 98.98
2q9o_A 559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 98.98
1v10_A521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 98.96
1hfu_A503 Laccase 1; oxidoreductase, blue multi-copper oxida 98.93
3gyr_A 612 PHS, phenoxazinone synthase; metalloprotein, lacca 98.92
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 98.88
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.82
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 98.76
3zx1_A481 Oxidoreductase, putative; laccase, metallo-oxidase 98.69
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 98.54
2wsd_A513 Spore coat protein A; oxidoreductase, multi-copper 98.54
3aw5_A448 Multicopper oxidase; beta barrel, oxidoreductase; 98.52
1sdd_B647 Coagulation factor V; copper-binding protein, cofa 98.52
2uxt_A451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 98.44
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 98.43
2xu9_A439 Laccase; oxidoreductase, multicopper oxidases; 1.5 98.42
3abg_A534 Bilirubin oxidase; cleavage on PAIR of basic resid 98.34
3od3_A488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 98.26
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 98.13
2g23_A612 PHS, phenoxazinone synthase; copper, metalloprotei 98.11
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 98.1
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 98.09
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 98.07
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 98.04
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 98.0
1kbv_A327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 97.97
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 97.92
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 97.9
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 97.84
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 97.82
1byp_A99 Protein (plastocyanin); electron transfer, photosy 97.82
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 97.8
1mzy_A333 Copper-containing nitrite reductase; mutant M182T, 97.77
2bw4_A340 Copper-containing nitrite reductase; oxidoreductas 97.69
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 97.68
2zoo_A442 Probable nitrite reductase; electron transfer, ele 97.65
1oe1_A336 Dissimilatory copper-containing nitrite reductase; 97.55
3c75_A132 Amicyanin; copper proteins, electron transfer comp 97.53
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 97.43
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 97.42
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 97.38
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 97.34
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 97.31
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 96.98
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 96.89
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 96.88
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 96.8
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 96.72
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 96.55
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 90.34
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 90.29
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 84.15
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Back     alignment and structure
Probab=100.00  E-value=8.3e-52  Score=428.55  Aligned_cols=202  Identities=33%  Similarity=0.602  Sum_probs=172.2

Q ss_pred             CeEEEEEEcCCCCCCcEEeeccccCCCCCCCCCCceeEeCCEEEEEEEeCCCC----CceEEEEecccccCCCCCCCccc
Q psy13500         22 DTIVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVCKGDTIVVDLHNKMPG----RSTTIHWHGLTQRLTPHMDGVPM   97 (396)
Q Consensus        22 dr~~i~vn~~~PgP~itiHwhG~~q~~~~~~DG~~~v~~Gd~v~v~v~N~l~~----~~ttiHwHGl~~~~t~~~DGvp~   97 (396)
                      .|.+|+|||++|||+|                   ++++||+|+|+|+|+|+.    .++||||||++|++++||||+|+
T Consensus        22 ~~~~~~~NG~~PGP~I-------------------~~~~GD~v~v~v~N~l~~~~~~~~tsiHwHGl~~~~~~~~DGv~~   82 (495)
T 3t6v_A           22 VRPAVNAGGTFPGPVI-------------------AGNVGDNFQIVTFNQLIECSMLVDTSIHWHGEFQKGTNWADGPAF   82 (495)
T ss_dssp             CEEEEEETTSSSCCEE-------------------EEETTCEEEEEEEECCCCGGGCSCBCEEEETCCCTTCGGGSCCBT
T ss_pred             eEEEEEECCcccCCeE-------------------EEECCcEEEEEEEECCCCccCCCceEEEeCCcccCCCccccCCCc
Confidence            4889999999999999                   999999999999999974    37999999999999999999999


Q ss_pred             ccccccCCCCeEEEEEEe-ccCceeeeeecCCccccCCeeeEEEEcCCCCCCCCCCcCCCCCCceEEEEeecccCCCCCC
Q psy13500         98 VTQCPILEGNVFRYKFLA-DAAGTYFWHSHDGFQKMDGIIGNLIIRQPRTSDPNSRYYEYDNPSHVVLVTDWYHNTTSDE  176 (396)
Q Consensus        98 vtq~pI~PG~~f~Y~f~~-~~~GT~wYHsH~~~q~~~Gl~G~lIV~~~~~~~p~~~~yd~d~~e~vl~l~Dw~~~~~~~~  176 (396)
                      +|||||+||++|+|+|++ +++||||||||.+.|+.+||+|+|||+++.  ++...+|++|..|++|+|+||+++.. ..
T Consensus        83 vtq~pI~PG~sftY~f~~~~~~GT~wYHsH~~~q~~~GL~G~lIV~~~~--~~~~~~~~~d~~e~~l~l~Dw~~~~~-~~  159 (495)
T 3t6v_A           83 ITQCPIIVGNSFSYNFNVPGMAGTYWYHSHLTTQYCDGLRGPFVVYDPN--DPDANLYDVDDDTTIITLADWYHVLA-KE  159 (495)
T ss_dssp             TTBCCBCTTCEEEEEEECTTCCEEEEEEECSTTGGGGTCEEEEEEECTT--CTTGGGCSBCSGGGEEEEEEECSSCG-GG
T ss_pred             cccCCCCCCCeEEEEEEeCCCCceeeeeccchhHHhcCceEEEEEcCcc--ccccccCCCCCceeEEEEecccCCch-hh
Confidence            999999999999999999 789999999999999999999999999884  44555688887788999999999876 22


Q ss_pred             cccccccCCCCCCCcEEEEccccCCC---------C--------------------------------------------
Q psy13500        177 RWPGLRLHDVGQLPDTFLINGKGSYP---------V--------------------------------------------  203 (396)
Q Consensus       177 ~~~~~~~~~~~~~~d~~LINGkg~~~---------~--------------------------------------------  203 (396)
                      .     ....+..+|++||||++++.         .                                            
T Consensus       160 ~-----~~~~p~~~d~~liNG~g~~~~~~~~~~~~~~~v~~G~~~RlRliN~~~~~~~~~~i~gh~~~via~DG~~~~P~  234 (495)
T 3t6v_A          160 M-----GAGGAITADSTLIDGLGRTHVNVAAVPLSVITVEVGKRYRMRLVSISCDPNYDFSIDGHDMTIIETDGVDSQEL  234 (495)
T ss_dssp             S-----CSSSCCCCSEEEETTBCCBSSSCCCCCCCEEEECTTCEEEEEEEECCSSCCEEEEETTCCEEEEEETTEEEEEE
T ss_pred             h-----ccCCCCCCcEEEECCcCcCCCCcccCCceEEEEcCCCEEEEEEEecCCCeeEEEEECCCeEEEEEeCCcccCCE
Confidence            1     12234578999999997421         0                                            


Q ss_pred             --------CCcEEEEEEecCCCCceEEEEEeecCCCCC-CCCceEEEEEEcCCCCC
Q psy13500        204 --------KGERYDFVIETSKAVSSYWIHIKGLGPCED-NKPFQLGVLKYDGSLFQ  250 (396)
Q Consensus       204 --------~GERydvlv~a~q~~g~Ywir~~~~~~~~~-~~~~~~AIL~Y~g~~~~  250 (396)
                              +||||||+|+++++.|+||||+.....|.. .+...+|||+|+++...
T Consensus       235 ~~~~l~i~pGqR~dvlv~~~~~~g~y~i~a~~~~~~~~~~~~~~~ail~Y~~~~~~  290 (495)
T 3t6v_A          235 TVDEIQIFAAQRYSFVLNANQPVGNYWIRANPNSGGEGFDGGINSAILRYDGATTA  290 (495)
T ss_dssp             EESBEEECTTCEEEEEEECCSCSSEEEEEEEESSSSCSCGGGTTEEEEEETTSCSS
T ss_pred             EeeeEEEcCceEEEEEEECCCCCceEEEEEecccCccccCCCceEEEEEECCCCCC
Confidence                    999999999999988999999987655532 23345899999987643
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Back     alignment and structure
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Back     alignment and structure
>3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Back     alignment and structure
>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} Back     alignment and structure
>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Back     alignment and structure
>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} Back     alignment and structure
>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Back     alignment and structure
>3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 396
d1hfua1131 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprin 3e-24
d1gyca1130 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, la 1e-22
d1v10a1136 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [T 1e-22
d1aoza1129 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cuc 2e-20
d1sdda1180 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos t 8e-16
d2j5wa3207 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sap 5e-15
d2q9oa1162 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces 2e-14
d2j5wa1192 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapie 3e-14
d1e30a_153 b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidan 2e-12
d1oe2a1159 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcalige 4e-12
d1gska1181 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Baci 1e-11
d1kbva1151 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisser 2e-11
d2j5wa4179 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sap 1e-10
d2j5wa5149 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sa 2e-10
d1sddb2139 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (B 2e-10
d1mzya1153 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodoba 8e-10
d1kv7a1140 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Esch 2e-09
d2bw4a1157 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcalige 8e-09
d2j5wa2145 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sap 9e-09
d1kcwa2146 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sap 2e-08
d1sdda2116 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos 2e-07
d1gyca2170 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, 4e-07
d1hfua2172 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Copr 3e-06
d2q9oa2181 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyce 5e-06
d1v10a2168 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus 6e-06
d1kbva2151 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisse 2e-04
d1sddb167 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (B 8e-04
d1aoza2209 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (C 0.001
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Length = 131 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Multidomain cupredoxins
domain: Laccase
species: Inky cap fungus (Coprinus cinereus) [TaxId: 5346]

 Score = 94.7 bits (235), Expect = 3e-24
 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 5/92 (5%)

Query: 58  VCKGDTIVVDLHNKMP----GRSTTIHWHGLTQRLTPHMDGVPMVTQCPILEGNVFRYKF 113
             K D   +++ N +      R T+IHWHGL QR T   DG   V QCPI  G+ F YKF
Sbjct: 38  GGKNDNFELNVVNDLDNPTMLRPTSIHWHGLFQRGTNWADGADGVNQCPISPGHAFLYKF 97

Query: 114 -LADAAGTYFWHSHDGFQKMDGIIGNLIIRQP 144
             A  AGT+++HSH G Q  DG+ G ++I   
Sbjct: 98  TPAGHAGTFWYHSHFGTQYCDGLRGPMVIYDD 129
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Length = 130 Back     information, alignment and structure
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Length = 136 Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Length = 129 Back     information, alignment and structure
>d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 180 Back     information, alignment and structure
>d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Length = 162 Back     information, alignment and structure
>d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Length = 153 Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 159 Back     information, alignment and structure
>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Length = 181 Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Length = 151 Back     information, alignment and structure
>d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 179 Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 139 Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Length = 153 Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Length = 140 Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 157 Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 116 Back     information, alignment and structure
>d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Length = 170 Back     information, alignment and structure
>d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Length = 172 Back     information, alignment and structure
>d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} Length = 181 Back     information, alignment and structure
>d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]} Length = 168 Back     information, alignment and structure
>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Length = 151 Back     information, alignment and structure
>d1sddb1 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 67 Back     information, alignment and structure
>d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Length = 209 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query396
d1v10a1136 Laccase {Rigidoporus lignosus [TaxId: 219653]} 100.0
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 99.97
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 99.97
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 99.97
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 99.96
d1kv7a1140 multi-copper oxidase CueO {Escherichia coli [TaxId 99.93
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.9
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.89
d1gska1181 Spore coat protein A, CotA {Bacillus subtilis [Tax 99.89
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 99.88
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 99.88
d1sdda1180 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.87
d2j5wa3207 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.84
d2j5wa1192 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.81
d2j5wa4179 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1v10a2168 Laccase {Rigidoporus lignosus [TaxId: 219653]} 99.75
d1gyca2170 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 99.73
d1hfua2172 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 99.68
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 99.68
d2q9oa2181 Laccase {Melanocarpus albomyces [TaxId: 204285]} 99.67
d1kbva2151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 99.56
d1sddb2139 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.55
d1kcwa2146 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.52
d2j5wa2145 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.51
d2j5wa5149 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1aoza2209 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 99.51
d1sdda2116 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.35
d1sddb167 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.28
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 99.26
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 99.13
d1v10a1136 Laccase {Rigidoporus lignosus [TaxId: 219653]} 99.07
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 98.92
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 98.73
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 98.66
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 98.6
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 98.57
d1kv7a1140 multi-copper oxidase CueO {Escherichia coli [TaxId 98.48
d1kv7a2165 multi-copper oxidase CueO {Escherichia coli [TaxId 98.47
d1gska2174 Spore coat protein A, CotA {Bacillus subtilis [Tax 98.37
d2bw4a2173 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 98.32
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 98.31
d1sdda1180 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 97.95
d1gska1181 Spore coat protein A, CotA {Bacillus subtilis [Tax 97.86
d1kv7a3181 multi-copper oxidase CueO {Escherichia coli [TaxId 97.8
d1hfua3200 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 97.77
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 97.74
d1oe1a2177 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 97.66
d2j5wa3207 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 97.65
d1v10a3190 Laccase {Rigidoporus lignosus [TaxId: 219653]} 97.64
d1aoza3214 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 97.59
d2j5wa4179 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 97.59
d1gska3154 Spore coat protein A, CotA {Bacillus subtilis [Tax 97.54
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 97.47
d1gyca3199 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 97.43
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 97.39
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 97.33
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 97.32
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 97.32
d2j5wa1192 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 97.22
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 97.16
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 97.16
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 97.12
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 97.01
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 96.96
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 96.95
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 96.89
d2q9oa3216 Laccase {Melanocarpus albomyces [TaxId: 204285]} 96.88
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 96.71
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 96.62
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 96.47
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 96.13
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 96.03
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 96.03
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 95.85
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 95.01
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 94.92
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 94.72
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 94.59
d1sddb2139 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 94.58
d1v10a2168 Laccase {Rigidoporus lignosus [TaxId: 219653]} 94.45
d1aoza3214 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 94.19
d1kcwa2146 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 94.03
d1hfua2172 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 93.98
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 93.92
d2q9oa2181 Laccase {Melanocarpus albomyces [TaxId: 204285]} 93.8
d1gska3154 Spore coat protein A, CotA {Bacillus subtilis [Tax 93.74
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 93.25
d2j5wa2145 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 92.96
d2q9oa3 216 Laccase {Melanocarpus albomyces [TaxId: 204285]} 92.18
d1gyca3199 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 92.03
d1sdda2116 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 91.71
d1hfua3200 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 91.22
d1gyca2170 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 91.19
d1aoza2209 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 91.0
d1v10a3190 Laccase {Rigidoporus lignosus [TaxId: 219653]} 90.96
d2j5wa5149 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 90.91
d1mzya2178 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 90.36
d1kbva2151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 88.6
d1kv7a3181 multi-copper oxidase CueO {Escherichia coli [TaxId 88.03
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Multidomain cupredoxins
domain: Laccase
species: Rigidoporus lignosus [TaxId: 219653]

Probab=100.00  E-value=1.5e-33  Score=241.52  Aligned_cols=105  Identities=32%  Similarity=0.595  Sum_probs=99.1

Q ss_pred             CeEEEEEEcCCCCCCcEEeeccccCCCCCCCCCCceeEeCCEEEEEEEeCCCC----CceEEEEecccccCCCCCCCccc
Q psy13500         22 DTIVVDLHNKMPGRSTTIHWHGLTQRLTPHMDGVPMVCKGDTIVVDLHNKMPG----RSTTIHWHGLTQRLTPHMDGVPM   97 (396)
Q Consensus        22 dr~~i~vn~~~PgP~itiHwhG~~q~~~~~~DG~~~v~~Gd~v~v~v~N~l~~----~~ttiHwHGl~~~~t~~~DGvp~   97 (396)
                      .|.++.+||++|||+|                   ++++||+|+|+|+|+++.    +++||||||+++..++++||+++
T Consensus        21 ~~~~~~~nG~~PGP~i-------------------~~~~GD~v~v~~~N~l~~~~~~~~tsiH~HGl~~~~~~~~dgv~~   81 (136)
T d1v10a1          21 ARSAVTAEGTTIAPLI-------------------TGNIDDRFQINVIDQLTDANMRRATSIHWHGFFQAGTTEMDGPAF   81 (136)
T ss_dssp             CEEEEEESSSSSCCCE-------------------EEETTCEEEEEEEECCCCTTSCCCBCEEEETCCCTTCGGGSCCBT
T ss_pred             eeEEEEECCCccCCeE-------------------EEECCcEEEEEEEeCCCCcccCcceeEEecccccccccccCCCCc
Confidence            4789999999999999                   999999999999998762    68999999999999999999999


Q ss_pred             ccccccCCCCeEEEEEEec-cCceeeeeecCCccccCCeeeEEEEcCCC
Q psy13500         98 VTQCPILEGNVFRYKFLAD-AAGTYFWHSHDGFQKMDGIIGNLIIRQPR  145 (396)
Q Consensus        98 vtq~pI~PG~~f~Y~f~~~-~~GT~wYHsH~~~q~~~Gl~G~lIV~~~~  145 (396)
                      +|||||+||++|+|+|++. ++||+|||||++.|+.+||+|+|||++++
T Consensus        82 ~t~~~I~PG~~~~Y~~~~~~~~Gt~wYH~H~~~q~~~GL~G~liV~~~~  130 (136)
T d1v10a1          82 VNQCPIIPNESFVYDFVVPGQAGTYWYHSHLSTQYCDGLRGAFVVYDPN  130 (136)
T ss_dssp             TTBCCBCTTEEEEEEEECTTCCEEEEEEECSTTGGGGTCEEEEEEECTT
T ss_pred             cccceECCCCeEEEEEECCCCccceEEecCchhHHhCCCEEEEEECCCc
Confidence            9999999999999999985 69999999999999999999999999873
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sddb1 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kv7a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gska2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bw4a2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1oe1a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1gyca3 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1gyca3 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mzya2 b.6.1.3 (A:194-371) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure