Psyllid ID: psy13508

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-

MAEATRSHLPALSEDDMDSWIVEGDKKLSIDNETKFCSPNLLKNVLQCVKGNGDVYDPENILSLHEFVMKSSKGRGVHFMMADGGFSVEGQENIQEILSKRLYLCQFLVSLFIVRPEGHFVCKVFDMFTPFSAGLLYLLYRSYKQVCIFKPNTSRPANSERYIVCKWKRPDCDTIRDFMFKLNKRLDRYGSTSKRDIVSCVPLDIMKSDANFFDYLVTSNNTVFDELEGDQFFRARNRSNPFELIKNGPFLNRAAMKMANMDKRLNSMFTQPVRENGNGPFLNRAAMKMANMDKRLNSMFTQPVRENGSPLLGPGELLYFADVCAGPGGFSEYVLYRKKWRAKGIGFTLTGSHDFKLDDFFAGPSETFEPYYGVKGNGDVYDPENILSLHEFVMKSTKGRGVHFMMADGGFSVEGQENIQEILSKRLYLCQFLVSLFIVRPEGHFVCKVFDMFTPFSAGLLYLLYRSYKQVCIFKPNTSRPANSERYIVCKWKRPDCDTIRDFMFKLNKRLDRYGSTSKRDIVSCVPLDIMKSDANFFDYLVTSNNVINRIAGLGKHAIYRYREDSNRWVSETSLGIQLSPGTLVYGETVEEFKGQGASQVKLKTFHIIDAYLITGRSQVK

cHHHHHccccccccccccccEEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHccccEEEEEcccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccEEEcccccccccccccHHHHHccccccccccHHHHHHHccccccccccccccHHHHHHHHHccccccccccccHHHHcccccccccHHHHHHHHHHHHcccccccccccccccccccccccEEEEEccccHHHHHHHHHcccccccEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHccccEEEEEcccccccccccEEEEEcccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccccccccccccccHHHHHHHHHcccccccEEEHHHHHHHHHcccccccc

ccHHHHHHccccccccccccEEEcccccccccccHccccHHHcccccccccccccccHHHHHHHHHHHHHHcccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHccEEEEccccccccccEEEEEEcccccccHHHHHHHHHHHHHHccccccccccccHcccHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccHccccHHHHHHHHHHHHHHHHHccccccccHHccccccccccccEEEEEEcccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHccEEEEEccccccccccEEEEEEEccccccccHHHHHHHHHHHHHHHcccccccHHEEccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcccEEEEcccccEEEcEEEEEcccccccEEEEEEEEEEccEEEccccccc

maeatrshlpalseddmdswivegdkklsidnetkfcspnllKNVLQCVkgngdvydpeniLSLHEFVMksskgrgvhfmmadggfsvegQENIQEILSKRLYLCQFLVSLFivrpeghfvckvfdmftpfsAGLLYLLYRSYKQVcifkpntsrpanseryivckwkrpdcdtIRDFMFKLNKRldrygstskrdivscvpldimksdanFFDYLVTSnntvfdelegdqffrarnrsnpfelikngpfLNRAAMKMANMDKRLnsmftqpvrengngpflNRAAMKMANMDKRLnsmftqpvrengspllgpgellyfadvcagpggfsEYVLYRKKWRAkgigftltgshdfklddffagpsetfepyygvkgngdvydpeniLSLHEFVMKstkgrgvhfmmadggfsvegQENIQEILSKRLYLCQFLVSLFivrpeghfvckvfdmftpfsAGLLYLLYRSYKQVcifkpntsrpanseryivckwkrpdcdtIRDFMFKLNKRldrygstskrdivscvpldimksdanFFDYLVTSNNVINRIAGLGKHAIYryredsnrwvsetslgiqlspgtlvygetveefkgqgasqvkLKTFHIIDAYLITGRSQVK

maeatrshlpalseddmdsWIVEGDKKLSIDNETKFCSPNLLKNVLQCVKGNGDVYDPENILSLHEFVMKSSKGRGVHFMMADGGFSVEGQENIQEILSKRLYLCQFLVSLFIVRPEGHFVCKVFDMFTPFSAGLLYLLYRSYKQVCIfkpntsrpanseryivckwkrpdcdTIRDFMFKLNkrldrygstskrdivscvpLDIMKSDANFFDYLVTSNNTVFDELEGDQFfrarnrsnpfelikngpfLNRAAMKMANMDKRLNSMFTQPVRENGNGPFLNRAAMKMANMDKRLNSMFTQPVRENGSPLLGPGELLYFADVCAGPGGFSEYVLYRKKWRAKGIGFTLTGSHDFKLDDFFAGPSETFEPYYGVKGNGDVYDPENILSLHEFVMKSTKGRGVHFMMADGGFSVEGQENIQEILSKRLYLCQFLVSLFIVRPEGHFVCKVFDMFTPFSAGLLYLLYRSYKQVCIfkpntsrpanseryivckwkrpdcdTIRDFMFKLNkrldrygstskrdivscvpLDIMKSDANFFDYLVTSNNVINRIAGLGKHAIYRYREDSNRWVSETSLGIQLSPGTLVYGETVEEFKgqgasqvklktFHIIDAYLITGRSQVK

*******************WIVEGDKKLSIDNETKFCSPNLLKNVLQCVKGNGDVYDPENILSLHEFVMKSSKGRGVHFMMADGGFSVEGQENIQEILSKRLYLCQFLVSLFIVRPEGHFVCKVFDMFTPFSAGLLYLLYRSYKQVCIFKPNTSRPANSERYIVCKWKRPDCDTIRDFMFKLNKRLDRYGSTSKRDIVSCVPLDIMKSDANFFDYLVTSNNTVFDELEGDQFFRARNRSNPFELIKNGPFLN**********************************************************LLGPGELLYFADVCAGPGGFSEYVLYRKKWRAKGIGFTLTGSHDFKLDDFFAGPSETFEPYYGVKGNGDVYDPENILSLHEFVMKSTKGRGVHFMMADGGFSVEGQENIQEILSKRLYLCQFLVSLFIVRPEGHFVCKVFDMFTPFSAGLLYLLYRSYKQVCIFKPNTSRPANSERYIVCKWKRPDCDTIRDFMFKLNKRLDRYGSTSKRDIVSCVPLDIMKSDANFFDYLVTSNNVINRIAGLGKHAIYRYREDSNRWVSETSLGIQLSPGTLVYGETVEEFKGQGASQVKLKTFHIIDAYLIT******

*********PALSEDDMDSWIVEGDKKLSIDNETKFCSPNLLKNVLQCVKGNGDVYDPENILSLHEFVMKSSKGRGVHFMMADGGFSVEGQENIQEILSKRLYLCQFLVSLFIVRPEGHFVCKVFDMFTPFSAGLLYLLYRSYKQVCIFKPNT*****SERYIVCKWKRPDCDTIRDFMFKLNKRLDRYGSTSKRDIVSCVPLDIMKSDANFFDYLVTSNNTVFDELEGDQFFRARNRSNPFELIKNGPFLNRAAMKMANMDKRLNSMFTQPVRENGNGPFLNRAAMKMANMDKRLNSMFTQPVRENGSPLLGPGELLYFADVCAGPGGFSEYVLYRKKWRAKGIGFTLTGSHDFKLDDFFAGPSETFEPYYGVKGNGDVYDPENILSLHEFVMKSTKGRGVHFMMADGGFSVEGQENIQEILSKRLYLCQFLVSLFIVRPEGHFVCKVFDMFTPFSAGLLYLLYRSYKQVCIFKPNTSRPANSERYIVCKWKRPDCDTIRDFMFKLNKRLDRYGSTSKRDIVSCVPLDIMKSDANFFDYLVTSNNVINRIAGLGKHAIYRYREDSNRWVSETSLGIQLSPGTLVYGETVEEFKGQGASQVKLKTFHIIDAYLITGRS***

********LPALSEDDMDSWIVEGDKKLSIDNETKFCSPNLLKNVLQCVKGNGDVYDPENILSLHEFVMKSSKGRGVHFMMADGGFSVEGQENIQEILSKRLYLCQFLVSLFIVRPEGHFVCKVFDMFTPFSAGLLYLLYRSYKQVCIFKPNTSRPANSERYIVCKWKRPDCDTIRDFMFKLNKRLDRYGSTSKRDIVSCVPLDIMKSDANFFDYLVTSNNTVFDELEGDQFFRARNRSNPFELIKNGPFLNRAAMKMANMDKRLNSMFTQPVRENGNGPFLNRAAMKMANMDKRLNSMFTQPVRENGSPLLGPGELLYFADVCAGPGGFSEYVLYRKKWRAKGIGFTLTGSHDFKLDDFFAGPSETFEPYYGVKGNGDVYDPENILSLHEFVMKSTKGRGVHFMMADGGFSVEGQENIQEILSKRLYLCQFLVSLFIVRPEGHFVCKVFDMFTPFSAGLLYLLYRSYKQVCIFKPNTSRPANSERYIVCKWKRPDCDTIRDFMFKLNKRLDRYGSTSKRDIVSCVPLDIMKSDANFFDYLVTSNNVINRIAGLGKHAIYRYREDSNRWVSETSLGIQLSPGTLVYGETVEEFKGQGASQVKLKTFHIIDAYLITGR****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		621	2.2.26 [Sep-21-2011]
Q803R5		829	Cap-specific mRNA (nucleo	yes	N/A	0.560	0.419	0.502	1e-101
Q6GQ76		846	Cap-specific mRNA (nucleo	N/A	N/A	0.568	0.417	0.468	4e-95
D2HRF1		835	Cap-specific mRNA (nucleo	yes	N/A	0.479	0.356	0.531	2e-92
A2VE39		835	Cap-specific mRNA (nucleo	yes	N/A	0.483	0.359	0.522	8e-92
Q5R981		835	Cap-specific mRNA (nucleo	yes	N/A	0.483	0.359	0.525	2e-91
Q8N1G2		835	Cap-specific mRNA (nucleo	yes	N/A	0.483	0.359	0.525	2e-91
Q9W4N2		788	Cap-specific mRNA (nucleo	yes	N/A	0.502	0.395	0.494	2e-90
Q9DBC3		837	Cap-specific mRNA (nucleo	yes	N/A	0.508	0.377	0.504	4e-90
Q5U2Z5		837	Cap-specific mRNA (nucleo	yes	N/A	0.508	0.377	0.501	5e-90
A8XYX2		874	Cap-specific mRNA (nucleo	N/A	N/A	0.516	0.367	0.489	2e-85

>sp\|Q803R5\|MTR1_DANRE Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Danio rerio GN=ftsjd2 PE=2 SV=1	Back alignment and function desciption

 Score =  368 bits (945), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 200/398 (50%), Positives = 255/398 (64%), Gaps = 50/398 (12%)

Query: 170 PDCDTIRDFMFKLNKRLDRYGSTSKRDIVSCVPLDIMKSDANFFDYLVTSNNTVFDELEG 229
           PD D +RD+M    K+L              +  +I     N   +L+    TVFD+LEG
Sbjct: 158 PDSDELRDWMTIGEKKLK-------------IDDEIEFCSENLL-HLLLRCKTVFDDLEG 203

Query: 230 DQFFRARNRSNPFELIKNGPFLNRAAMKMANMDKRLNSMFTQPVRENGNGPFLNRAAMKM 289
           ++  RAR RSNP+E I+   FLNRAAMKMANMD   + MFT P  ++  G  L R     
Sbjct: 204 EEMRRARTRSNPYETIRGAFFLNRAAMKMANMDHVFDYMFTNP--KDSQGKVLTR----- 256

Query: 290 ANMDKRLNSMFTQPVRENGSPLLGPGELLYFADVCAGPGGFSEYVLYRKKWRAKGIGFTL 349
              DK                    GELLYF DVCAGPGGFSEYVL+R++W AKG G TL
Sbjct: 257 ---DKE-------------------GELLYFGDVCAGPGGFSEYVLWRRRWHAKGFGMTL 294

Query: 350 TGSHDFKLDDFFAGPSETFEPYYGVKGNGDVYD---PENILSLHEFVMKSTKGRGVHFMM 406
            G++DFKL+DF+A PSE FE YYG  G     D   PENI +   FV+ ST+GRG+HF+M
Sbjct: 295 KGANDFKLEDFYAAPSELFEAYYGEGGIDGDGDITRPENISAFRNFVLDSTEGRGLHFLM 354

Query: 407 ADGGFSVEGQENIQEILSKRLYLCQFLVSLFIVRPEGHFVCKVFDMFTPFSAGLLYLLYR 466
           ADGGFSVEGQEN+QEILSK+L LCQFL +L +VRP GHF+CK FD+FTPFS GL+YLLY 
Sbjct: 355 ADGGFSVEGQENLQEILSKQLLLCQFLTALSVVRPGGHFLCKTFDLFTPFSVGLIYLLYL 414

Query: 467 SYKQVCIFKPNTSRPANSERYIVCKWKRPDCDTIRDFMFKLNKRLDRYGSTSKRDIVSCV 526
            +++V +FKP TSRPANSERY+VCK  +P  D +R++MF +N +L+++   S RD++  V
Sbjct: 415 CFERVSLFKPVTSRPANSERYVVCKGLKPGTDAVREYMFTINLKLNQF-RHSDRDVIEVV 473

Query: 527 PLDIMKSDANFFDYLVTSNN--VINRIAGLGK-HAIYR 561
           PLDI+K D +FF Y++ SN      +I  L K HA  R
Sbjct: 474 PLDIIKGDTDFFQYMIGSNESYCAVQIKALAKIHAYVR 511

S-adenosyl-L-methionine-dependent methyltransferase that mediates mRNA cap1 2'-O-ribose methylation to the 5'-cap structure of mRNAs. Methylates the ribose of the first nucleotide of a m(7)GpppG-capped mRNA to produce m(7)GpppNmp (cap1). Cap1 modification is linked to higher levels of translation.
Danio rerio (taxid: 7955)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 5EC: 7

>sp\|Q6GQ76\|MTR1_XENLA Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Xenopus laevis GN=ftsjd2 PE=2 SV=1	Back alignment and function description

>sp\|D2HRF1\|MTR1_AILME Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Ailuropoda melanoleuca GN=FTSJD2 PE=3 SV=1	Back alignment and function description

>sp\|A2VE39\|MTR1_BOVIN Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Bos taurus GN=FTSJD2 PE=2 SV=1	Back alignment and function description

>sp\|Q5R981\|MTR1_PONAB Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Pongo abelii GN=FTSJD2 PE=2 SV=1	Back alignment and function description

>sp\|Q8N1G2\|MTR1_HUMAN Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Homo sapiens GN=FTSJD2 PE=1 SV=1	Back alignment and function description

>sp\|Q9W4N2\|MTR1_DROME Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Drosophila melanogaster GN=CG6379 PE=2 SV=1	Back alignment and function description

>sp\|Q9DBC3\|MTR1_MOUSE Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Mus musculus GN=Ftsjd2 PE=1 SV=1	Back alignment and function description

>sp\|Q5U2Z5\|MTR1_RAT Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Rattus norvegicus GN=Ftsjd2 PE=2 SV=1	Back alignment and function description

>sp\|A8XYX2\|MTR1A_CAEBR Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1A OS=Caenorhabditis briggsae GN=CBG20906 PE=3 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		621
321463616		742	hypothetical protein DAPPUDRAFT_307206 [	0.526	0.440	0.560	1e-110
427793847		945	Putative ftsj-like rna methyltransferase	0.479	0.315	0.572	1e-105
345495762		893	PREDICTED: cap-specific mRNA (nucleoside	0.515	0.358	0.537	1e-102
328717828		927	PREDICTED: cap-specific mRNA (nucleoside	0.521	0.349	0.520	1e-100
427793713		990	Putative ftsj-like rna methyltransferase	0.479	0.301	0.501	3e-99
41055983		829	cap-specific mRNA (nucleoside-2'-O-)-met	0.560	0.419	0.502	5e-99
242015838		703	conserved hypothetical protein [Pediculu	0.468	0.413	0.573	2e-96
357619209		961	hypothetical protein KGM_20770 [Danaus p	0.483	0.312	0.536	3e-96
170042033		769	conserved hypothetical protein [Culex qu	0.510	0.412	0.524	1e-95
307184308		775	Uncharacterized protein KIAA0082-like pr	0.518	0.415	0.511	2e-95

>gi\|321463616\|gb\|EFX74631.1\| hypothetical protein DAPPUDRAFT_307206 [Daphnia pulex]	Back alignment and taxonomy information

 Score =  406 bits (1043), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 207/369 (56%), Positives = 255/369 (69%), Gaps = 42/369 (11%)

Query: 217 VTSNNTVFDELEGDQFFRARNRSNPFELIKNGPFLNRAAMKMANMDKRLNSMFTQPVREN 276
           V    ++FD LE ++  +AR RSNPFE I+ G F                          
Sbjct: 102 VLQCKSIFDVLEEEELRKARTRSNPFETIR-GAF-------------------------- 134

Query: 277 GNGPFLNRAAMKMANMDKRLNSMFTQPVRENGSPLLGPGELLYFADVCAGPGGFSEYVLY 336
               FLNRAAMKMANMD   + MFT P  E+G+P+LGP ELLYFADVCAGPGGFSEY+L+
Sbjct: 135 ----FLNRAAMKMANMDAVFDFMFTDPRNEDGTPVLGPNELLYFADVCAGPGGFSEYILW 190

Query: 337 RKKWRAKGIGFTLTGSHDFKLDDFFAGPSETFEPYYGV---KGNGDVYDPENILSLHEFV 393
           RKKW AKG GFTL  S+DFKL+DF A P E FEP+YGV   +GNGDVY+PENI     FV
Sbjct: 191 RKKWEAKGFGFTLKSSNDFKLEDFHAAPCECFEPHYGVGGVEGNGDVYNPENIREFQRFV 250

Query: 394 MKSTKGRGVHFMMADGGFSVEGQENIQEILSKRLYLCQFLVSLFIVRPEGHFVCKVFDMF 453
           M  T G GVHFMMADGGFSVEGQEN+QEILSKRLYLCQFLV+L IVR  GHFVCK+FD+F
Sbjct: 251 MAQT-GEGVHFMMADGGFSVEGQENLQEILSKRLYLCQFLVALSIVRTGGHFVCKLFDLF 309

Query: 454 TPFSAGLLYLLYRSYKQVCIFKPNTSRPANSERYIVCKWKRPDCDTIRDFMFKLNKRLDR 513
           TPFSAGL+YL+YRS+KQ+ I KPNTSRPANSERYI+CKWKR D   +  ++F++N+RLD+
Sbjct: 310 TPFSAGLVYLMYRSFKQISIHKPNTSRPANSERYIICKWKRSDTQDVETYLFEINRRLDK 369

Query: 514 YG-STSKRDIVSCVPLDIMKSDANFFDYLVTSNNVIN--RIAGLGKHAIY----RYREDS 566
              S ++ D++  VPLD+M +  +F++YL  SNN +   ++  L K A +      RED 
Sbjct: 370 LSNSKTETDVMHIVPLDLMTNHHDFYNYLFESNNDLGERQVVNLAKIAAFCKDVTLREDR 429

Query: 567 NRWVSETSL 575
              + + SL
Sbjct: 430 QSELKKQSL 438

Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|427793847\|gb\|JAA62375.1\| Putative ftsj-like rna methyltransferase, partial [Rhipicephalus pulchellus]	Back alignment and taxonomy information

>gi\|345495762\|ref\|XP_001606646.2\| PREDICTED: cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1-like [Nasonia vitripennis]	Back alignment and taxonomy information

>gi\|328717828\|ref\|XP_001943568.2\| PREDICTED: cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1-like [Acyrthosiphon pisum]	Back alignment and taxonomy information

>gi\|427793713\|gb\|JAA62308.1\| Putative ftsj-like rna methyltransferase, partial [Rhipicephalus pulchellus]	Back alignment and taxonomy information

>gi|41055983|ref|NP_956427.1| cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 [Danio rerio] gi|82177092|sp|Q803R5.1|MTR1_DANRE RecName: Full=Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1; AltName: Full=Cap1 2'O-ribose methyltransferase 1; Short=MTr1; AltName: Full=FtsJ methyltransferase domain-containing protein 2 gi|27881850|gb|AAH44371.1| FtsJ methyltransferase domain containing 2 [Danio rerio]

Back alignment and taxonomy information

>gi\|242015838\|ref\|XP_002428554.1\| conserved hypothetical protein [Pediculus humanus corporis] gi\|212513188\|gb\|EEB15816.1\| conserved hypothetical protein [Pediculus humanus corporis]	Back alignment and taxonomy information

>gi\|357619209\|gb\|EHJ71879.1\| hypothetical protein KGM_20770 [Danaus plexippus]	Back alignment and taxonomy information

>gi\|170042033\|ref\|XP_001848746.1\| conserved hypothetical protein [Culex quinquefasciatus] gi\|167865569\|gb\|EDS28952.1\| conserved hypothetical protein [Culex quinquefasciatus]	Back alignment and taxonomy information

>gi\|307184308\|gb\|EFN70766.1\| Uncharacterized protein KIAA0082-like protein [Camponotus floridanus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		621
ZFIN\|ZDB-GENE-040426-696		829	ftsjd2 "FtsJ methyltransferase	0.450	0.337	0.591	5.9e-124
UNIPROTKB\|Q6GQ76		846	ftsjd2 "Cap-specific mRNA (nuc	0.458	0.336	0.570	1.9e-112
UNIPROTKB\|F1NAT2		789	FTSJD2 "Uncharacterized protei	0.425	0.334	0.611	3.1e-112
UNIPROTKB\|Q8N1G2		835	FTSJD2 "Cap-specific mRNA (nuc	0.425	0.316	0.6	3.9e-106
UNIPROTKB\|Q5R981		835	FTSJD2 "Cap-specific mRNA (nuc	0.425	0.316	0.6	3.9e-106
UNIPROTKB\|A2VE39		835	FTSJD2 "Cap-specific mRNA (nuc	0.425	0.316	0.596	5e-106
UNIPROTKB\|D2HRF1		835	FTSJD2 "Cap-specific mRNA (nuc	0.425	0.316	0.6	6.4e-106
UNIPROTKB\|F1PGE5		835	FTSJD2 "Uncharacterized protei	0.425	0.316	0.596	8.1e-106
MGI\|MGI:1921407		837	Ftsjd2 "FtsJ methyltransferase	0.425	0.315	0.6	1.5e-104
RGD\|1307801		837	Ftsjd2 "FtsJ methyltransferase	0.425	0.315	0.596	1.9e-104

ZFIN\|ZDB-GENE-040426-696 ftsjd2 "FtsJ methyltransferase domain containing 2" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

 Score = 895 (320.1 bits), Expect = 5.9e-124, Sum P(4) = 5.9e-124
 Identities = 171/289 (59%), Positives = 215/289 (74%)

Query:   281 FLNRAAMKMANMDKRLNSMFTQPVRENGSPLLGP--GELLYFADVCAGPGGFSEYVLYRK 338
             FLNRAAMKMANMD   + MFT P    G  L     GELLYF DVCAGPGGFSEYVL+R+
Sbjct:   224 FLNRAAMKMANMDHVFDYMFTNPKDSQGKVLTRDKEGELLYFGDVCAGPGGFSEYVLWRR 283

Query:   339 KWRAKGIGFTLTGSHDFKLDDFFAGPSETFEPYYG---VKGNGDVYDPENILSLHEFVMK 395
             +W AKG G TL G++DFKL+DF+A PSE FE YYG   + G+GD+  PENI +   FV+ 
Sbjct:   284 RWHAKGFGMTLKGANDFKLEDFYAAPSELFEAYYGEGGIDGDGDITRPENISAFRNFVLD 343

Query:   396 STKGRGVHFMMADGGFSVEGQENIQEILSKRLYLCQFLVSLFIVRPEGHFVCKVFDMFTP 455
             ST+GRG+HF+MADGGFSVEGQEN+QEILSK+L LCQFL +L +VRP GHF+CK FD+FTP
Sbjct:   344 STEGRGLHFLMADGGFSVEGQENLQEILSKQLLLCQFLTALSVVRPGGHFLCKTFDLFTP 403

Query:   456 FSAGLLYLLYRSYKQVCIFKPNTSRPANSERYIVCKWKRPDCDTIRDFMFKLNKRLDRYG 515
             FS GL+YLLY  +++V +FKP TSRPANSERY+VCK  +P  D +R++MF +N +L+++ 
Sbjct:   404 FSVGLIYLLYLCFERVSLFKPVTSRPANSERYVVCKGLKPGTDAVREYMFTINLKLNQFR 463

Query:   516 STSKRDIVSCVPLDIMKSDANFFDYLVTSNN--VINRIAGLGK-HAIYR 561
               S RD++  VPLDI+K D +FF Y++ SN      +I  L K HA  R
Sbjct:   464 H-SDRDVIEVVPLDIIKGDTDFFQYMIGSNESYCAVQIKALAKIHAYVR 511

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0008168 "methyltransferase activity" evidence=IEA

GO:0032259 "methylation" evidence=IEA

GO:0004483 "mRNA (nucleoside-2'-O-)-methyltransferase activity" evidence=IEA;ISS

GO:0006370 "7-methylguanosine mRNA capping" evidence=IEA;ISS

GO:0080009 "mRNA methylation" evidence=ISS

GO:0006397 "mRNA processing" evidence=IEA

GO:0005634 "nucleus" evidence=IEA

GO:0016740 "transferase activity" evidence=IEA

UNIPROTKB\|Q6GQ76 ftsjd2 "Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1" [Xenopus laevis (taxid:8355)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NAT2 FTSJD2 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8N1G2 FTSJD2 "Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5R981 FTSJD2 "Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1" [Pongo abelii (taxid:9601)]	Back alignment and assigned GO terms

UNIPROTKB\|A2VE39 FTSJD2 "Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|D2HRF1 FTSJD2 "Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1" [Ailuropoda melanoleuca (taxid:9646)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PGE5 FTSJD2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

MGI\|MGI:1921407 Ftsjd2 "FtsJ methyltransferase domain containing 2" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1307801 Ftsjd2 "FtsJ methyltransferase domain containing 2" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9DBC3	MTR1_MOUSE	2, ., 1, ., 1, ., 5, 7	0.5042	0.5088	0.3775	yes	N/A
D2HRF1	MTR1_AILME	2, ., 1, ., 1, ., 5, 7	0.5313	0.4798	0.3568	yes	N/A
Q5U2Z5	MTR1_RAT	2, ., 1, ., 1, ., 5, 7	0.5014	0.5088	0.3775	yes	N/A
Q803R5	MTR1_DANRE	2, ., 1, ., 1, ., 5, 7	0.5025	0.5603	0.4197	yes	N/A
Q5R981	MTR1_PONAB	2, ., 1, ., 1, ., 5, 7	0.5255	0.4830	0.3592	yes	N/A
Q8N1G2	MTR1_HUMAN	2, ., 1, ., 1, ., 5, 7	0.5255	0.4830	0.3592	yes	N/A
A2VE39	MTR1_BOVIN	2, ., 1, ., 1, ., 5, 7	0.5225	0.4830	0.3592	yes	N/A

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.1.1	0.691
4th Layer	2.1.1.57	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		621
pfam01728		177	pfam01728, FtsJ, FtsJ-like methyltransferase	3e-41
pfam01728		177	pfam01728, FtsJ, FtsJ-like methyltransferase	5e-27
COG0293		205	COG0293, FtsJ, 23S rRNA methylase [Translation, ri	1e-10
COG0293		205	COG0293, FtsJ, 23S rRNA methylase [Translation, ri	1e-08
TIGR00438		188	TIGR00438, rrmJ, cell division protein FtsJ	3e-05
TIGR00438		188	TIGR00438, rrmJ, cell division protein FtsJ	7e-04

>gnl\|CDD\|216666 pfam01728, FtsJ, FtsJ-like methyltransferase	Back alignment and domain information

 Score =  147 bits (373), Expect = 3e-41
 Identities = 70/213 (32%), Positives = 105/213 (49%), Gaps = 36/213 (16%)

Query: 281 FLNRAAMKMANMDKRLNSMFTQPVRENGSPLLGPGELLYFADVCAGPGGFSEYVLYRKKW 340
           +++RAA K+  +D+R                L PG+     D+ A PGGFS+ +L R   
Sbjct: 1   YVSRAAYKLLEIDERFG--------------LKPGKGKTVLDLGAAPGGFSQVLLERGG- 45

Query: 341 RAKGIGFTLTGSHDFKLDDFFAGPSETFEPYYGVKGNGDVYDPENILSLHEFVMKSTKGR 400
             K +   L             GP E  +  Y ++G  D+ DPE +  L E +       
Sbjct: 46  AGKVVAVDL-------------GPMEPIQGVYFLRG--DITDPETLEKLRELL-----PG 85

Query: 401 GVHFMMADGGFSVEGQENIQEILSKRLYLCQFLVSLFIVRPEGHFVCKVFDMFTPFSAGL 460
            V  +++DG  +V G EN    +S +L L   L++L ++RP G+FV KVF  F  FS  L
Sbjct: 86  KVDLVLSDGAPNVSGIENTDSFISLQLVLAALLLALEVLRPGGNFVVKVFKGFE-FSVEL 144

Query: 461 LYLLYRSYKQVCIFKPNTSRPANSERYIVCKWK 493
           L  L + +++V IFKP  SRP++SE Y+VC   
Sbjct: 145 LEKLKKGFEKVGIFKPPASRPSSSEEYLVCLGF 177

This family consists of FtsJ from various bacterial and archaeal sources FtsJ is a methyltransferase, but actually has no effect on cell division. FtsJ's substrate is the 23S rRNA. The 1.5 A crystal structure of FtsJ in complex with its cofactor S-adenosylmethionine revealed that FtsJ has a methyltransferase fold. This family also includes the N terminus of flaviviral NS5 protein. It has been hypothesised that the N-terminal domain of NS5 is a methyltransferase involved in viral RNA capping. Length = 177

>gnl\|CDD\|216666 pfam01728, FtsJ, FtsJ-like methyltransferase	Back alignment and domain information

>gnl\|CDD\|223370 COG0293, FtsJ, 23S rRNA methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|223370 COG0293, FtsJ, 23S rRNA methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|232976 TIGR00438, rrmJ, cell division protein FtsJ	Back alignment and domain information

>gnl\|CDD\|232976 TIGR00438, rrmJ, cell division protein FtsJ	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		621
1ej0_A		180	FTSJ; methyltransferase, adoMet, adenosyl methioni	9e-12
1ej0_A		180	FTSJ; methyltransferase, adoMet, adenosyl methioni	2e-09
2nyu_A		196	Putative ribosomal RNA methyltransferase 2; SAM, s	1e-11
2nyu_A		196	Putative ribosomal RNA methyltransferase 2; SAM, s	9e-09
3evf_A		277	RNA-directed RNA polymerase NS5; NS5 methyltransfe	1e-10
3evf_A		277	RNA-directed RNA polymerase NS5; NS5 methyltransfe	6e-06
3dou_A		191	Ribosomal RNA large subunit methyltransferase J; c	4e-10
3dou_A		191	Ribosomal RNA large subunit methyltransferase J; c	4e-09
2plw_A		201	Ribosomal RNA methyltransferase, putative; malaria	6e-10
2plw_A		201	Ribosomal RNA methyltransferase, putative; malaria	3e-07
3eld_A		300	Methyltransferase; flavivirus, RNA capping, guanyl	4e-09
3eld_A		300	Methyltransferase; flavivirus, RNA capping, guanyl	2e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-08

>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Length = 180	Back alignment and structure

 Score = 63.2 bits (155), Expect = 9e-12
 Identities = 46/215 (21%), Positives = 80/215 (37%), Gaps = 42/215 (19%)

Query: 284 RAAMKMANMDKRLNSMFTQPVRENGSPLLGPGELLYFADVCAGPGGFSEYVLYRKKWRAK 343
           RA  K+  + +                L  PG  +   D+ A PGG+S+YV+ +   + +
Sbjct: 5   RAWFKLDEIQQSDK-------------LFKPGMTV--VDLGAAPGGWSQYVVTQIGGKGR 49

Query: 344 GIGFTLTGSHDFKLDDFFAGPSETFEPYYGVKG-NGDVYDPENILSLHEFVMKSTKGRGV 402
            I        D              +P  GV    GD  D        + +++      V
Sbjct: 50  IIAC------DLL----------PMDPIVGVDFLQGDFRDELV----MKALLERVGDSKV 89

Query: 403 HFMMADGGFSVEGQENIQEILSKRLYLCQFLVSLFIVRPEGHFVCKVFD--MFTPFSAGL 460
             +M+D   ++ G   +    +  L      +   ++ P G FV KVF    F       
Sbjct: 90  QVVMSDMAPNMSGTPAVDIPRAMYLVELALEMCRDVLAPGGSFVVKVFQGEGFDE----Y 145

Query: 461 LYLLYRSYKQVCIFKPNTSRPANSERYIVCKWKRP 495
           L  +   + +V + KP++SR  + E YIV   ++P
Sbjct: 146 LREIRSLFTKVKVRKPDSSRARSREVYIVATGRKP 180

PyMOL of 1ej0

>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Length = 180	Back alignment and structure

>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Length = 196	Back alignment and structure

>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Length = 196	Back alignment and structure

>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Length = 277	Back alignment and structure

>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Length = 277	Back alignment and structure

>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} Length = 191	Back alignment and structure

>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} Length = 191	Back alignment and structure

>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Length = 201	Back alignment and structure

>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Length = 201	Back alignment and structure

>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Length = 300	Back alignment and structure

>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Length = 300	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		621
2px2_A		269	Genome polyprotein [contains: capsid protein C (co	100.0
3dou_A		191	Ribosomal RNA large subunit methyltransferase J; c	100.0
3eld_A		300	Methyltransferase; flavivirus, RNA capping, guanyl	100.0
3gcz_A		282	Polyprotein; flavivirus, RNA capping, methyltransf	100.0
3evf_A		277	RNA-directed RNA polymerase NS5; NS5 methyltransfe	100.0
3p8z_A		267	Mtase, non-structural protein 5; methyltransferase	99.96
2plw_A		201	Ribosomal RNA methyltransferase, putative; malaria	99.94
3lkz_A		321	Non-structural protein 5; flavivirus, methyltransf	99.94
2nyu_A		196	Putative ribosomal RNA methyltransferase 2; SAM, s	99.93
2oxt_A		265	Nucleoside-2'-O-methyltransferase; flavivirus, vir	99.91
2px2_A		269	Genome polyprotein [contains: capsid protein C (co	99.91
2p41_A		305	Type II methyltransferase; vizier, viral enzymes i	99.91
3r24_A		344	NSP16, 2'-O-methyl transferase; methyltransferase,	99.9
2wa2_A		276	Non-structural protein 5; transferase, S-adenosyl-	99.89
3dou_A		191	Ribosomal RNA large subunit methyltransferase J; c	99.88
3gcz_A		282	Polyprotein; flavivirus, RNA capping, methyltransf	99.86
3eld_A		300	Methyltransferase; flavivirus, RNA capping, guanyl	99.86
3evf_A		277	RNA-directed RNA polymerase NS5; NS5 methyltransfe	99.85
3r24_A		344	NSP16, 2'-O-methyl transferase; methyltransferase,	99.85
1ej0_A		180	FTSJ; methyltransferase, adoMet, adenosyl methioni	99.83
2hwk_A		320	Helicase NSP2; rossman fold, alpha/beta/alpha, mul	99.77
2hwk_A		320	Helicase NSP2; rossman fold, alpha/beta/alpha, mul	99.74
3p8z_A		267	Mtase, non-structural protein 5; methyltransferase	99.59
2xyq_A		290	Putative 2'-O-methyl transferase; transferase-vira	99.57
4auk_A		375	Ribosomal RNA large subunit methyltransferase M; Y	99.57
2plw_A		201	Ribosomal RNA methyltransferase, putative; malaria	99.49
3lkz_A		321	Non-structural protein 5; flavivirus, methyltransf	99.46
2nyu_A		196	Putative ribosomal RNA methyltransferase 2; SAM, s	99.44
2p41_A		305	Type II methyltransferase; vizier, viral enzymes i	99.43
2oxt_A		265	Nucleoside-2'-O-methyltransferase; flavivirus, vir	99.37
2wa2_A		276	Non-structural protein 5; transferase, S-adenosyl-	99.31
2xyq_A		290	Putative 2'-O-methyl transferase; transferase-vira	99.02
1ej0_A		180	FTSJ; methyltransferase, adoMet, adenosyl methioni	99.0
3hp7_A		291	Hemolysin, putative; structural genomics, APC64019	98.93
3id6_C		232	Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase;	98.86
3lpm_A		259	Putative methyltransferase; structural genomics, p	98.43
3opn_A		232	Putative hemolysin; structural genomics, PSI-2, pr	98.35
3mti_A		185	RRNA methylase; SAM-dependent, PSI, MCSG, structur	98.3
4df3_A		233	Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase;	98.29
2ozv_A		260	Hypothetical protein ATU0636; structural genomics,	98.28
3ajd_A		274	Putative methyltransferase MJ0026; tRNA, M5C, ross	98.26
2ipx_A		233	RRNA 2'-O-methyltransferase fibrillarin; FBL, stru	98.25
3m6w_A		464	RRNA methylase; rRNA methyltransferase, 5-methylcy	98.21
3m4x_A		456	NOL1/NOP2/SUN family protein; mtase domain, PUA do	98.2
1ixk_A		315	Methyltransferase; open beta sheet; 1.90A {Pyrococ	98.16
1sqg_A		429	SUN protein, FMU protein; rossmann-fold, mixed bet	98.14
2frx_A		479	Hypothetical protein YEBU; rossmann-type S-adenosy	98.11
4dzr_A		215	Protein-(glutamine-N5) methyltransferase, release	98.1
3eey_A		197	Putative rRNA methylase; rRNA methylation, S-adeno	98.09
1nt2_A		210	Fibrillarin-like PRE-rRNA processing protein; adeM	98.08
3sso_A		419	Methyltransferase; macrolide, natural product, ros	98.06
2yxl_A		450	PH0851 protein, 450AA long hypothetical FMU protei	98.05
2bm8_A		236	Cephalosporin hydroxylase CMCI; cephamycin biosynt	98.02
4fzv_A		359	Putative methyltransferase NSUN4; mterf fold, meth	98.01
2b9e_A		309	NOL1/NOP2/SUN domain family, member 5 isoform 2; m	97.98
1g8a_A		227	Fibrillarin-like PRE-rRNA processing protein; rRNA	97.91
3a27_A		272	TYW2, uncharacterized protein MJ1557; wybutosine m	97.88
3trk_A		324	Nonstructural polyprotein; hydrolase; 2.40A {Chiku	97.87
4auk_A		375	Ribosomal RNA large subunit methyltransferase M; Y	97.87
1dus_A		194	MJ0882; hypothetical protein, methanococcus jannas	97.81
3hm2_A		178	Precorrin-6Y C5,15-methyltransferase; alpha-beta-s	97.81
3evz_A		230	Methyltransferase; NYSGXRC, NEW YORK SGX research	97.79
3e23_A		211	Uncharacterized protein RPA2492; alpha-beta protei	97.78
3e8s_A		227	Putative SAM dependent methyltransferase; NP_74470	97.75
3hem_A		302	Cyclopropane-fatty-acyl-phospholipid synthase 2; p	97.73
3h2b_A		203	SAM-dependent methyltransferase; alpha-beta protei	97.72
3cgg_A		195	SAM-dependent methyltransferase; NP_600671.1, meth	97.7
3dh0_A		219	SAM dependent methyltransferase; cystal structure,	97.69
1fbn_A		230	MJ fibrillarin homologue; MJ proteins, ribosomal R	97.68
2b3t_A		276	Protein methyltransferase HEMK; translation termin	97.66
3mb5_A		255	SAM-dependent methyltransferase; RNA methyltransfe	97.62
3ujc_A		266	Phosphoethanolamine N-methyltransferase; parasite;	97.6
3gjy_A		317	Spermidine synthase; APC62791, structural genomics	97.6
3r3h_A		242	O-methyltransferase, SAM-dependent; structural gen	97.59
4gek_A		261	TRNA (CMO5U34)-methyltransferase; structural genom	97.58
3sm3_A		235	SAM-dependent methyltransferases; NESG, structural	97.57
4hg2_A		257	Methyltransferase type 11; structural genomics, PS	97.57
3ggd_A		245	SAM-dependent methyltransferase; YP_325210.1, stru	97.54
2frn_A		278	Hypothetical protein PH0793; structural genomics,	97.53
3q87_B		170	N6 adenine specific DNA methylase; SAM-methyltrans	97.52
3adn_A		294	Spermidine synthase; aminopropyltransferase, polya	97.52
4dmg_A		393	Putative uncharacterized protein TTHA1493; rRNA, m	97.52
3e05_A		204	Precorrin-6Y C5,15-methyltransferase (decarboxyla;	97.51
3dli_A		240	Methyltransferase; PSI-II, NYSGXRC, structural gen	97.5
2b25_A		336	Hypothetical protein; structural genomics, methyl	97.49
2pwy_A		258	TRNA (adenine-N(1)-)-methyltransferase; mtase, ado	97.49
3duw_A		223	OMT, O-methyltransferase, putative; alternating of	97.48
3dtn_A		234	Putative methyltransferase MM_2633; structural gen	97.47
3tfw_A		248	Putative O-methyltransferase; PSI-biology, nysgrc,	97.46
1yb2_A		275	Hypothetical protein TA0852; structural genomics,	97.45
1l3i_A		192	Precorrin-6Y methyltransferase/putative decarboxyl	97.45
3grz_A		205	L11 mtase, ribosomal protein L11 methyltransferase	97.44
3kkz_A		267	Uncharacterized protein Q5LES9; putative methyltra	97.44
1kpg_A		287	CFA synthase;, cyclopropane-fatty-acyl-phospholipi	97.43
3p9n_A		189	Possible methyltransferase (methylase); RV2966C, a	97.43
3njr_A		204	Precorrin-6Y methylase; methyltransferase, decarbo	97.41
2fk8_A		318	Methoxy mycolic acid synthase 4; S-adenosylmethion	97.4
3fpf_A		298	Mtnas, putative uncharacterized protein; thermonic	97.4
3g5t_A		299	Trans-aconitate 3-methyltransferase; structural ge	97.4
3hnr_A		220	Probable methyltransferase BT9727_4108; structural	97.4
3i9f_A		170	Putative type 11 methyltransferase; structural gen	97.39
3ou2_A		218	SAM-dependent methyltransferase; O-methyltransfera	97.39
2ih2_A		421	Modification methylase TAQI; DNA, DNA methyltransf	97.39
4fsd_A		383	Arsenic methyltransferase; rossmann fold; 1.75A {C	97.38
2ex4_A		241	Adrenal gland protein AD-003; methyltransferase, s	97.38
2zfu_A		215	Nucleomethylin, cerebral protein 1; nucleolar prot	97.37
1i1n_A		226	Protein-L-isoaspartate O-methyltransferase; S-aden	97.35
3g5l_A		253	Putative S-adenosylmethionine dependent methyltran	97.34
4gua_A		670	Non-structural polyprotein; viral precursor polypr	97.33
3ofk_A		216	Nodulation protein S; NODS, N-methyltransferase, S	97.33
3d2l_A		243	SAM-dependent methyltransferase; ZP_00538691.1, st	97.33
1xtp_A		254	LMAJ004091AAA; SGPP, structural genomics, PSI, pro	97.32
1i9g_A		280	Hypothetical protein RV2118C; mtase, adoMet, cryst	97.32
1y8c_A		246	S-adenosylmethionine-dependent methyltransferase;	97.32
1pjz_A		203	Thiopurine S-methyltransferase; polymorphism, S-ad	97.3
2a14_A		263	Indolethylamine N-methyltransferase; SGC,INMT, str	97.29
2p35_A		259	Trans-aconitate 2-methyltransferase; SAM dependent	97.29
3tr6_A		225	O-methyltransferase; cellular processes; HET: SAH;	97.29
3f4k_A		257	Putative methyltransferase; structural genomics, P	97.28
3lcc_A		235	Putative methyl chloride transferase; halide methy	97.27
2as0_A		396	Hypothetical protein PH1915; RNA methyltransferase	97.26
3gu3_A		284	Methyltransferase; alpha-beta protein, structural	97.26
3lbf_A		210	Protein-L-isoaspartate O-methyltransferase; modifi	97.23
3l8d_A		242	Methyltransferase; structural genomics, PSI, nysgr	97.23
2gb4_A		252	Thiopurine S-methyltransferase; 18204406, thiopuri	97.22
3bus_A		273	REBM, methyltransferase; rebeccamycin synthesis; H	97.22
2xvm_A		199	Tellurite resistance protein TEHB; antibiotic resi	97.22
2esr_A		177	Methyltransferase; structural genomics, hypothetic	97.22
1o54_A		277	SAM-dependent O-methyltransferase; TM0748, structu	97.22
1jsx_A		207	Glucose-inhibited division protein B; methyltransf	97.22
3jwh_A		217	HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena	97.21
1inl_A		296	Spermidine synthase; beta-barrel, rossman fold, st	97.2
2pxx_A		215	Uncharacterized protein MGC2408; structural genomi	97.19
3dr5_A		221	Putative O-methyltransferase; Q8NRD3, CGL1119, PF0	97.19
1xdz_A		240	Methyltransferase GIDB; MCSG, protein structure in	97.17
1vl5_A		260	Unknown conserved protein BH2331; putative methylt	97.17
1ri5_A		298	MRNA capping enzyme; methyltransferase, M7G, messe	97.16
3jwg_A		219	HEN1, methyltransferase type 12; 1.90A {Clostridiu	97.16
1sui_A		247	Caffeoyl-COA O-methyltransferase; rossmann fold, p	97.16
1dl5_A		317	Protein-L-isoaspartate O-methyltransferase; isoasp	97.13
2igt_A		332	SAM dependent methyltransferase; alpha-beta sandwi	97.12
3mgg_A		276	Methyltransferase; NYSGXRC, PSI-II, protein struct	97.12
3iv6_A		261	Putative Zn-dependent alcohol dehydrogenase; alpha	97.11
3bwc_A		304	Spermidine synthase; SAM, SGPP, structura genomics	97.11
3ege_A		261	Putative methyltransferase from antibiotic biosyn	97.11
2ift_A		201	Putative methylase HI0767; NESG, Y767_haein, struc	97.1
3u81_A		221	Catechol O-methyltransferase; neurotransmitter deg	97.1
1yzh_A		214	TRNA (guanine-N(7)-)-methyltransferase; alpha-beta	97.1
3tma_A		354	Methyltransferase; thump domain; 2.05A {Thermus th	97.09
3orh_A		236	Guanidinoacetate N-methyltransferase; structura ge	97.09
3ccf_A		279	Cyclopropane-fatty-acyl-phospholipid synthase; YP_	97.09
2yxd_A		183	Probable cobalt-precorrin-6Y C(15)-methyltransfer	97.09
2yvl_A		248	TRMI protein, hypothetical protein; tRNA, methyltr	97.09
3bkx_A		275	SAM-dependent methyltransferase; YP_807781.1, cycl	97.08
3c3y_A		237	Pfomt, O-methyltransferase; plant secondary metabo	97.07
1zx0_A		236	Guanidinoacetate N-methyltransferase; structural g	97.07
3dmg_A		381	Probable ribosomal RNA small subunit methyltransf;	97.07
2fhp_A		187	Methylase, putative; alpha-beta-alpha sandwich, st	97.05
2avd_A		229	Catechol-O-methyltransferase; structural genomics,	97.05
1ve3_A		227	Hypothetical protein PH0226; dimer, riken structur	97.03
4dcm_A		375	Ribosomal RNA large subunit methyltransferase G; 2	97.02
3pfg_A		263	N-methyltransferase; N,N-dimethyltransferase, SAM	97.02
4htf_A		285	S-adenosylmethionine-dependent methyltransferase;	97.01
2yxe_A		215	Protein-L-isoaspartate O-methyltransferase; rossma	96.98
1ws6_A		171	Methyltransferase; structural genomics, riken stru	96.97
3g07_A		292	7SK snRNA methylphosphate capping enzyme; structur	96.97
2i7c_A		283	Spermidine synthase; transferase, structural genom	96.96
1o9g_A		250	RRNA methyltransferase; antibiotic resistance, Se-	96.96
2yqz_A		263	Hypothetical protein TTHA0223; RNA methyltransfera	96.95
2pbf_A		227	Protein-L-isoaspartate O-methyltransferase beta-A	96.94
3uwp_A		438	Histone-lysine N-methyltransferase, H3 lysine-79;	96.94
1nv8_A		284	HEMK protein; class I adoMet-dependent methyltrans	96.94
3ntv_A		232	MW1564 protein; rossmann fold, putative methyltran	96.94
1nkv_A		256	Hypothetical protein YJHP; structural genomics, PS	96.92
3g89_A		249	Ribosomal RNA small subunit methyltransferase G; 1	96.91
1iy9_A		275	Spermidine synthase; rossmann fold, structural gen	96.91
2nxc_A		254	L11 mtase, ribosomal protein L11 methyltransferase	96.9
1mjf_A		281	Spermidine synthase; spermidine synthetase, struct	96.9
2pt6_A		321	Spermidine synthase; transferase, structural genom	96.89
1wxx_A		382	TT1595, hypothetical protein TTHA1280; thermus the	96.89
3m70_A		286	Tellurite resistance protein TEHB homolog; structu	96.89
2cmg_A		262	Spermidine synthase; transferase, putrescine amino	96.88
2gpy_A		233	O-methyltransferase; structural genomics, PSI, pro	96.83
3ocj_A		305	Putative exported protein; structural genomics, PS	96.83
3lst_A		348	CALO1 methyltransferase; calicheamicin, enediyne,	96.82
1vbf_A		231	231AA long hypothetical protein-L-isoaspartate O-	96.81
1uir_A		314	Polyamine aminopropyltransferase; spermidien synth	96.8
3c3p_A		210	Methyltransferase; NP_951602.1, structural genomic	96.79
2b78_A		385	Hypothetical protein SMU.776; structure genomics,	96.77
2p7i_A		250	Hypothetical protein; putative methyltransferase,	96.77
2o57_A		297	Putative sarcosine dimethylglycine methyltransfera	96.77
1r18_A		227	Protein-L-isoaspartate(D-aspartate)-O-methyltrans;	96.77
2gs9_A		211	Hypothetical protein TT1324; methyl transferase, s	96.76
2fca_A		213	TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac	96.75
2hnk_A		239	SAM-dependent O-methyltransferase; modified rossma	96.75
3vc1_A		312	Geranyl diphosphate 2-C-methyltransferase; rossman	96.74
3bkw_A		243	MLL3908 protein, S-adenosylmethionine dependent me	96.73
3cc8_A		230	Putative methyltransferase; structural genomics, j	96.72
2yx1_A		336	Hypothetical protein MJ0883; methyl transferase, t	96.69
2o07_A		304	Spermidine synthase; structural genomics, structur	96.69
3q7e_A		349	Protein arginine N-methyltransferase 1; HET: SAH;	96.68
2y1w_A		348	Histone-arginine methyltransferase CARM1; histone	96.66
1xxl_A		239	YCGJ protein; structural genomics, protein structu	96.65
4e2x_A		416	TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s	96.64
1fp1_D		372	Isoliquiritigenin 2'-O-methyltransferase; protein-	96.62
2i62_A		265	Nicotinamide N-methyltransferase; structural genom	96.61
1p91_A		269	Ribosomal RNA large subunit methyltransferase A; R	96.61
3v97_A		703	Ribosomal RNA large subunit methyltransferase L; Y	96.6
2qe6_A		274	Uncharacterized protein TFU_2867; putative methylt	96.6
3k6r_A		278	Putative transferase PH0793; structural genomics,	96.6
3cbg_A		232	O-methyltransferase; cyanobacterium; HET: SAH FER	96.59
3reo_A		368	(ISO)eugenol O-methyltransferase; directed evoluti	96.58
2pjd_A		343	Ribosomal RNA small subunit methyltransferase C; g	96.57
3thr_A		293	Glycine N-methyltransferase; GNMT, folate, methylt	96.57
2fpo_A		202	Methylase YHHF; structural genomics, putative meth	96.55
2avn_A		260	Ubiquinone/menaquinone biosynthesis methyltransfe	96.55
2fyt_A		340	Protein arginine N-methyltransferase 3; structural	96.53
3g2m_A		299	PCZA361.24; SAM-dependent methyltransferase, glyco	96.53
3bgv_A		313	MRNA CAP guanine-N7 methyltransferase; alternative	96.52
3mcz_A		352	O-methyltransferase; adomet_mtases, S-adenosylmeth	96.49
2vdw_A		302	Vaccinia virus capping enzyme D1 subunit; nucleoti	96.49
3p9c_A		364	Caffeic acid O-methyltransferase; S-adenosylmethio	96.49
3dlc_A		219	Putative S-adenosyl-L-methionine-dependent methylt	96.46
3trk_A		324	Nonstructural polyprotein; hydrolase; 2.40A {Chiku	96.45
2p8j_A		209	S-adenosylmethionine-dependent methyltransferase;	96.44
3r0q_C		376	Probable protein arginine N-methyltransferase 4.2;	96.42
2ip2_A		334	Probable phenazine-specific methyltransferase; pyo	96.38
2vdv_E		246	TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl	96.37
1jg1_A		235	PIMT;, protein-L-isoaspartate O-methyltransferase;	96.37
1vlm_A		219	SAM-dependent methyltransferase; possible histamin	96.37
1wzn_A		252	SAM-dependent methyltransferase; structural genomi	96.36
3bxo_A		239	N,N-dimethyltransferase; desosamine, sugar, carboh	96.31
3c0k_A		396	UPF0064 protein YCCW; PUA domain, adoMet dependent	96.31
2f8l_A		344	Hypothetical protein LMO1582; structural genomics,	96.3
2b2c_A		314	Spermidine synthase; beta-alpha, transferase; 2.50	96.26
3m33_A		226	Uncharacterized protein; structural genomics, PSI-	96.24
1xj5_A		334	Spermidine synthase 1; structural genomics, protei	96.21
2kw5_A		202	SLR1183 protein; structural genomics, northeast st	96.2
1tw3_A		360	COMT, carminomycin 4-O-methyltransferase; anthracy	96.17
1g6q_1		328	HnRNP arginine N-methyltransferase; SAM-binding do	96.15
3dxy_A		218	TRNA (guanine-N(7)-)-methyltransferase; rossmann f	96.12
3ckk_A		235	TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-	96.1
3bzb_A		281	Uncharacterized protein; RED ALGA, protein structu	95.98
3kr9_A		225	SAM-dependent methyltransferase; class I rossmann-	95.95
1wy7_A		207	Hypothetical protein PH1948; seven-stranded beta s	95.92
2g72_A		289	Phenylethanolamine N-methyltransferase; HET: SAM F	95.9
2aot_A		292	HMT, histamine N-methyltransferase; classic methyl	95.87
2qfm_A		364	Spermine synthase; spermidine aminopropyltransfera	95.83
1u2z_A		433	Histone-lysine N-methyltransferase, H3 lysine-79 s	95.82
3gnl_A		244	Uncharacterized protein, DUF633, LMOF2365_1472; st	95.74
1fp2_A		352	Isoflavone O-methyltransferase; protein-product co	95.73
3dp7_A		363	SAM-dependent methyltransferase; structural genomi	95.72
3lec_A		230	NADB-rossmann superfamily protein; PSI, MCSG, stru	95.58
1x19_A		359	CRTF-related protein; methyltransferase, bacterioc	95.55
3gwz_A		369	MMCR; methyltransferase, mitomycin, S-adenosyl met	95.54
3b3j_A		480	Histone-arginine methyltransferase CARM1; protein	95.43
3i53_A		332	O-methyltransferase; CO-complex, rossmann-like fol	95.37
4hc4_A		376	Protein arginine N-methyltransferase 6; HRMT1L6, S	95.34
4gua_A		670	Non-structural polyprotein; viral precursor polypr	95.28
1zg3_A		358	Isoflavanone 4'-O-methyltransferase; rossman fold,	95.25
4a6d_A		353	Hydroxyindole O-methyltransferase; melatonin, circ	95.19
1qzz_A		374	RDMB, aclacinomycin-10-hydroxylase; anthracycline,	94.78
3giw_A		277	Protein of unknown function DUF574; rossmann-fold	94.71
3htx_A		950	HEN1; HEN1, small RNA methyltransferase, protein-R	94.62
3axs_A		392	Probable N(2),N(2)-dimethylguanosine tRNA methylt	94.51
1wg8_A		285	Predicted S-adenosylmethionine-dependent methyltra	94.16
2r3s_A		335	Uncharacterized protein; methyltransferase domain,	94.08
3id6_C		232	Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase;	93.81
1m6y_A		301	S-adenosyl-methyltransferase MRAW; SAM-dependent m	93.67
1af7_A		274	Chemotaxis receptor methyltransferase CHER; chemot	93.66
3mq2_A		218	16S rRNA methyltransferase; methyltranferase, ribo	93.66
2dul_A		378	N(2),N(2)-dimethylguanosine tRNA methyltransferas;	93.46
3p2e_A		225	16S rRNA methylase; methyltransferase, transferase	93.39
2okc_A		445	Type I restriction enzyme stysji M protein; NP_813	92.63
2qm3_A		373	Predicted methyltransferase; putative methyltransf	92.5
1yub_A		245	Ermam, rRNA methyltransferase; MLS antibiotics; NM	92.24
3tm4_A		373	TRNA (guanine N2-)-methyltransferase TRM14; rossma	91.79
2ozv_A		260	Hypothetical protein ATU0636; structural genomics,	91.75
1ne2_A		200	Hypothetical protein TA1320; structural genomics,	91.28
3tka_A		347	Ribosomal RNA small subunit methyltransferase H; H	91.25
3iyl_W		1299	VP1; non-enveloped virus, membrane penetration pro	90.79
3gdh_A		241	Trimethylguanosine synthase homolog; M7G, CAP, dim	90.59
2ar0_A		541	M.ecoki, type I restriction enzyme ecoki M protein	90.33
3sso_A		419	Methyltransferase; macrolide, natural product, ros	90.31
1qam_A		244	ERMC' methyltransferase; rRNA methyltransferase ER	90.13
1zq9_A		285	Probable dimethyladenosine transferase; SGC, struc	89.77
3uzu_A		279	Ribosomal RNA small subunit methyltransferase A; s	89.66
3s1s_A		878	Restriction endonuclease bpusi; PD--(D/E)XK cataly	89.55
1ej6_A		1289	Lambda2; icosahedral, non-equivalence, dsRNA virus	89.26
3lpm_A		259	Putative methyltransferase; structural genomics, p	89.12
3b5i_A		374	S-adenosyl-L-methionine:salicylic acid carboxyl me	89.05
3gru_A		295	Dimethyladenosine transferase; rossman fold, ribos	88.62
2h1r_A		299	Dimethyladenosine transferase, putative; SGC toron	88.59
2h00_A		254	Methyltransferase 10 domain containing protein; st	88.47
3ftd_A		249	Dimethyladenosine transferase; KSGA, rossmann-like	86.97
3tqs_A		255	Ribosomal RNA small subunit methyltransferase A; p	86.85
3o4f_A		294	Spermidine synthase; aminopropyltransferase, polya	86.07
3gjy_A		317	Spermidine synthase; APC62791, structural genomics	84.75
4azs_A		569	Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15	83.93
4gqb_A		637	Protein arginine N-methyltransferase 5; TIM barrel	83.18
1dus_A		194	MJ0882; hypothetical protein, methanococcus jannas	82.52
3fut_A		271	Dimethyladenosine transferase; methyltransferase,	81.09
1m6e_X		359	S-adenosyl-L-methionnine:salicylic acid carboxyl m	80.25
2r6z_A		258	UPF0341 protein in RSP 3' region; alpha-beta prote	80.24

>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A*	Back alignment and structure

Probab=100.00  E-value=3.8e-37  Score=308.75  Aligned_cols=213  Identities=22%  Similarity=0.225  Sum_probs=156.4

Q ss_pred             hhcccccccCCChhHHHHhhhccCcchhcccccccchhhhhhccccccccccCCccccccCCCcchhhHHHHHHHHHHhc
Q psy13508        217 VTSNNTVFDELEGDQFFRARNRSNPFELIKNGPFLNRAAMKMANMDKRLNSMFTQPVRENGNGPFLNRAAMKMANMDKRL  296 (621)
Q Consensus       217 i~~~Ksvfd~l~~~~~~~aR~r~np~e~~~~~~f~nraa~K~a~id~~~~~~~~~~~~~~~~~~~~sRAa~KL~EId~~~  296 (621)
                      =..+|..++.|+.++|.++|.+. -.|.=+...   |-|+|-.+.               .-.+|||||+|||.||++++
T Consensus         9 g~~wk~~ln~~~k~~f~~y~~~~-i~e~dr~~a---~~~~~~g~~---------------~~g~yRSRAayKL~EIdeK~   69 (269)
T 2px2_A            9 GEQWKEKLNAMGKEEFFSYRKEA-ILEVDRTEA---RRARREGNK---------------VGGHPVSRGTAKLRWLVERR   69 (269)
T ss_dssp             HHHHHHHHHTSCHHHHHHHHTTT-CEEECGGGT---TC----------------------CCSCCSSTHHHHHHHHHHTT
T ss_pred             HHHHHHHHhccCHHHHHHHhhcC-ceEechHHH---HHHHhcCCC---------------cCCCcccHHHHHHHHHHHcC
Confidence            35688999999999999997654 333212111   222222222               23689999999999999997


Q ss_pred             CcCCCCcccCCCCCCCCCCCcceEEEeccCCChhHHHHHHhcCCCCeEEEEecCCCCCCCCCcccCCCCCCcccc-CCC-
Q psy13508        297 NSMFTQPVRENGSPLLGPGELLYFADVCAGPGGFSEYVLYRKKWRAKGIGFTLTGSHDFKLDDFFAGPSETFEPY-YGV-  374 (621)
Q Consensus       297 ~~~~~~~~~~~~~~~~~~g~~~~vlDLcaaPGGwsqyl~~r~~~~~k~~GvdL~~~~~~~l~~~~~~~~~~~~~~-~Gv-  374 (621)
                       +             ++||+  +||||||||||||||+.++.+. +.+.|.++...    +      +..++.+. +|+ 
T Consensus        70 -l-------------ikpg~--~VVDLGaAPGGWSQvAa~~~~v-g~V~G~vig~D----~------~~~P~~~~~~Gv~  122 (269)
T 2px2_A           70 -F-------------VQPIG--KVVDLGCGRGGWSYYAATMKNV-QEVRGYTKGGP----G------HEEPMLMQSYGWN  122 (269)
T ss_dssp             -S-------------CCCCE--EEEEETCTTSHHHHHHTTSTTE-EEEEEECCCST----T------SCCCCCCCSTTGG
T ss_pred             -C-------------CCCCC--EEEEcCCCCCHHHHHHhhhcCC-CCceeEEEccc----c------ccCCCcccCCCce
Confidence             6             58888  8999999999999999987332 33345554321    0      01234444 675 


Q ss_pred             cc---cc-cCCChhhHHHHHHHHHhhcCCCcccEEEecCCCCCCCchhhHHHHHHHHHHHHHHhhhhccCCCc-EEEEEE
Q psy13508        375 KG---NG-DVYDPENILSLHEFVMKSTKGRGVHFMMADGGFSVEGQENIQEILSKRLYLCQFLVSLFIVRPEG-HFVCKV  449 (621)
Q Consensus       375 ~~---~G-DI~~~~~~~~l~~~v~~~~~~~~vDlVlsDg~~~~~G~~~~de~~~~~L~l~~l~~al~~Lr~GG-~fV~K~  449 (621)
                      .+   +| ||++.              .+.++|+|||||||+ +|+...|+..+..    .+.+|..+|+||| +||||+
T Consensus       123 ~i~~~~G~Df~~~--------------~~~~~DvVLSDMAPn-SG~~~vD~~Rs~~----aL~~A~~~Lk~gG~~FvvKV  183 (269)
T 2px2_A          123 IVTMKSGVDVFYK--------------PSEISDTLLCDIGES-SPSAEIEEQRTLR----ILEMVSDWLSRGPKEFCIKI  183 (269)
T ss_dssp             GEEEECSCCGGGS--------------CCCCCSEEEECCCCC-CSCHHHHHHHHHH----HHHHHHHHHTTCCSEEEEEE
T ss_pred             EEEeeccCCccCC--------------CCCCCCEEEeCCCCC-CCccHHHHHHHHH----HHHHHHHHhhcCCcEEEEEE
Confidence            33   37 99961              366899999999999 9999999885433    6678999999999 999999


Q ss_pred             ccCCCCChHHHHHHHHhccceeEeecCCCCCCCCceEEEEEeecCC
Q psy13508        450 FDMFTPFSAGLLYLLYRSYKQVCIFKPNTSRPANSERYIVCKWKRP  495 (621)
Q Consensus       450 F~~~~~~s~~ll~~l~~~F~~V~i~KP~aSR~~ssE~YlVc~g~~~  495 (621)
                      |++..+...+++..|++.|..|.+.|| +||+.|+|+|+||+....
T Consensus       184 Fqg~~~~~~~~l~~lk~~F~~vkvk~p-aSR~~S~E~YlVa~~~~n  228 (269)
T 2px2_A          184 LCPYMPKVIEKLESLQRRFGGGLVRVP-LSRNSNHEMYWVSGASGN  228 (269)
T ss_dssp             SCTTSHHHHHHHHHHHHHHCCEEECCT-TSCTTCCCEEEETTCCSC
T ss_pred             CCCCchHHHHHHHHHHHHcCCEEEECC-CCCCCCccEEEEecccCc
Confidence            997555566677899999999997555 999999999999976643

PyMOL of 2px2

>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0	Back alignment and structure

>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A*	Back alignment and structure

>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus}	Back alignment and structure

>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A*	Back alignment and structure

>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A*	Back alignment and structure

>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum}	Back alignment and structure

>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus}	Back alignment and structure

>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens}	Back alignment and structure

>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus}	Back alignment and structure

>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A*	Back alignment and structure

>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A*	Back alignment and structure

>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus}	Back alignment and structure

>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A*	Back alignment and structure

>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0	Back alignment and structure

>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus}	Back alignment and structure

>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A*	Back alignment and structure

>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A*	Back alignment and structure

>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus}	Back alignment and structure

>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A*	Back alignment and structure

>2hwk_A Helicase NSP2; rossman fold, alpha/beta/alpha, multi-domain, hydrolase; 2.45A {Venezuelan equine encephalitis virus}	Back alignment and structure

>2hwk_A Helicase NSP2; rossman fold, alpha/beta/alpha, multi-domain, hydrolase; 2.45A {Venezuelan equine encephalitis virus}	Back alignment and structure

>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A*	Back alignment and structure

>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A*	Back alignment and structure

>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A*	Back alignment and structure

>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum}	Back alignment and structure

>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus}	Back alignment and structure

>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens}	Back alignment and structure

>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A*	Back alignment and structure

>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus}	Back alignment and structure

>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A*	Back alignment and structure

>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A*	Back alignment and structure

>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A*	Back alignment and structure

>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus}	Back alignment and structure

>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E*	Back alignment and structure

>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes}	Back alignment and structure

>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp}	Back alignment and structure

>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A*	Back alignment and structure

>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix}	Back alignment and structure

>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str}	Back alignment and structure

>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A	Back alignment and structure

>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens}	Back alignment and structure

>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A*	Back alignment and structure

>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium}	Back alignment and structure

>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38	Back alignment and structure

>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A	Back alignment and structure

>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli}	Back alignment and structure

>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405}	Back alignment and structure

>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3	Back alignment and structure

>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A*	Back alignment and structure

>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii}	Back alignment and structure

>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A*	Back alignment and structure

>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A*	Back alignment and structure

>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38	Back alignment and structure

>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A	Back alignment and structure

>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii}	Back alignment and structure

>3trk_A Nonstructural polyprotein; hydrolase; 2.40A {Chikungunya virus}	Back alignment and structure

>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A*	Back alignment and structure

>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4	Back alignment and structure

>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae}	Back alignment and structure

>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus}	Back alignment and structure

>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris}	Back alignment and structure

>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440}	Back alignment and structure

>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A*	Back alignment and structure

>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus}	Back alignment and structure

>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A	Back alignment and structure

>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A*	Back alignment and structure

>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C*	Back alignment and structure

>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A*	Back alignment and structure

>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp}	Back alignment and structure

>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A*	Back alignment and structure

>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei}	Back alignment and structure

>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans}	Back alignment and structure

>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413}	Back alignment and structure

>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A*	Back alignment and structure

>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi}	Back alignment and structure

>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus}	Back alignment and structure

>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0	Back alignment and structure

>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus}	Back alignment and structure

>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13	Back alignment and structure

>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus}	Back alignment and structure

>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A*	Back alignment and structure

>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei}	Back alignment and structure

>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp}	Back alignment and structure

>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13	Back alignment and structure

>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A*	Back alignment and structure

>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp}	Back alignment and structure

>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A*	Back alignment and structure

>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A*	Back alignment and structure

>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis}	Back alignment and structure

>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus}	Back alignment and structure

>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A*	Back alignment and structure

>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A*	Back alignment and structure

>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae}	Back alignment and structure

>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian}	Back alignment and structure

>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus}	Back alignment and structure

>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A*	Back alignment and structure

>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A*	Back alignment and structure

>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A	Back alignment and structure

>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42	Back alignment and structure

>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens}	Back alignment and structure

>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A*	Back alignment and structure

>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str}	Back alignment and structure

>4gua_A Non-structural polyprotein; viral precursor polyprotein, protease, zinc-binding, hydrola; HET: MES; 2.85A {Sindbis virus}	Back alignment and structure

>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A*	Back alignment and structure

>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15}	Back alignment and structure

>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42	Back alignment and structure

>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13	Back alignment and structure

>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43	Back alignment and structure

>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36	Back alignment and structure

>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15	Back alignment and structure

>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str}	Back alignment and structure

>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0	Back alignment and structure

>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A*	Back alignment and structure

>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana}	Back alignment and structure

>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51	Back alignment and structure

>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A	Back alignment and structure

>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli}	Back alignment and structure

>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis}	Back alignment and structure

>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A*	Back alignment and structure

>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes}	Back alignment and structure

>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A*	Back alignment and structure

>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46	Back alignment and structure

>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13	Back alignment and structure

>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20	Back alignment and structure

>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A	Back alignment and structure

>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A*	Back alignment and structure

>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens}	Back alignment and structure

>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum}	Back alignment and structure

>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20	Back alignment and structure

>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41	Back alignment and structure

>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A*	Back alignment and structure

>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A	Back alignment and structure

>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A*	Back alignment and structure

>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1	Back alignment and structure

>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51	Back alignment and structure

>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei}	Back alignment and structure

>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides}	Back alignment and structure

>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A*	Back alignment and structure

>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413}	Back alignment and structure

>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46	Back alignment and structure

>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ...	Back alignment and structure

>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53	Back alignment and structure

>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus}	Back alignment and structure

>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*	Back alignment and structure

>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413}	Back alignment and structure

>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii}	Back alignment and structure

>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus}	Back alignment and structure

>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei}	Back alignment and structure

>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum}	Back alignment and structure

>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*	Back alignment and structure

>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A*	Back alignment and structure

>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46	Back alignment and structure

>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1	Back alignment and structure

>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43	Back alignment and structure

>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli}	Back alignment and structure

>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A*	Back alignment and structure

>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli}	Back alignment and structure

>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii}	Back alignment and structure

>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46	Back alignment and structure

>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens}	Back alignment and structure

>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A*	Back alignment and structure

>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A	Back alignment and structure

>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A	Back alignment and structure

>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum}	Back alignment and structure

>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A*	Back alignment and structure

>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A*	Back alignment and structure

>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus}	Back alignment and structure

>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21	Back alignment and structure

>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A*	Back alignment and structure

>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17	Back alignment and structure

>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A*	Back alignment and structure

>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A*	Back alignment and structure

>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A*	Back alignment and structure

>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A*	Back alignment and structure

>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae}	Back alignment and structure

>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A	Back alignment and structure

>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans}	Back alignment and structure

>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis}	Back alignment and structure

>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora}	Back alignment and structure

>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7	Back alignment and structure

>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A*	Back alignment and structure

>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca}	Back alignment and structure

>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A*	Back alignment and structure

>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A	Back alignment and structure

>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18	Back alignment and structure

>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7	Back alignment and structure

>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus}	Back alignment and structure

>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53	Back alignment and structure

>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans}	Back alignment and structure

>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A*	Back alignment and structure

>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti}	Back alignment and structure

>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus}	Back alignment and structure

>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A*	Back alignment and structure

>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A*	Back alignment and structure

>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A*	Back alignment and structure

>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A	Back alignment and structure

>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A*	Back alignment and structure

>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A*	Back alignment and structure

>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A*	Back alignment and structure

>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A*	Back alignment and structure

>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33	Back alignment and structure

>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A*	Back alignment and structure

>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca}	Back alignment and structure

>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A*	Back alignment and structure

>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP}	Back alignment and structure

>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A*	Back alignment and structure

>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli}	Back alignment and structure

>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A*	Back alignment and structure

>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46	Back alignment and structure

>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41	Back alignment and structure

>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A*	Back alignment and structure

>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A*	Back alignment and structure

>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A*	Back alignment and structure

>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis}	Back alignment and structure

>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus}	Back alignment and structure

>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A*	Back alignment and structure

>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis}	Back alignment and structure

>3trk_A Nonstructural polyprotein; hydrolase; 2.40A {Chikungunya virus}	Back alignment and structure

>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum}	Back alignment and structure

>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana}	Back alignment and structure

>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa}	Back alignment and structure

>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E	Back alignment and structure

>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A*	Back alignment and structure

>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41	Back alignment and structure

>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43	Back alignment and structure

>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae}	Back alignment and structure

>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12}	Back alignment and structure

>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45	Back alignment and structure

>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17	Back alignment and structure

>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans}	Back alignment and structure

>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A	Back alignment and structure

>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A	Back alignment and structure

>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A*	Back alignment and structure

>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6	Back alignment and structure

>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A*	Back alignment and structure

>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens}	Back alignment and structure

>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae}	Back alignment and structure

>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A*	Back alignment and structure

>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32	Back alignment and structure

>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ...	Back alignment and structure

>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A*	Back alignment and structure

>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31	Back alignment and structure

>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str}	Back alignment and structure

>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A*	Back alignment and structure

>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus}	Back alignment and structure

>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae}	Back alignment and structure

>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A*	Back alignment and structure

>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A*	Back alignment and structure

>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus}	Back alignment and structure

>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A*	Back alignment and structure

>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens}	Back alignment and structure

>4gua_A Non-structural polyprotein; viral precursor polyprotein, protease, zinc-binding, hydrola; HET: MES; 2.85A {Sindbis virus}	Back alignment and structure

>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A*	Back alignment and structure

>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A*	Back alignment and structure

>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A*	Back alignment and structure

>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A*	Back alignment and structure

>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana}	Back alignment and structure

>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A*	Back alignment and structure

>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23	Back alignment and structure

>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme}	Back alignment and structure

>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E*	Back alignment and structure

>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A*	Back alignment and structure

>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A*	Back alignment and structure

>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP}	Back alignment and structure

>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A*	Back alignment and structure

>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A*	Back alignment and structure

>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45	Back alignment and structure

>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638}	Back alignment and structure

>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24	Back alignment and structure

>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A*	Back alignment and structure

>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str}	Back alignment and structure

>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32	Back alignment and structure

>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli}	Back alignment and structure

>3iyl_W VP1; non-enveloped virus, membrane penetration protein, autocleav myristol group, icosahedral virus; HET: MYR; 3.30A {Grass carp reovirus} PDB: 3k1q_A	Back alignment and structure

>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A*	Back alignment and structure

>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B*	Back alignment and structure

>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A*	Back alignment and structure

>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A	Back alignment and structure

>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24	Back alignment and structure

>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei}	Back alignment and structure

>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus}	Back alignment and structure

>1ej6_A Lambda2; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_U	Back alignment and structure

>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes}	Back alignment and structure

>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana}	Back alignment and structure

>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A*	Back alignment and structure

>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum}	Back alignment and structure

>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54	Back alignment and structure

>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B*	Back alignment and structure

>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0	Back alignment and structure

>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli}	Back alignment and structure

>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A*	Back alignment and structure

>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A*	Back alignment and structure

>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4	Back alignment and structure

>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A*	Back alignment and structure

>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35	Back alignment and structure

>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		621
d1ej0a_		180	c.66.1.2 (A:) RNA methyltransferase FtsJ {Escheric	2e-22
d1ej0a_		180	c.66.1.2 (A:) RNA methyltransferase FtsJ {Escheric	8e-16
d2p41a1		257	c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-	1e-10
d2p41a1		257	c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-	6e-05

>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Length = 180	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: RNA methyltransferase FtsJ
domain: RNA methyltransferase FtsJ
species: Escherichia coli [TaxId: 562]

 Score = 92.6 bits (229), Expect = 2e-22
 Identities = 42/212 (19%), Positives = 74/212 (34%), Gaps = 36/212 (16%)

Query: 284 RAAMKMANMDKRLNSMFTQPVRENGSPLLGPGELLYFADVCAGPGGFSEYVLYRKKWRAK 343
           RA  K+  + +                L  PG  +   D+ A PGG+S+YV+ +   + +
Sbjct: 5   RAWFKLDEIQQSDK-------------LFKPG--MTVVDLGAAPGGWSQYVVTQIGGKGR 49

Query: 344 GIGFTLTGSHDFKLDDFFAGPSETFEPYYGVKGNGDVYDPENILSLHEFVMKSTKGRGVH 403
            I   L         DF  G                             +++      V 
Sbjct: 50  IIACDLLPMDPIVGVDFLQGDFRDELVMK-------------------ALLERVGDSKVQ 90

Query: 404 FMMADGGFSVEGQENIQEILSKRLYLCQFLVSLFIVRPEGHFVCKVFDMFTPFSAGLLYL 463
            +M+D   ++ G   +    +  L      +   ++ P G FV KVF          L  
Sbjct: 91  VVMSDMAPNMSGTPAVDIPRAMYLVELALEMCRDVLAPGGSFVVKVFQ--GEGFDEYLRE 148

Query: 464 LYRSYKQVCIFKPNTSRPANSERYIVCKWKRP 495
           +   + +V + KP++SR  + E YIV   ++P
Sbjct: 149 IRSLFTKVKVRKPDSSRARSREVYIVATGRKP 180

PyMOL of d1ej0a_

>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Length = 180	Back information, alignment and structure

>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Length = 257	Back information, alignment and structure

>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Length = 257	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		621
d1ej0a_		180	RNA methyltransferase FtsJ {Escherichia coli [TaxI	100.0
d1ej0a_		180	RNA methyltransferase FtsJ {Escherichia coli [TaxI	99.98
d2p41a1		257	An RNA cap (nucleoside-2'-O-)-methyltransferase do	99.96
d2p41a1		257	An RNA cap (nucleoside-2'-O-)-methyltransferase do	99.71
d1g8aa_		227	Fibrillarin homologue {Archaeon Pyrococcus horikos	98.26
d1wg8a2		182	TM0872, methyltransferase domain {Thermus thermoph	98.2
d1sqga2		284	Ribosomal RNA small subunit methyltransferase B, R	98.2
d1m6ya2		192	TM0872, methyltransferase domain {Thermotoga marit	98.18
d1yb2a1		250	Hypothetical protein Ta0852 {Thermoplasma acidophi	98.13
d2fk8a1		280	Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri	98.03
d2as0a2		324	Hypothetical protein PH1915, middle and C-terminal	97.99
d1ixka_		313	Hypothetical methyltransferase PH1374 {Archaeon Py	97.98
d2b9ea1		293	NOL1R {Human (Homo sapiens) [TaxId: 9606]}	97.97
d1i9ga_		264	Probable methyltransferase Rv2118c {Mycobacterium	97.97
d1nt2a_		209	Fibrillarin homologue {Archaeon Archaeoglobus fulg	97.88
d1kpia_		291	CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]}	97.8
d1ve3a1		226	Hypothetical protein PH0226 {Archaeon Pyrococcus h	97.8
d1vl5a_		231	Hypothetical protein BH2331 {Bacillus halodurans [	97.77
d1xxla_		234	Hypothetical protein YcgJ {Bacillus subtilis [TaxI	97.75
d1o54a_		266	Hypothetical protein TM0748 {Thermotoga maritima [	97.72
d2b25a1		324	Hypothetical protein FLJ20628 {Human (Homo sapiens	97.69
d1dusa_		194	Hypothetical protein MJ0882 {Archaeon Methanococcu	97.68
d1dl5a1		213	Protein-L-isoaspartyl O-methyltransferase {Thermot	97.67
d1nkva_		245	Hypothetical Protein YjhP {Escherichia coli [TaxId	97.63
d1im8a_		225	Hypothetical protein HI0319 (YecO) {Haemophilus in	97.63
d2b78a2		317	Hypothetical protein SMu776, middle and C-terminal	97.63
d1wxxa2		318	Hypothetical protein TTHA1280, middle and C-termin	97.63
d1i1na_		224	Protein-L-isoaspartyl O-methyltransferase {Human (	97.6
d2o57a1		282	Putative sarcosine dimethylglycine methyltransfera	97.59
d1g8sa_		230	Fibrillarin homologue {Archaeon Methanococcus jann	97.57
d2a14a1		257	Indolethylamine N-methyltransferase, INMT {Human (	97.56
d1pjza_		201	Thiopurine S-methyltransferase {Pseudomonas syring	97.55
d1y8ca_		246	Putative methyltransferase CAC2371 {Clostridium ac	97.53
d1kpga_		285	CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]}	97.53
d1ri5a_		252	mRNA cap (Guanine N-7) methyltransferase {Fungus (	97.47
d2igta1		309	Putative methyltransferase Atu0340 {Agrobacterium	97.43
d1l3ia_		186	Precorrin-6Y methyltransferase (CbiT) {Archaeon Me	97.41
d2gh1a1		281	Methyltransferase BC2162 {Bacillus cereus [TaxId:	97.39
d1wzna1		251	Hypothetical methyltransferase PH1305 {Archaeon Py	97.34
d1zx0a1		229	Guanidinoacetate methyltransferase {Human (Homo sa	97.33
d1tw3a2		253	Carminomycin 4-O-methyltransferase {Streptomyces p	97.32
d2ex4a1		222	Adrenal gland protein AD-003 (C9orf32) {Human (Hom	97.3
d1p91a_		268	rRNA methyltransferase RlmA {Escherichia coli [Tax	97.29
d2bzga1		229	Thiopurine S-methyltransferase {Human (Homo sapien	97.19
d1nw3a_		328	Catalytic, N-terminal domain of histone methyltran	97.18
d2avna1		246	Hypothetical methyltransferase TM1389 {Thermotoga	97.17
d2nxca1		254	PrmA-like protein TTHA0656 (TT0836) {Thermus therm	97.12
d1jqea_		280	Histamine methyltransferase {Human (Homo sapiens)	97.04
d2i6ga1		198	Putative methyltransferase TehB {Salmonella typhim	96.99
d2fcaa1		204	tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil	96.94
d2b3ta1		274	N5-glutamine methyltransferase, HemK {Escherichia	96.92
d1u2za_		406	Catalytic, N-terminal domain of histone methyltran	96.84
d1xtpa_		254	Hypothetical protein Lmaj004091aaa (LmjF30.0810) {	96.84
d1vlma_		208	Possible histamine N-methyltransferase TM1293 {The	96.74
d1xvaa_		292	Glycine N-methyltransferase {Rat (Rattus norvegicu	96.73
d2frna1		260	Hypothetical protein PH0793 {Pyrococcus horikoshii	96.66
d2g72a1		263	Phenylethanolamine N-methyltransferase, PNMTase {H	96.59
d2ih2a1		223	DNA methylase TaqI, N-terminal domain {Thermus aqu	96.51
d1g6q1_		328	Arginine methyltransferase, HMT1 {Baker's yeast (S	96.44
d1oria_		316	Protein arginine N-methyltransferase 1, PRMT1 {Rat	96.44
d2p7ia1		225	Hypothetical protein ECA1738 {Erwinia carotovora [	96.35
d2fyta1		311	Protein arginine N-methyltransferase 3, PRMT3 {Hum	96.33
d1vbfa_		224	Protein-L-isoaspartyl O-methyltransferase {Sulfolo	96.02
d2esra1		152	Putative methyltransferase SPy1538 {Streptococcus	95.98
d1qzza2		256	Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu	95.96
d2bm8a1		232	Cephalosporin hydroxylase CmcI {Streptomyces clavu	95.92
d1ws6a1		171	Methyltransferase TTHA0928 {Thermus thermophilus [	95.7
d1r18a_		223	Protein-L-isoaspartyl O-methyltransferase {Fruit f	95.62
d1wy7a1		201	Hypothetical protein PH1948 {Archaeon Pyrococcus h	95.44
d1yzha1		204	tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep	95.3
d1kyza2		243	Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra	95.15
d1wg8a2		182	TM0872, methyltransferase domain {Thermus thermoph	94.85
d2fpoa1		183	Methylase YhhF {Escherichia coli [TaxId: 562]}	94.68
d2f8la1		328	Hypothetical protein Lmo1582 {Listeria monocytogen	94.68
d2cl5a1		214	Catechol O-methyltransferase, COMT {Rat (Rattus no	94.39
d2avda1		219	COMT domain-containing protein 1, COMTD1 {Human (H	93.77
d1jg1a_		215	Protein-L-isoaspartyl O-methyltransferase {Archaeo	93.58
d1fp1d2		244	Chalcone O-methyltransferase {Alfalfa (Medicago sa	93.5
d1uira_		312	Spermidine synthase {Thermus thermophilus [TaxId:	93.36
d1susa1		227	Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag	93.11
d2fhpa1		182	Putative methylase EF2452 {Enterococcus faecalis [	92.88
d1iy9a_		274	Spermidine synthase {Bacillus subtilis [TaxId: 142	92.12
d1vj0a2		182	Hypothetical protein TM0436 {Thermotoga maritima [	91.33
d1kola2		195	Formaldehyde dehydrogenase {Pseudomonas putida [Ta	91.04
d2b2ca1		312	Spermidine synthase {Caenorhabditis elegans [TaxId	90.34
d1e3ia2		174	Alcohol dehydrogenase {Mouse (Mus musculus), class	89.88
d2o07a1		285	Spermidine synthase {Human (Homo sapiens) [TaxId:	89.84
d1pl8a2		171	Ketose reductase (sorbitol dehydrogenase) {Human (	89.7
d1ne2a_		197	Hypothetical protein Ta1320 {Archaeon Thermoplasma	89.16
d1jqba2		174	Bacterial secondary alcohol dehydrogenase {Clostri	88.92
d1mjfa_		276	Putative spermidine synthetase PF0127 (SpeE) {Arch	88.89
d2ifta1		183	Putative methylase HI0767 {Haemophilus influenzae	88.68
d1inla_		295	Spermidine synthase {Thermotoga maritima [TaxId: 2	88.45
d1p0fa2		174	Alcohol dehydrogenase {Frog (Rana perezi) [TaxId:	87.36
d1e3ja2		170	Ketose reductase (sorbitol dehydrogenase) {Silverl	85.8
d1f8fa2		174	Benzyl alcohol dehydrogenase {Acinetobacter calcoa	84.66
d1wxxa2		318	Hypothetical protein TTHA1280, middle and C-termin	84.52
d1xj5a_		290	Spermidine synthase {Thale cress (Arabidopsis thal	84.01
d1jvba2		170	Alcohol dehydrogenase {Archaeon Sulfolobus solfata	83.93
d1h2ba2		172	Alcohol dehydrogenase {Archaeon Aeropyrum pernix [	83.78
d1cdoa2		175	Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI	82.21
d1yuba_		245	rRNA adenine dimethylase {Streptococcus pneumoniae	81.97
d1d1ta2		176	Alcohol dehydrogenase {Human (Homo sapiens), diffe	80.6

>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: RNA methyltransferase FtsJ
domain: RNA methyltransferase FtsJ
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=1.4e-48  Score=376.72  Aligned_cols=179  Identities=26%  Similarity=0.345  Sum_probs=163.9

Q ss_pred             cchhhHHHHHHHHHHhcCcCCCCcccCCCCCCCCCCCcceEEEeccCCChhHHHHHHhcCCCCeEEEEecCCCCCCCCCc
Q psy13508        280 PFLNRAAMKMANMDKRLNSMFTQPVRENGSPLLGPGELLYFADVCAGPGGFSEYVLYRKKWRAKGIGFTLTGSHDFKLDD  359 (621)
Q Consensus       280 ~~~sRAa~KL~EId~~~~~~~~~~~~~~~~~~~~~g~~~~vlDLcaaPGGwsqyl~~r~~~~~k~~GvdL~~~~~~~l~~  359 (621)
                      ||||||||||+||+++|++             ++++.  +|||||||||||+||+.++.+..++++|+|+.+        
T Consensus         1 GyrsRaafKL~EI~~k~~l-------------~k~~~--~vlDLg~aPGgw~q~~~~~~~~~~~v~~vDl~~--------   57 (180)
T d1ej0a_           1 GLRSRAWFKLDEIQQSDKL-------------FKPGM--TVVDLGAAPGGWSQYVVTQIGGKGRIIACDLLP--------   57 (180)
T ss_dssp             CCSCHHHHHHHHHHHHHCC-------------CCTTC--EEEEESCTTCHHHHHHHHHHCTTCEEEEEESSC--------
T ss_pred             CchhHHHHHHHHHHHHhCc-------------cCCCC--eEEEEeccCCcceEEEEeeccccceEEEeeccc--------
Confidence            7999999999999999998             47777  899999999999999999888889999999984        


Q ss_pred             ccCCCCCCccccCCC-cccccCCChhhHHHHHHHHHhhcCCCcccEEEecCCCCCCCchhhHHHHHHHHHHHHHHhhhhc
Q psy13508        360 FFAGPSETFEPYYGV-KGNGDVYDPENILSLHEFVMKSTKGRGVHFMMADGGFSVEGQENIQEILSKRLYLCQFLVSLFI  438 (621)
Q Consensus       360 ~~~~~~~~~~~~~Gv-~~~GDI~~~~~~~~l~~~v~~~~~~~~vDlVlsDg~~~~~G~~~~de~~~~~L~l~~l~~al~~  438 (621)
                              ++++.|+ .++||+++..+...+....    ...++|||||||+|+++|+++.||..+.+|.++++.+|+.+
T Consensus        58 --------~~~i~~~~~~~~d~~~~~~~~~~~~~~----~~~~~DlVlSD~ap~~sg~~~~d~~~~~~L~~~~l~~a~~~  125 (180)
T d1ej0a_          58 --------MDPIVGVDFLQGDFRDELVMKALLERV----GDSKVQVVMSDMAPNMSGTPAVDIPRAMYLVELALEMCRDV  125 (180)
T ss_dssp             --------CCCCTTEEEEESCTTSHHHHHHHHHHH----TTCCEEEEEECCCCCCCSCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             --------ccccCCceEeecccccchhhhhhhhhc----cCcceeEEEecccchhcccchhHHHHHHHHHHHHHHhhhhc
Confidence                    3445565 7899999988888766543    46789999999999999999999999999999999999999


Q ss_pred             cCCCcEEEEEEccCCCCChHHHHHHHHhccceeEeecCCCCCCCCceEEEEEeecCC
Q psy13508        439 VRPEGHFVCKVFDMFTPFSAGLLYLLYRSYKQVCIFKPNTSRPANSERYIVCKWKRP  495 (621)
Q Consensus       439 Lr~GG~fV~K~F~~~~~~s~~ll~~l~~~F~~V~i~KP~aSR~~ssE~YlVc~g~~~  495 (621)
                      |++||+||||+|++.+  +..|++.|+++|++|+++||.|||++|||+|+||+|||+
T Consensus       126 Lk~gG~fV~K~F~g~~--~~~l~~~l~~~F~~V~~~KP~aSR~~SsE~Ylv~~g~Kp  180 (180)
T d1ej0a_         126 LAPGGSFVVKVFQGEG--FDEYLREIRSLFTKVKVRKPDSSRARSREVYIVATGRKP  180 (180)
T ss_dssp             EEEEEEEEEEEESSTT--HHHHHHHHHHHEEEEEEECCTTSCTTCCEEEEEEEEECC
T ss_pred             cCCCCcEEEEEecCcc--HHHHHHHHHhhcCEEEEECCCCcccCCceEEEEEecCCC
Confidence            9999999999999854  889999999999999999999999999999999999985

PyMOL of d1ej0a_

>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]}	Back information, alignment and structure

>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]}	Back information, alignment and structure

>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]}	Back information, alignment and structure

>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]}	Back information, alignment and structure

>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]}	Back information, alignment and structure

>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]}	Back information, alignment and structure

>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}	Back information, alignment and structure

>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]}	Back information, alignment and structure

>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]}	Back information, alignment and structure

>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]}	Back information, alignment and structure

>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]}	Back information, alignment and structure

>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]}	Back information, alignment and structure

>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure

>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure

>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure

>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]}	Back information, alignment and structure

>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]}	Back information, alignment and structure

>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]}	Back information, alignment and structure

>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]}	Back information, alignment and structure

>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]}	Back information, alignment and structure

>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]}	Back information, alignment and structure

>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]}	Back information, alignment and structure

>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}	Back information, alignment and structure