Psyllid ID: psy13569
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 118 | ||||||
| 350407614 | 1513 | PREDICTED: ras-specific guanine nucleoti | 0.5 | 0.038 | 0.661 | 2e-16 | |
| 340717199 | 1513 | PREDICTED: ras-specific guanine nucleoti | 0.5 | 0.038 | 0.661 | 2e-16 | |
| 345488865 | 1522 | PREDICTED: ras-specific guanine nucleoti | 0.5 | 0.038 | 0.661 | 3e-16 | |
| 357627758 | 1444 | hypothetical protein KGM_10682 [Danaus p | 0.5 | 0.040 | 0.627 | 2e-15 | |
| 347965563 | 1618 | AGAP001238-PB [Anopheles gambiae str. PE | 0.457 | 0.033 | 0.648 | 1e-14 | |
| 347965565 | 1505 | AGAP001238-PA [Anopheles gambiae str. PE | 0.457 | 0.035 | 0.648 | 1e-14 | |
| 157128743 | 910 | hypothetical protein AaeL_AAEL011225 [Ae | 0.457 | 0.059 | 0.629 | 3e-14 | |
| 383858662 | 1675 | PREDICTED: ras-specific guanine nucleoti | 0.423 | 0.029 | 0.64 | 4e-12 | |
| 189233725 | 1406 | PREDICTED: similar to AGAP001238-PA [Tri | 0.457 | 0.038 | 0.574 | 5e-12 | |
| 328723328 | 1489 | PREDICTED: ras-specific guanine nucleoti | 0.5 | 0.039 | 0.576 | 7e-12 |
| >gi|350407614|ref|XP_003488143.1| PREDICTED: ras-specific guanine nucleotide-releasing factor 1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Score = 90.1 bits (222), Expect = 2e-16, Method: Compositional matrix adjust.
Identities = 39/59 (66%), Positives = 47/59 (79%)
Query: 44 MLSPKLQRVVRINDHQLTNLSDRAKYDHSLSGYLEKRTSDQARWQTRWFVLYQNKVIAY 102
MLSPK+QR VR+ND QL LS++A YDHS +GYL KRT+D A+WQ RWFVLYQN + Y
Sbjct: 1 MLSPKMQRTVRVNDSQLIMLSEKAHYDHSFTGYLHKRTADSAKWQLRWFVLYQNLLFYY 59
|
Source: Bombus impatiens Species: Bombus impatiens Genus: Bombus Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|340717199|ref|XP_003397074.1| PREDICTED: ras-specific guanine nucleotide-releasing factor 1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|345488865|ref|XP_001602057.2| PREDICTED: ras-specific guanine nucleotide-releasing factor 1-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|357627758|gb|EHJ77340.1| hypothetical protein KGM_10682 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|347965563|ref|XP_003435786.1| AGAP001238-PB [Anopheles gambiae str. PEST] gi|333470454|gb|EGK97627.1| AGAP001238-PB [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|347965565|ref|XP_321917.5| AGAP001238-PA [Anopheles gambiae str. PEST] gi|333470453|gb|EAA01783.5| AGAP001238-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|157128743|ref|XP_001661501.1| hypothetical protein AaeL_AAEL011225 [Aedes aegypti] gi|108872489|gb|EAT36714.1| AAEL011225-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|383858662|ref|XP_003704818.1| PREDICTED: ras-specific guanine nucleotide-releasing factor 1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|189233725|ref|XP_970314.2| PREDICTED: similar to AGAP001238-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|328723328|ref|XP_001952636.2| PREDICTED: ras-specific guanine nucleotide-releasing factor 1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 118 | ||||||
| UNIPROTKB|F1LM43 | 1243 | Rasgrf1 "Ras-specific guanine | 0.415 | 0.039 | 0.448 | 6.5e-07 | |
| RGD|620395 | 1244 | Rasgrf1 "RAS protein-specific | 0.415 | 0.039 | 0.448 | 6.5e-07 | |
| UNIPROTKB|F1LS73 | 1252 | Rasgrf1 "Ras-specific guanine | 0.415 | 0.039 | 0.448 | 6.5e-07 | |
| UNIPROTKB|E1BM01 | 1257 | RASGRF1 "Uncharacterized prote | 0.415 | 0.038 | 0.448 | 8.4e-07 | |
| UNIPROTKB|F8VPA5 | 1257 | RASGRF1 "Ras-specific guanine | 0.415 | 0.038 | 0.448 | 8.4e-07 | |
| UNIPROTKB|J3KQP9 | 1273 | RASGRF1 "Ras-specific guanine | 0.415 | 0.038 | 0.448 | 8.5e-07 | |
| UNIPROTKB|Q13972 | 1275 | RASGRF1 "Ras-specific guanine | 0.415 | 0.038 | 0.448 | 8.5e-07 | |
| UNIPROTKB|F1RKR6 | 1278 | RASGRF1 "Uncharacterized prote | 0.415 | 0.038 | 0.448 | 8.5e-07 | |
| UNIPROTKB|E2RNH2 | 1287 | RASGRF1 "Uncharacterized prote | 0.415 | 0.038 | 0.448 | 8.6e-07 | |
| MGI|MGI:99694 | 1262 | Rasgrf1 "RAS protein-specific | 0.415 | 0.038 | 0.428 | 1.8e-06 |
| UNIPROTKB|F1LM43 Rasgrf1 "Ras-specific guanine nucleotide-releasing factor 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Score = 128 (50.1 bits), Expect = 6.5e-07, P = 6.5e-07
Identities = 22/49 (44%), Positives = 33/49 (67%)
Query: 49 LQRVVRINDHQLTNLSDRAKYDHSLSGYLEKRTSDQARWQTRWFVLYQN 97
+Q+ +R+ND + +L A+ D + GYL KR+SD +WQT+WF L QN
Sbjct: 1 MQKAIRLNDGHVVSLGLLAQRDGTRKGYLSKRSSDNPKWQTKWFALLQN 49
|
|
| RGD|620395 Rasgrf1 "RAS protein-specific guanine nucleotide-releasing factor 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LS73 Rasgrf1 "Ras-specific guanine nucleotide-releasing factor 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BM01 RASGRF1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F8VPA5 RASGRF1 "Ras-specific guanine nucleotide-releasing factor 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3KQP9 RASGRF1 "Ras-specific guanine nucleotide-releasing factor 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q13972 RASGRF1 "Ras-specific guanine nucleotide-releasing factor 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RKR6 RASGRF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RNH2 RASGRF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:99694 Rasgrf1 "RAS protein-specific guanine nucleotide-releasing factor 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 118 | |||
| cd13261 | 136 | cd13261, PH_RasGRF1_2, Ras-specific guanine nucleo | 5e-12 | |
| cd13255 | 110 | cd13255, PH_TAAP2-like, Tandem PH-domain-containin | 0.002 | |
| cd13301 | 108 | cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin | 0.003 |
| >gnl|CDD|241415 cd13261, PH_RasGRF1_2, Ras-specific guanine nucleotide-releasing factors 1 and 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
Score = 58.2 bits (141), Expect = 5e-12
Identities = 16/31 (51%), Positives = 23/31 (74%)
Query: 67 AKYDHSLSGYLEKRTSDQARWQTRWFVLYQN 97
A+ D + GYL K++SD ++W T+WF LYQN
Sbjct: 1 ARKDGTRRGYLSKKSSDNSKWHTKWFALYQN 31
|
RasGRF1 (also called GRF1; CDC25Mm/Ras-specific nucleotide exchange factor CDC25; GNRP/Guanine nucleotide-releasing protein) and RasGRF2 (also called GRF2; Ras guanine nucleotide exchange factor 2) are a family of guanine nucleotide exchange factors (GEFs). They both promote the exchange of Ras-bound GDP by GTP, thereby regulating the RAS signaling pathway. RasGRF1 and RasGRF2 form homooligomers and heterooligomers. GRF1 has 3 isoforms and GRF2 has 2 isoforms. The longest isoforms of RasGRF1 and RasGRF2 contain the following domains: a Rho-GEF domain sandwiched between 2 PH domains, IQ domains, a REM (Ras exchanger motif) domain, and a Ras-GEF domainwhich gives them the capacity to activate both Ras and Rac GTPases in response to signals from a variety of neurotransmitter receptors. Their IQ domains allow them to act as calcium sensors to mediate the actions of NMDA-type and calcium-permeable AMPA-type glutamate receptors. GRF1 also mediates the action of dopamine receptors that signal through cAMP. GRF1 and GRF2 play strikingly different roles in regulating MAP kinase family members, neuronal synaptic plasticity, specific forms of learning and memory, and behavioral responses to psychoactive drugs. PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes. Length = 136 |
| >gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 118 | |||
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 4e-06 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 2e-05 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 1e-04 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 1e-04 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 2e-04 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 2e-04 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 2e-04 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 3e-04 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 3e-04 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 3e-04 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 4e-04 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 4e-04 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 4e-04 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 5e-04 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 6e-04 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 7e-04 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 7e-04 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 8e-04 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 9e-04 |
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 | Back alignment and structure |
|---|
Score = 41.9 bits (98), Expect = 4e-06
Identities = 9/29 (31%), Positives = 17/29 (58%)
Query: 74 SGYLEKRTSDQARWQTRWFVLYQNKVIAY 102
G+L +++S RW+ WF L+ + + Y
Sbjct: 11 GGWLWRQSSILRRWKRNWFALWLDGTLGY 39
|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 118 | |||
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 99.49 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 99.48 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 99.48 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 99.45 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 99.45 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 99.45 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 99.45 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 99.44 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 99.44 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 99.43 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 99.43 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 99.43 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 99.42 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 99.41 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 99.41 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 99.41 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 99.4 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 99.39 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 99.37 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 99.37 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 99.37 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 99.37 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 99.36 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 99.36 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 99.36 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 99.36 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 99.35 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 99.35 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 99.34 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 99.34 | |
| 2w2x_D | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.31 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 99.3 | |
| 3tca_A | 291 | Amyloid beta A4 precursor protein-binding family 1 | 99.29 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 99.29 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 99.28 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 99.28 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 99.28 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 99.27 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 99.24 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 99.23 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 99.23 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 99.22 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 99.21 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 99.18 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 99.17 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 99.16 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 99.16 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 99.16 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 99.15 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 99.13 | |
| 2r09_A | 347 | Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph | 99.13 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 99.08 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 99.05 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 99.03 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 98.97 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 98.94 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 98.86 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 98.85 | |
| 4h8s_A | 407 | DCC-interacting protein 13-beta; BAR domain, pleck | 98.82 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 98.77 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 98.69 | |
| 4gmv_A | 281 | RAS-associated and pleckstrin homology domains-CO | 98.69 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 98.59 | |
| 2fjl_A | 150 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 98.52 | |
| 3hk0_A | 256 | Growth factor receptor-bound protein 10; GRB10, RA | 98.42 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 98.29 | |
| 4f7h_A | 173 | Fermitin family homolog 2; beta-barrel, membrane b | 97.86 | |
| 2d9w_A | 127 | Docking protein 2; PH domain, structural genomics, | 97.16 | |
| 2coa_A | 125 | Protein kinase C, D2 type; protein kinase D2, PH d | 96.54 | |
| 4bbk_A | 165 | Kindlin-1, fermitin family homolog 1; PH domain, c | 96.33 | |
| 1w1g_A | 151 | HPDK1, 3-phosphoinositide dependent protein kinase | 95.93 | |
| 2d9z_A | 129 | Protein kinase C, NU type; PH domain, structural g | 95.3 | |
| 1v5m_A | 136 | SH2 and PH domain-containing adapter protein APS; | 89.14 |
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
Probab=99.49 E-value=3.8e-14 Score=92.65 Aligned_cols=50 Identities=20% Similarity=0.467 Sum_probs=44.6
Q ss_pred cCCCCCceeceeeccCCCCCcceeeEEeeCCEEEEEeeCCCCCCCccccC
Q psy13569 67 AKYDHSLSGYLEKRTSDQARWQTRWFVLYQNKVIAYCWSKGTFQSYASSI 116 (118)
Q Consensus 67 Ar~d~~keG~L~KkG~~~~~WkrRWFVLkgNlLFYFE~~~srrPsg~~~~ 116 (118)
+..++.++|||.|+|...++|++|||||+++.|+||+++.+..|.|...+
T Consensus 4 ~~~~~~~~G~L~K~~~~~~~Wk~RwfvL~~~~L~yyk~~~~~~~~~~i~L 53 (109)
T 1wgq_A 4 GSSGSTMSGYLYRSKGSKKPWKHLWFVIKNKVLYTYAASEDVAALESQPL 53 (109)
T ss_dssp CCCSCSCEEEEEEESSTTSCCEEEEEEEETTEEEEESCTTCSSCSEEEEC
T ss_pred CCCCCeEEEEEEeCCCCCCCceeEEEEEeCCEEEEECCCCcCccCceEEC
Confidence 34567999999999999999999999999999999999999999886543
|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* | Back alignment and structure |
|---|
| >2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} | Back alignment and structure |
|---|
| >4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* | Back alignment and structure |
|---|
| >2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A | Back alignment and structure |
|---|
| >2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 118 | ||||
| d1faoa_ | 100 | b.55.1.1 (A:) Dual adaptor of phosphotyrosine and | 2e-04 | |
| d1eaza_ | 103 | b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: | 4e-04 | |
| d1fgya_ | 127 | b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 | 5e-04 | |
| d1x1ga1 | 116 | b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie | 8e-04 | |
| d1v5ua_ | 117 | b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M | 0.001 | |
| d1x1fa1 | 136 | b.55.1.1 (A:8-143) Signal-transducing adaptor prot | 0.001 | |
| d1plsa_ | 113 | b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta | 0.002 | |
| d1v5pa_ | 126 | b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: | 0.002 | |
| d1v89a_ | 118 | b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI | 0.003 |
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
class: All beta proteins fold: PH domain-like barrel superfamily: PH domain-like family: Pleckstrin-homology domain (PH domain) domain: Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH species: Human (Homo sapiens) [TaxId: 9606]
Score = 35.5 bits (81), Expect = 2e-04
Identities = 11/33 (33%), Positives = 18/33 (54%)
Query: 74 SGYLEKRTSDQARWQTRWFVLYQNKVIAYCWSK 106
GYL K+ W+TRWF L++N++ +
Sbjct: 7 EGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQM 39
|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 118 | |||
| d2coaa1 | 112 | Protein kinase c, d2 type {Human (Homo sapiens) [T | 99.51 | |
| d1faoa_ | 100 | Dual adaptor of phosphotyrosine and 3-phosphoinosi | 99.48 | |
| d1fgya_ | 127 | Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.45 | |
| d1v89a_ | 118 | Rho-GTPase-activating protein 25 (KIAA0053) {Human | 99.4 | |
| d1x1fa1 | 136 | Signal-transducing adaptor protein 1, STAP-1 {Huma | 99.4 | |
| d1v88a_ | 130 | Oxysterol binding protein-related protein 8 (ORP-8 | 99.4 | |
| d2fjla1 | 101 | Phosphoinositide phospholipase C, PLC-gamma-1 {Rat | 99.36 | |
| d1unqa_ | 118 | Rac-alpha serine/threonine kinase {Human (Homo sap | 99.34 | |
| d1plsa_ | 113 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.33 | |
| d1eaza_ | 103 | Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | 99.33 | |
| d1wgqa_ | 109 | FYVE, RhoGEF and PH domain containing protein 6, F | 99.29 | |
| d1v5ua_ | 117 | SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ | 99.27 | |
| d1v5pa_ | 126 | Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | 99.26 | |
| d2dyna_ | 111 | Dynamin {Human (Homo sapiens) [TaxId: 9606]} | 99.26 | |
| d1u5fa1 | 111 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.24 | |
| d2coda1 | 102 | Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 | 99.23 | |
| d1omwa2 | 119 | G-protein coupled receptor kinase 2 (beta-adrenerg | 99.23 | |
| d1upqa_ | 107 | Phosphoinositol 3-phosphate binding protein-1, PEP | 99.22 | |
| d2i5fa1 | 104 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.2 | |
| d1u5da1 | 106 | Src kinase-associated phosphoprotein SKAP55 (SCAP1 | 99.18 | |
| d1wi1a_ | 126 | Calcium-dependent activator protein for secretion, | 99.16 | |
| d1wg7a_ | 150 | Dedicator of cytokinesis protein 9, DOCK9 {Human ( | 99.1 | |
| d2elba2 | 101 | DCC-interacting protein 13-alpha, APPL1 {Human (Ho | 99.1 | |
| d1u5ea1 | 209 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.08 | |
| d2cofa1 | 95 | KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | 99.08 | |
| d2coca1 | 99 | FYVE, RhoGEF and PH domain containing protein 3, F | 99.07 | |
| d1btka_ | 169 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 99.06 | |
| d1x1ga1 | 116 | Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.03 | |
| d1qqga1 | 103 | Insulin receptor substrate 1, IRS-1 {Human (Homo s | 99.02 | |
| d1droa_ | 122 | beta-spectrin {Fruit fly (Drosophila melanogaster) | 99.01 | |
| d2j59m1 | 133 | Rho GTPase-activating protein 21 {Human (Homo sapi | 98.98 | |
| d1wjma_ | 123 | beta-spectrin {Human (Homo sapiens), brain 2 isofo | 98.91 | |
| d1w1ha_ | 147 | 3-phosphoinositide dependent protein kinase-1 {Hum | 98.89 | |
| d1v5ma_ | 136 | SH2 and PH domain-containing adapter protein APS { | 98.85 | |
| d1btna_ | 106 | beta-spectrin {Mouse (Mus musculus), brain [TaxId: | 98.82 | |
| d2dfka2 | 162 | Rho guanine nucleotide exchange factor 9, Collybis | 96.97 | |
| d1v61a_ | 132 | Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ | 96.94 | |
| d1maia_ | 119 | Phospholipase C delta-1 {Rat (Rattus norvegicus) [ | 92.96 | |
| d1dbha2 | 133 | Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ | 89.48 |
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: PH domain-like barrel superfamily: PH domain-like family: Pleckstrin-homology domain (PH domain) domain: Protein kinase c, d2 type species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.51 E-value=5.6e-15 Score=97.43 Aligned_cols=45 Identities=4% Similarity=0.029 Sum_probs=41.9
Q ss_pred CceeceeeccCCCCCcceeeEEeeCCEEEEEeeCCCCCCCccccC
Q psy13569 72 SLSGYLEKRTSDQARWQTRWFVLYQNKVIAYCWSKGTFQSYASSI 116 (118)
Q Consensus 72 ~keG~L~KkG~~~~~WkrRWFVLkgNlLFYFE~~~srrPsg~~~~ 116 (118)
.|+|||.|+|...++|++|||||++|.|.||+++++.+|.|...+
T Consensus 2 lk~GwL~k~~~~~~~wkkRwFvL~~~~L~YYk~~~~~~p~g~I~L 46 (112)
T d2coaa1 2 LREGWVVHYSNKDTLRKRHYWRLDCKCITLFQNNTTNRYYKEIPL 46 (112)
T ss_dssp SEEEEEEECCSSSCCCEEEEEEECSSEEEEESSSSCSSCSEEEET
T ss_pred ceEEEEEEECCCCCCeeEEEEEEEcceEEEEeccCCCccceEEee
Confidence 589999999999999999999999999999999999999997543
|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|