Psyllid ID: psy13580

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MASFSYLFLRIKAVVTLEPQPSTSPEPREEINHASGLNGAGALTIVLEDADMNKKDVDEIVLVGGSTRIPKVQQLVKEFFNSKMKETAEAYLGKKVTHAVVTVPAYFKI
cccccEEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccccHHHHHHHHHHHccccccHHHcccccEEEEEEEEccccccc
cccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHccEEEEEcHHHHcHHHHHHHHHHccccHHHHHHHHHcccccEEEEEEcccccc
MASFSYLFLRIKAVvtlepqpstspepreeinhasglngaGALTIVledadmnkkdvDEIVLvggstripKVQQLVKEFFNSKMKETAEAYLGKKVTHAVVTVPAYFKI
MASFSYLFLRIKavvtlepqpstspePREEINHASGLNGAGALTIVLEDADMNKKDVDEIVLVggstripkvqQLVKEFFNSKMKETAeaylgkkvthavvtvpayfki
MASFSYLFLRIKAVVTLEPQPSTSPEPREEINHASGLNGAGALTIVLEDADMNKKDVDEIVLVGGSTRIPKVQQLVKEFFNSKMKETAEAYLGKKVTHAVVTVPAYFKI
***FSYLFLRIKAVVTL********************NGAGALTIVLEDADMNKKDVDEIVLVGGSTRIPKVQQLVKEFFNSKMKETAEAYLGKKVTHAVVTVPAYF**
****SYLFLRIKAVVTLEPQPSTSPEPREEINHASGLNGAGALTIVLEDADMNKKDVDEIVLVGGSTRIPKVQQLVKEFFNSKMKETAEAYLGKKVTHAVVTVPAYF**
MASFSYLFLRIKAVVTLE************INHASGLNGAGALTIVLEDADMNKKDVDEIVLVGGSTRIPKVQQLVKEFFNSKMKETAEAYLGKKVTHAVVTVPAYFKI
**SFSYLFLRIKAVVTLEPQPSTSPEPREEINHASGLNGAGALTIVLEDADMNKKDVDEIVLVGGSTRIPKVQQLVKEFFNSKMKETAEAYLGKKVTHAVVTVPA****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASFSYLFLRIKAVVTLEPQPSTSPEPREEINHASGLNGAGALTIVLEDADMNKKDVDEIVLVGGSTRIPKVQQLVKEFFNSKMKETAEAYLGKKVTHAVVTVPAYFKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query109 2.2.26 [Sep-21-2011]
P29844 656 Heat shock 70 kDa protein yes N/A 0.348 0.057 0.894 2e-12
Q0VCX2 655 78 kDa glucose-regulated yes N/A 0.348 0.058 0.815 4e-12
Q3S4T7 654 78 kDa glucose-regulated N/A N/A 0.348 0.058 0.815 4e-12
P11021 654 78 kDa glucose-regulated yes N/A 0.348 0.058 0.815 4e-12
Q5R4P0 654 78 kDa glucose-regulated yes N/A 0.348 0.058 0.815 4e-12
P20029 655 78 kDa glucose-regulated yes N/A 0.348 0.058 0.815 5e-12
Q90593 652 78 kDa glucose-regulated no N/A 0.348 0.058 0.815 5e-12
P07823 654 78 kDa glucose-regulated N/A N/A 0.348 0.058 0.815 5e-12
P06761 654 78 kDa glucose-regulated yes N/A 0.348 0.058 0.815 5e-12
Q16956 667 78 kDa glucose-regulated N/A N/A 0.348 0.056 0.815 2e-11
>sp|P29844|HSP7C_DROME Heat shock 70 kDa protein cognate 3 OS=Drosophila melanogaster GN=Hsc70-3 PE=2 SV=2 Back     alignment and function desciption
 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%)

Query: 46  VLEDADMNKKDVDEIVLVGGSTRIPKVQQLVKEFFNSK 83
           VLEDADMNKKDV EIVLVGGSTRIPKVQQLVK+FF  K
Sbjct: 345 VLEDADMNKKDVHEIVLVGGSTRIPKVQQLVKDFFGGK 382
Probably plays a role in facilitating the assembly of multimeric protein complexes inside the ER.
Drosophila melanogaster (taxid: 7227)
>sp|Q0VCX2|GRP78_BOVIN 78 kDa glucose-regulated protein OS=Bos taurus GN=HSPA5 PE=2 SV=1 Back     alignment and function description
>sp|Q3S4T7|GRP78_SPETR 78 kDa glucose-regulated protein OS=Spermophilus tridecemlineatus GN=HSPA5 PE=2 SV=1 Back     alignment and function description
>sp|P11021|GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 Back     alignment and function description
>sp|Q5R4P0|GRP78_PONAB 78 kDa glucose-regulated protein OS=Pongo abelii GN=HSPA5 PE=2 SV=1 Back     alignment and function description
>sp|P20029|GRP78_MOUSE 78 kDa glucose-regulated protein OS=Mus musculus GN=Hspa5 PE=1 SV=3 Back     alignment and function description
>sp|Q90593|GRP78_CHICK 78 kDa glucose-regulated protein OS=Gallus gallus GN=HSPA5 PE=1 SV=1 Back     alignment and function description
>sp|P07823|GRP78_MESAU 78 kDa glucose-regulated protein OS=Mesocricetus auratus GN=HSPA5 PE=1 SV=1 Back     alignment and function description
>sp|P06761|GRP78_RAT 78 kDa glucose-regulated protein OS=Rattus norvegicus GN=Hspa5 PE=1 SV=1 Back     alignment and function description
>sp|Q16956|GRP78_APLCA 78 kDa glucose-regulated protein OS=Aplysia californica PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
111380719 659 heat shock cognate 70 protein [Trichoplu 0.348 0.057 0.973 6e-13
111380717 659 heat shock cognate 70 protein [Trichoplu 0.348 0.057 0.973 6e-13
124013459 660 heat shock cognate 70 [Plodia interpunct 0.348 0.057 0.973 6e-13
357622014 963 heat shock cognate 70 protein [Danaus pl 0.348 0.039 0.973 6e-13
94468818 655 heat shock cognate 70 [Aedes aegypti] gi 0.348 0.058 0.973 6e-13
328670877 659 heat shock protein [Helicoverpa armigera 0.348 0.057 0.973 6e-13
188532068 459 heat shock cognate 70 protein [Loxostege 0.348 0.082 0.973 6e-13
312373895 660 hypothetical protein AND_16863 [Anophele 0.348 0.057 0.973 6e-13
27260894 659 heat shock cognate 70 protein [Spodopter 0.348 0.057 0.973 6e-13
215259789 299 78 kDa glucose-regulated protein [Culex 0.348 0.127 0.973 6e-13
>gi|111380719|gb|ABH09735.1| heat shock cognate 70 protein [Trichoplusia ni] Back     alignment and taxonomy information
 Score = 78.2 bits (191), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%)

Query: 46  VLEDADMNKKDVDEIVLVGGSTRIPKVQQLVKEFFNSK 83
           VLEDADMNKKDVDEIVLVGGSTRIPKVQQLVKEFFN K
Sbjct: 347 VLEDADMNKKDVDEIVLVGGSTRIPKVQQLVKEFFNGK 384

Source: Trichoplusia ni

Species: Trichoplusia ni

Genus: Trichoplusia

Family: Noctuidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|111380717|gb|ABH09734.1| heat shock cognate 70 protein [Trichoplusia ni] Back     alignment and taxonomy information
>gi|124013459|gb|ABM88156.1| heat shock cognate 70 [Plodia interpunctella] Back     alignment and taxonomy information
>gi|357622014|gb|EHJ73638.1| heat shock cognate 70 protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|94468818|gb|ABF18258.1| heat shock cognate 70 [Aedes aegypti] gi|403182773|gb|EJY57621.1| AAEL017349-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|328670877|gb|AEB26315.1| heat shock protein [Helicoverpa armigera] Back     alignment and taxonomy information
>gi|188532068|gb|ACD63049.1| heat shock cognate 70 protein [Loxostege sticticalis] Back     alignment and taxonomy information
>gi|312373895|gb|EFR21564.1| hypothetical protein AND_16863 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|27260894|gb|AAN86047.1| heat shock cognate 70 protein [Spodoptera frugiperda] Back     alignment and taxonomy information
>gi|215259789|gb|ACJ64386.1| 78 kDa glucose-regulated protein [Culex tarsalis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
FB|FBgn0001218 656 Hsc70-3 "Heat shock 70-kDa pro 0.348 0.057 0.894 1.5e-11
UNIPROTKB|F1N614 600 F1N614 "Uncharacterized protei 0.348 0.063 0.815 2.7e-11
UNIPROTKB|F1RS36 634 HSPA5 "78 kDa glucose-regulate 0.348 0.059 0.815 3e-11
UNIPROTKB|Q90593 652 HSPA5 "78 kDa glucose-regulate 0.348 0.058 0.815 3.1e-11
UNIPROTKB|F1PIC7 654 HSPA5 "Uncharacterized protein 0.348 0.058 0.815 3.1e-11
UNIPROTKB|P11021 654 HSPA5 "78 kDa glucose-regulate 0.348 0.058 0.815 3.1e-11
UNIPROTKB|G3I8R9 654 I79_019946 "78 kDa glucose-reg 0.348 0.058 0.815 3.1e-11
UNIPROTKB|P07823 654 HSPA5 "78 kDa glucose-regulate 0.348 0.058 0.815 3.1e-11
RGD|2843 654 Hspa5 "heat shock protein 5" [ 0.348 0.058 0.815 3.1e-11
MGI|MGI:95835 655 Hspa5 "heat shock protein 5" [ 0.348 0.058 0.815 3.1e-11
FB|FBgn0001218 Hsc70-3 "Heat shock 70-kDa protein cognate 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 168 (64.2 bits), Expect = 1.5e-11, P = 1.5e-11
 Identities = 34/38 (89%), Positives = 35/38 (92%)

Query:    46 VLEDADMNKKDVDEIVLVGGSTRIPKVQQLVKEFFNSK 83
             VLEDADMNKKDV EIVLVGGSTRIPKVQQLVK+FF  K
Sbjct:   345 VLEDADMNKKDVHEIVLVGGSTRIPKVQQLVKDFFGGK 382
GO:0009408 "response to heat" evidence=ISS;NAS
GO:0016887 "ATPase activity" evidence=NAS
GO:0005783 "endoplasmic reticulum" evidence=IDA;NAS
GO:0030431 "sleep" evidence=TAS
GO:0016246 "RNA interference" evidence=IMP
GO:0005811 "lipid particle" evidence=IDA
GO:0005615 "extracellular space" evidence=IDA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0051298 "centrosome duplication" evidence=IMP
UNIPROTKB|F1N614 F1N614 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RS36 HSPA5 "78 kDa glucose-regulated protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q90593 HSPA5 "78 kDa glucose-regulated protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PIC7 HSPA5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P11021 HSPA5 "78 kDa glucose-regulated protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3I8R9 I79_019946 "78 kDa glucose-regulated protein" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms
UNIPROTKB|P07823 HSPA5 "78 kDa glucose-regulated protein" [Mesocricetus auratus (taxid:10036)] Back     alignment and assigned GO terms
RGD|2843 Hspa5 "heat shock protein 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:95835 Hspa5 "heat shock protein 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
cd10241374 cd10241, HSPA5-like_NBD, Nucleotide-binding domain 2e-19
cd10233376 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding 2e-16
pfam00012 598 pfam00012, HSP70, Hsp70 protein 2e-15
PRK00290 627 PRK00290, dnaK, molecular chaperone DnaK; Provisio 3e-15
PTZ00009 653 PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro 3e-15
cd10170369 cd10170, HSP70_NBD, Nucleotide-binding domain of t 8e-14
cd10234376 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding d 2e-13
cd10241 374 cd10241, HSPA5-like_NBD, Nucleotide-binding domain 5e-13
cd10236355 cd10236, HscA_like_NBD, Nucleotide-binding domain 1e-12
TIGR02350 595 TIGR02350, prok_dnaK, chaperone protein DnaK 2e-12
cd10233 376 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding 7e-12
pfam00012 598 pfam00012, HSP70, Hsp70 protein 1e-11
PRK00290 627 PRK00290, dnaK, molecular chaperone DnaK; Provisio 1e-11
cd10237417 cd10237, HSPA13-like_NBD, Nucleotide-binding domai 2e-11
PRK05183 616 PRK05183, hscA, chaperone protein HscA; Provisiona 2e-11
CHL00094 621 CHL00094, dnaK, heat shock protein 70 4e-11
cd11733 377 cd11733, HSPA9-like_NBD, Nucleotide-binding domain 4e-11
PRK13411 653 PRK13411, PRK13411, molecular chaperone DnaK; Prov 6e-11
cd11733377 cd11733, HSPA9-like_NBD, Nucleotide-binding domain 2e-10
PRK13410 668 PRK13410, PRK13410, molecular chaperone DnaK; Prov 2e-10
cd11734373 cd11734, Ssq1_like_NBD, Nucleotide-binding domain 2e-10
TIGR01991 599 TIGR01991, HscA, Fe-S protein assembly chaperone H 3e-10
PTZ00400 663 PTZ00400, PTZ00400, DnaK-type molecular chaperone; 5e-10
PTZ00009 653 PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro 9e-10
cd10234 376 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding d 2e-09
TIGR02350 595 TIGR02350, prok_dnaK, chaperone protein DnaK 2e-09
cd10238375 cd10238, HSPA14-like_NBD, Nucleotide-binding domai 2e-09
COG0443 579 COG0443, DnaK, Molecular chaperone [Posttranslatio 2e-09
cd10235339 cd10235, HscC_like_NBD, Nucleotide-binding domain 9e-09
cd10230388 cd10230, HYOU1-like_NBD, Nucleotide-binding domain 1e-08
PLN03184 673 PLN03184, PLN03184, chloroplast Hsp70; Provisional 2e-08
cd10228381 cd10228, HSPA4_like_NDB, Nucleotide-binding domain 9e-08
cd10170 369 cd10170, HSP70_NBD, Nucleotide-binding domain of t 1e-07
cd11734 373 cd11734, Ssq1_like_NBD, Nucleotide-binding domain 1e-07
cd10235 339 cd10235, HscC_like_NBD, Nucleotide-binding domain 1e-07
PRK13411 653 PRK13411, PRK13411, molecular chaperone DnaK; Prov 2e-07
COG0443 579 COG0443, DnaK, Molecular chaperone [Posttranslatio 2e-07
PTZ00400 663 PTZ00400, PTZ00400, DnaK-type molecular chaperone; 7e-07
cd10232 386 cd10232, ScSsz1p_like_NBD, Nucleotide-binding doma 9e-07
PTZ00186 657 PTZ00186, PTZ00186, heat shock 70 kDa precursor pr 1e-06
PRK13410 668 PRK13410, PRK13410, molecular chaperone DnaK; Prov 4e-06
cd10236 355 cd10236, HscA_like_NBD, Nucleotide-binding domain 9e-06
PTZ00186 657 PTZ00186, PTZ00186, heat shock 70 kDa precursor pr 1e-05
cd10228 381 cd10228, HSPA4_like_NDB, Nucleotide-binding domain 2e-05
cd11738383 cd11738, HSPA4L_NBD, Nucleotide-binding domain of 3e-05
cd11737383 cd11737, HSPA4_NBD, Nucleotide-binding domain of H 3e-05
cd11732377 cd11732, HSP105-110_like_NBD, Nucleotide-binding d 5e-05
CHL00094 621 CHL00094, dnaK, heat shock protein 70 6e-05
cd10231415 cd10231, YegD_like, Escherichia coli YegD, a putat 6e-05
cd10232386 cd10232, ScSsz1p_like_NBD, Nucleotide-binding doma 1e-04
cd10238 375 cd10238, HSPA14-like_NBD, Nucleotide-binding domai 2e-04
PRK05183 616 PRK05183, hscA, chaperone protein HscA; Provisiona 7e-04
cd11739383 cd11739, HSPH1_NBD, Nucleotide-binding domain of H 0.001
PLN03184 673 PLN03184, PLN03184, chloroplast Hsp70; Provisional 0.002
cd11739 383 cd11739, HSPH1_NBD, Nucleotide-binding domain of H 0.002
TIGR01991 599 TIGR01991, HscA, Fe-S protein assembly chaperone H 0.003
>gnl|CDD|212681 cd10241, HSPA5-like_NBD, Nucleotide-binding domain of human HSPA5 and similar proteins Back     alignment and domain information 
 Score = 81.2 bits (201), Expect = 2e-19
 Identities = 32/38 (84%), Positives = 35/38 (92%)

Query: 46  VLEDADMNKKDVDEIVLVGGSTRIPKVQQLVKEFFNSK 83
           VLEDAD+ K D+DEIVLVGGSTRIPKVQQL+KEFFN K
Sbjct: 316 VLEDADLKKSDIDEIVLVGGSTRIPKVQQLLKEFFNGK 353

This subfamily includes human HSPA5 (also known as 70-kDa heat shock protein 5, glucose-regulated protein 78/GRP78, and immunoglobulin heavy chain-binding protein/BIP, MIF2; the gene encoding HSPA5 maps to 9q33.3.), Sacchaormyces cerevisiae Kar2p (also known as Grp78p), and related proteins. This subfamily belongs to the heat shock protein 70 (HSP70) family of chaperones that assist in protein folding and assembly and can direct incompetent "client" proteins towards degradation. HSPA5 and Kar2p are chaperones of the endoplasmic reticulum (ER). Typically, HSP70s have a nucleotide-binding domain (NBD) and a substrate-binding domain (SBD). The nucleotide sits in a deep cleft formed between the two lobes of the NBD. The two subdomains of each lobe change conformation between ATP-bound, ADP-bound, and nucleotide-free states. ATP binding opens up the substrate-binding site; substrate-binding increases the rate of ATP hydrolysis. HSP70 chaperone activity is regulated by various co-chaperones: J-domain proteins and nucleotide exchange factors (NEFs). Multiple ER DNAJ domain proteins have been identified and may exist in distinct complexes with HSPA5 in various locations in the ER, for example DNAJC3-p58IPK in the lumen. HSPA5-NEFs include SIL1 and an atypical HSP70 family protein HYOU1/ORP150. The ATPase activity of Kar2p is stimulated by the NEFs: Sil1p and Lhs1p. Length = 374
>gnl|CDD|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins Back     alignment and domain information
>gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein Back     alignment and domain information
>gnl|CDD|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional Back     alignment and domain information
>gnl|CDD|212667 cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family Back     alignment and domain information
>gnl|CDD|212676 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding domain of human HSPA9 and similar proteins Back     alignment and domain information
>gnl|CDD|212681 cd10241, HSPA5-like_NBD, Nucleotide-binding domain of human HSPA5 and similar proteins Back     alignment and domain information
>gnl|CDD|212678 cd10236, HscA_like_NBD, Nucleotide-binding domain of HscA and similar proteins Back     alignment and domain information
>gnl|CDD|233830 TIGR02350, prok_dnaK, chaperone protein DnaK Back     alignment and domain information
>gnl|CDD|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins Back     alignment and domain information
>gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein Back     alignment and domain information
>gnl|CDD|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|212679 cd10237, HSPA13-like_NBD, Nucleotide-binding domain of human HSPA13 and similar proteins Back     alignment and domain information
>gnl|CDD|235360 PRK05183, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|214360 CHL00094, dnaK, heat shock protein 70 Back     alignment and domain information
>gnl|CDD|212683 cd11733, HSPA9-like_NBD, Nucleotide-binding domain of human HSPA9, Escherichia coli DnaK, and similar proteins Back     alignment and domain information
>gnl|CDD|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|212683 cd11733, HSPA9-like_NBD, Nucleotide-binding domain of human HSPA9, Escherichia coli DnaK, and similar proteins Back     alignment and domain information
>gnl|CDD|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|212684 cd11734, Ssq1_like_NBD, Nucleotide-binding domain of Saccharomyces cerevisiae Ssq1 and similar proteins Back     alignment and domain information
>gnl|CDD|233673 TIGR01991, HscA, Fe-S protein assembly chaperone HscA Back     alignment and domain information
>gnl|CDD|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional Back     alignment and domain information
>gnl|CDD|212676 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding domain of human HSPA9 and similar proteins Back     alignment and domain information
>gnl|CDD|233830 TIGR02350, prok_dnaK, chaperone protein DnaK Back     alignment and domain information
>gnl|CDD|212680 cd10238, HSPA14-like_NBD, Nucleotide-binding domain of human HSPA14 and similar proteins Back     alignment and domain information
>gnl|CDD|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|212677 cd10235, HscC_like_NBD, Nucleotide-binding domain of Escherichia coli HscC and similar proteins Back     alignment and domain information
>gnl|CDD|212672 cd10230, HYOU1-like_NBD, Nucleotide-binding domain of human HYOU1 and similar proteins Back     alignment and domain information
>gnl|CDD|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional Back     alignment and domain information
>gnl|CDD|212670 cd10228, HSPA4_like_NDB, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4 and similar proteins Back     alignment and domain information
>gnl|CDD|212667 cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family Back     alignment and domain information
>gnl|CDD|212684 cd11734, Ssq1_like_NBD, Nucleotide-binding domain of Saccharomyces cerevisiae Ssq1 and similar proteins Back     alignment and domain information
>gnl|CDD|212677 cd10235, HscC_like_NBD, Nucleotide-binding domain of Escherichia coli HscC and similar proteins Back     alignment and domain information
>gnl|CDD|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>gnl|CDD|212674 cd10232, ScSsz1p_like_NBD, Nucleotide-binding domain of Saccharmomyces cerevisiae Ssz1pp and similar proteins Back     alignment and domain information
>gnl|CDD|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>gnl|CDD|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|212678 cd10236, HscA_like_NBD, Nucleotide-binding domain of HscA and similar proteins Back     alignment and domain information
>gnl|CDD|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>gnl|CDD|212670 cd10228, HSPA4_like_NDB, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4 and similar proteins Back     alignment and domain information
>gnl|CDD|212688 cd11738, HSPA4L_NBD, Nucleotide-binding domain of HSPA4L Back     alignment and domain information
>gnl|CDD|212687 cd11737, HSPA4_NBD, Nucleotide-binding domain of HSPA4 Back     alignment and domain information
>gnl|CDD|212682 cd11732, HSP105-110_like_NBD, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4, HYOU1, and similar proteins Back     alignment and domain information
>gnl|CDD|214360 CHL00094, dnaK, heat shock protein 70 Back     alignment and domain information
>gnl|CDD|212673 cd10231, YegD_like, Escherichia coli YegD, a putative chaperone protein, and related proteins Back     alignment and domain information
>gnl|CDD|212674 cd10232, ScSsz1p_like_NBD, Nucleotide-binding domain of Saccharmomyces cerevisiae Ssz1pp and similar proteins Back     alignment and domain information
>gnl|CDD|212680 cd10238, HSPA14-like_NBD, Nucleotide-binding domain of human HSPA14 and similar proteins Back     alignment and domain information
>gnl|CDD|235360 PRK05183, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|212689 cd11739, HSPH1_NBD, Nucleotide-binding domain of HSPH1 Back     alignment and domain information
>gnl|CDD|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional Back     alignment and domain information
>gnl|CDD|212689 cd11739, HSPH1_NBD, Nucleotide-binding domain of HSPH1 Back     alignment and domain information
>gnl|CDD|233673 TIGR01991, HscA, Fe-S protein assembly chaperone HscA Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
3ldl_A384 Crystal Structure Of Human Grp78 (70kda Heat Shock 3e-13
3ldl_A 384 Crystal Structure Of Human Grp78 (70kda Heat Shock 1e-08
3iuc_A408 Crystal Structure Of The Human 70kda Heat Shock Pro 3e-13
3iuc_A 408 Crystal Structure Of The Human 70kda Heat Shock Pro 9e-09
3qfu_A394 Crystal Structure Of Yeast Hsp70 (BipKAR2) COMPLEXE 4e-10
3qfu_A 394 Crystal Structure Of Yeast Hsp70 (BipKAR2) COMPLEXE 3e-06
3qfp_A390 Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE D 4e-10
3qfp_A 390 Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE D 3e-06
3kvg_A400 Crystal Structure Of The N-Terminal Domain Of Hsp70 6e-10
3kvg_A 400 Crystal Structure Of The N-Terminal Domain Of Hsp70 3e-05
3gl1_A387 Crystal Structure Of Atpase Domain Of Ssb1 Chaperon 3e-09
3i33_A404 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-08
4fsv_A387 Crystal Structure Of A Heat Shock 70kda Protein 2 ( 1e-08
1qqn_A378 D206s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 2e-08
1qqm_A378 D199s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 2e-08
3cqx_A386 Chaperone Complex Length = 386 3e-08
1qqo_A378 E175s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 3e-08
1hx1_A400 Crystal Structure Of A Bag Domain In Complex With T 3e-08
1kay_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71a 3e-08
1ngd_A386 Structural Basis Of The 70-kilodalton Heat Shock Co 3e-08
1ngf_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 3e-08
1ngh_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 3e-08
1ngg_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 3e-08
1kax_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71m 3e-08
1ngc_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 3e-08
1nge_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 3e-08
1nga_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 3e-08
3fzf_A381 Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP 3e-08
1ba0_A386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 3e-08
2qwn_A394 Crystal Structure Of Disulfide-Bond-Crosslinked Com 3e-08
1bup_A386 T13s Mutant Of Bovine 70 Kilodalton Heat Shock Prot 3e-08
1kaz_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71e 3e-08
1ngb_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 3e-08
2bup_A381 T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 3e-08
1hpm_A386 How Potassium Affects The Activity Of The Molecular 3e-08
2qw9_B394 Crystal Structure Of Bovine Hsc70 (1-394aa)in The A 3e-08
1atr_A386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 3e-08
1ats_A386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 3e-08
1ba1_A386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 3e-08
1yuw_A 554 Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214 3e-08
3fe1_A403 Crystal Structure Of The Human 70kda Heat Shock Pro 3e-08
3c7n_B 554 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 3e-08
2v7z_A 543 Crystal Structure Of The 70-Kda Heat Shock Cognate 3e-08
3gdq_A408 Crystal Structure Of The Human 70kda Heat Shock Pro 4e-08
3d2f_B382 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 9e-08
1s3x_A382 The Crystal Structure Of The Human Hsp70 Atpase Dom 9e-08
1hjo_A380 Atpase Domain Of Human Heat Shock 70kda Protein 1 L 9e-08
3d2e_B382 Crystal Structure Of A Complex Of Sse1p And Hsp70, 9e-08
3jxu_A409 Crystal Structure Of The Human 70kda Heat Shock Pro 9e-08
3a8y_A392 Crystal Structure Of The Complex Between The Bag5 B 1e-07
2e8a_A391 Crystal Structure Of The Human Hsp70 Atpase Domain 1e-07
2e88_A391 Crystal Structure Of The Human Hsp70 Atpase Domain 1e-07
1xqs_C191 Crystal Structure Of The Hspbp1 Core Domain Complex 1e-07
1dkg_D383 Crystal Structure Of The Nucleotide Exchange Factor 3e-06
1dkg_D 383 Crystal Structure Of The Nucleotide Exchange Factor 4e-05
2kho_A 605 Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAP 3e-06
2kho_A 605 Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAP 3e-05
4b9q_A 605 Open Conformation Of Atp-Bound Hsp70 Homolog Dnak L 4e-06
4b9q_A 605 Open Conformation Of Atp-Bound Hsp70 Homolog Dnak L 2e-04
2v7y_A 509 Crystal Structure Of The Molecular Chaperone Dnak F 5e-05
>pdb|3LDL|A Chain A, Crystal Structure Of Human Grp78 (70kda Heat Shock Protein 5 BIP) Atpase Domain In Complex With Atp Length = 384 Back     alignment and structure 
Iteration: 1

 Score = 70.1 bits (170), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 31/38 (81%), Positives = 35/38 (92%)
Query: 46  VLEDADMNKKDVDEIVLVGGSTRIPKVQQLVKEFFNSK 83
           VLED+D+ K D+DEIVLVGGSTRIPK+QQLVKEFFN K
Sbjct: 322 VLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGK 359
>pdb|3LDL|A Chain A, Crystal Structure Of Human Grp78 (70kda Heat Shock Protein 5 BIP) Atpase Domain In Complex With Atp Length = 384 Back     alignment and structure
>pdb|3IUC|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 5 (BipGRP78) ATPASE DOMAIN IN COMPLEX WITH ADP Length = 408 Back     alignment and structure
>pdb|3IUC|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 5 (BipGRP78) ATPASE DOMAIN IN COMPLEX WITH ADP Length = 408 Back     alignment and structure
>pdb|3QFP|A Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE DOMAIN Length = 390 Back     alignment and structure
>pdb|3QFP|A Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE DOMAIN Length = 390 Back     alignment and structure
>pdb|3KVG|A Chain A, Crystal Structure Of The N-Terminal Domain Of Hsp70 (Cgd2_20) From Cryptosporidium Parvum In Complex With Amppnp Length = 400 Back     alignment and structure
>pdb|3KVG|A Chain A, Crystal Structure Of The N-Terminal Domain Of Hsp70 (Cgd2_20) From Cryptosporidium Parvum In Complex With Amppnp Length = 400 Back     alignment and structure
>pdb|3GL1|A Chain A, Crystal Structure Of Atpase Domain Of Ssb1 Chaperone, A Member Of The Hsp70 Family, From Saccharomyces Cerevisiae Length = 387 Back     alignment and structure
>pdb|3I33|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 2 (Hsp70-2) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 404 Back     alignment and structure
>pdb|4FSV|A Chain A, Crystal Structure Of A Heat Shock 70kda Protein 2 (Hspa2) From Homo Sapiens At 1.80 A Resolution Length = 387 Back     alignment and structure
>pdb|1QQN|A Chain A, D206s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|1QQM|A Chain A, D199s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|3CQX|A Chain A, Chaperone Complex Length = 386 Back     alignment and structure
>pdb|1QQO|A Chain A, E175s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|1HX1|A Chain A, Crystal Structure Of A Bag Domain In Complex With The Hsc70 Atpase Domain Length = 400 Back     alignment and structure
>pdb|1KAY|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71a Mutant Length = 381 Back     alignment and structure
>pdb|1NGD|A Chain A, Structural Basis Of The 70-kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGF|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGH|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGG|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1KAX|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71m Mutant Length = 381 Back     alignment and structure
>pdb|1NGC|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGE|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGA|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|3FZF|A Chain A, Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP Length = 381 Back     alignment and structure
>pdb|1BA0|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal 1nge 3 Length = 386 Back     alignment and structure
>pdb|2QWN|A Chain A, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-386aa)r171c And Bovine Auxilin (810-910aa)d876c In The AdpPi State Length = 394 Back     alignment and structure
>pdb|1BUP|A Chain A, T13s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 386 Back     alignment and structure
>pdb|1KAZ|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71e Mutant Length = 381 Back     alignment and structure
>pdb|1NGB|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|2BUP|A Chain A, T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 Length = 381 Back     alignment and structure
>pdb|1HPM|A Chain A, How Potassium Affects The Activity Of The Molecular Chaperone Hsc70. Ii. Potassium Binds Specifically In The Atpase Active Site Length = 386 Back     alignment and structure
>pdb|2QW9|B Chain B, Crystal Structure Of Bovine Hsc70 (1-394aa)in The Apo State Length = 394 Back     alignment and structure
>pdb|1ATR|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>pdb|1ATS|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>pdb|1BA1|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal Mutant With Cys 17 Replaced By Lys Length = 386 Back     alignment and structure
>pdb|1YUW|A Chain A, Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214A MUTANT Length = 554 Back     alignment and structure
>pdb|3FE1|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 6 (Hsp70b') Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 403 Back     alignment and structure
>pdb|3C7N|B Chain B, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 554 Back     alignment and structure
>pdb|2V7Z|A Chain A, Crystal Structure Of The 70-Kda Heat Shock Cognate Protein From Rattus Norvegicus In Post-Atp Hydrolysis State Length = 543 Back     alignment and structure
>pdb|3GDQ|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1-Like Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 408 Back     alignment and structure
>pdb|3D2F|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 382 Back     alignment and structure
>pdb|1S3X|A Chain A, The Crystal Structure Of The Human Hsp70 Atpase Domain Length = 382 Back     alignment and structure
>pdb|1HJO|A Chain A, Atpase Domain Of Human Heat Shock 70kda Protein 1 Length = 380 Back     alignment and structure
>pdb|3D2E|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 382 Back     alignment and structure
>pdb|3JXU|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1a (Hsp70-1) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 409 Back     alignment and structure
>pdb|3A8Y|A Chain A, Crystal Structure Of The Complex Between The Bag5 Bd5 And Hsp70 Nbd Length = 392 Back     alignment and structure
>pdb|2E8A|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In Complex With Amp-Pnp Length = 391 Back     alignment and structure
>pdb|2E88|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In The Apo Form Length = 391 Back     alignment and structure
>pdb|1XQS|C Chain C, Crystal Structure Of The Hspbp1 Core Domain Complexed With The Fragment Of Hsp70 Atpase Domain Length = 191 Back     alignment and structure
>pdb|1DKG|D Chain D, Crystal Structure Of The Nucleotide Exchange Factor Grpe Bound To The Atpase Domain Of The Molecular Chaperone Dnak Length = 383 Back     alignment and structure
>pdb|1DKG|D Chain D, Crystal Structure Of The Nucleotide Exchange Factor Grpe Bound To The Atpase Domain Of The Molecular Chaperone Dnak Length = 383 Back     alignment and structure
>pdb|2KHO|A Chain A, Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAPERONE (1-605) Complexed With Adp And Substrate Length = 605 Back     alignment and structure
>pdb|2KHO|A Chain A, Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAPERONE (1-605) Complexed With Adp And Substrate Length = 605 Back     alignment and structure
>pdb|4B9Q|A Chain A, Open Conformation Of Atp-Bound Hsp70 Homolog Dnak Length = 605 Back     alignment and structure
>pdb|4B9Q|A Chain A, Open Conformation Of Atp-Bound Hsp70 Homolog Dnak Length = 605 Back     alignment and structure
>pdb|2V7Y|A Chain A, Crystal Structure Of The Molecular Chaperone Dnak From Geobacillus Kaustophilus Hta426 In Post-Atp Hydrolysis State Length = 509 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 3e-20
3qfu_A 394 78 kDa glucose-regulated protein homolog; HSP70, K 4e-15
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 4e-20
3i33_A 404 Heat shock-related 70 kDa protein 2; protein-ADP c 8e-15
1yuw_A 554 Heat shock cognate 71 kDa protein; chaperone; 2.60 1e-19
1yuw_A 554 Heat shock cognate 71 kDa protein; chaperone; 2.60 1e-14
3d2f_A 675 Heat shock protein homolog SSE1; nucleotide exchan 7e-17
3d2f_A 675 Heat shock protein homolog SSE1; nucleotide exchan 4e-13
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 2e-14
1dkg_D 383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 9e-13
2kho_A 605 Heat shock protein 70; molecular chaperone, HSP70, 2e-13
2kho_A 605 Heat shock protein 70; molecular chaperone, HSP70, 3e-12
2v7y_A 509 Chaperone protein DNAK; HSP70, heat shock protein, 2e-13
2v7y_A 509 Chaperone protein DNAK; HSP70, heat shock protein, 4e-11
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* 1ngf_A* ... Length = 404 Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* 1ngf_A* ... Length = 404 Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Length = 554 Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Length = 554 Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675 Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675 Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Length = 383 Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Length = 383 Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Length = 605 Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Length = 605 Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Length = 509 Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Length = 509 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
4b9q_A 605 Chaperone protein DNAK; HET: ATP; 2.40A {Escherich 99.63
3d2f_A 675 Heat shock protein homolog SSE1; nucleotide exchan 99.61
4gni_A409 Putative heat shock protein; HSP70-type ATPase, AT 99.6
1yuw_A 554 Heat shock cognate 71 kDa protein; chaperone; 2.60 99.58
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 99.58
2kho_A 605 Heat shock protein 70; molecular chaperone, HSP70, 99.57
2v7y_A 509 Chaperone protein DNAK; HSP70, heat shock protein, 99.57
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 99.55
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 99.55
1jce_A344 ROD shape-determining protein MREB; MBL, actin, HS 99.21
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 98.84
4a2a_A419 Cell division protein FTSA, putative; cell cycle, 98.83
2ych_A377 Competence protein PILM; cell cycle, type IV pilus 98.67
2fsj_A346 Hypothetical protein TA0583; actin homologs, archa 98.27
4ehu_A276 Activator of 2-hydroxyisocaproyl-COA dehydratase; 98.23
2zgy_A320 Plasmid segregation protein PARM; plasmid partitio 97.91
2fxu_A375 Alpha-actin-1, actin, alpha skeletal muscle; actin 97.68
3js6_A355 Uncharacterized PARM protein; partition, segregati 97.55
1k8k_A418 ARP3, actin-like protein 3, actin-2; beta-propelle 97.52
4apw_A329 ALP12; actin-like protein; 19.70A {Clostridium tet 97.0
1k8k_B394 ARP2, actin-like protein 2; beta-propeller, struct 95.83
3i8b_A515 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 95.62
3l0q_A554 Xylulose kinase; xlylulose kinase, SGX, PSI, struc 95.57
1hux_A270 Activator of (R)-2-hydroxyglutaryl-COA dehydratase 95.5
2zf5_O497 Glycerol kinase; hyperthermophilic archaeon, ATP-b 95.5
4bc3_A538 Xylulose kinase; transferase, glucuronate xyluloki 95.48
1nbw_A607 Glycerol dehydratase reactivase alpha subunit; mol 95.48
3ll3_A504 Gluconate kinase; xylulose kinase, nysgx, ATP, ADP 95.28
2d0o_A610 DIOL dehydratase-reactivating factor large subunit 95.09
3ifr_A508 Carbohydrate kinase, FGGY; xylulose kinase, SGX, s 95.07
3hz6_A511 Xylulokinase; xylulose, structural genomic, chromo 94.97
3g25_A501 Glycerol kinase; IDP00743, ATP-binding, glycerol m 94.57
2dpn_A495 Glycerol kinase; thermus thermophilus HB8, structu 94.4
2itm_A484 Xylulose kinase, xylulokinase; ATPase, FGGY kinase 94.21
3ezw_A526 Glycerol kinase; glycerol metabolism, allosteric r 94.2
3h3n_X506 Glycerol kinase; ATP-binding, glycerol metabolism, 94.11
3jvp_A572 Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su 94.06
4e1j_A520 Glycerol kinase; structural genomics, PSI-biology, 94.01
2d4w_A504 Glycerol kinase; alpha and beta protein, ribonucle 93.87
2w40_A503 Glycerol kinase, putative; closed conformation, ma 93.74
2p3r_A510 Glycerol kinase; glycerol metabolism, allosteric r 93.67
2uyt_A489 Rhamnulokinase; rhamnose degradation, IN-LINE phos 91.57
1hnj_A317 Beta-ketoacyl-acyl carrier protein synthase III; F 90.29
2ews_A287 Pantothenate kinase; PANK, structural genomics, st 90.07
1zow_A313 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB 89.5
2x3e_A331 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, 88.77
3h6e_A482 Carbohydrate kinase, FGGY; novosphingobium aromati 88.3
2ebd_A309 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 88.3
1ub7_A322 3-oxoacyl-[acyl-carrier protein] synthase; fatty a 88.27
3qbx_A371 Anhydro-N-acetylmuramic acid kinase; acetate and s 88.1
1mzj_A339 Beta-ketoacylsynthase III; beta-ketosynthase, arom 88.02
3eno_A 334 Putative O-sialoglycoprotein endopeptidase; hydrol 87.25
3cqy_A370 Anhydro-N-acetylmuramic acid kinase; APC7501, SO_1 86.9
4ewp_A 350 3-oxoacyl-[acyl-carrier-protein] synthase 3; trans 86.18
2ivn_A 330 O-sialoglycoprotein endopeptidase; UP1 keops compl 85.33
1u6e_A335 3-oxoacyl-[acyl-carrier-protein] synthase III; tra 85.15
4fo0_A593 Actin-related protein 8; chromatin remodeling, nuc 84.9
3ov2_A 393 Curcumin synthase; type III polyketide synthase, t 84.64
1ted_A393 PKS18; thiolase fold, substrate binding tunnel, tr 84.56
3euo_A 379 Type III pentaketide synthase; alpha helix, acyltr 83.69
4dfe_A333 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci 83.45
4b9q_A 605 Chaperone protein DNAK; HET: ATP; 2.40A {Escherich 83.11
3oit_A 387 OS07G0271500 protein; type III polyketide synthase 82.14
2gel_A 231 Putative GRAM negative resuscitation promoting FA; 81.92
3dwl_A427 Actin-related protein 3; propellor, actin-binding, 81.5
1ee0_A 402 2-pyrone synthase; polyketide synthase, thiolase f 81.48
3a5r_A 387 Benzalacetone synthase; chalcone synthase, type II 81.22
1i88_A 389 CHS2, chalcone synthase 2; polyketide synthase, tr 81.09
2p0u_A 413 Stilbenecarboxylate synthase 2; polyketide synthas 80.97
1xes_A 413 Dihydropinosylvin synthase; native structure, tran 80.75
3s21_A345 3-oxoacyl-[ACP] synthase III; non-decarboxylative 80.68
3r6m_A 213 YEAZ, resuscitation promoting factor; actin/HSP70 80.5
3awk_A 402 Chalcone synthase-like polyketide synthase; type I 80.41
1u0m_A 382 Putative polyketide synthase; type III polyketide 80.28
3il3_A 323 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 80.16
4efi_A 354 3-oxoacyl-(acyl-carrier protein) synthase; structu 80.05
>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D Back     alignment and structure
Probab=99.63  E-value=1.3e-16  Score=128.35  Aligned_cols=85  Identities=31%  Similarity=0.431  Sum_probs=77.2

Q ss_pred             cCccccCHHHHHHHhHHHHHHHHHHHHHHHHhcCCCcccccEEEEecCccccchhhHHHHHHhcc-----cchhHHHhhh
Q psy13580         18 EPQPSTSPEPREEINHASGLNGAGALTIVLEDADMNKKDVDEIVLVGGSTRIPKVQQLVKEFFNS-----KMKETAEAYL   92 (109)
Q Consensus        18 ~~~~~itr~~fe~l~~~~~~~~~~~v~~~l~~a~~~~~~I~~VilvGGssriP~V~~~l~~~f~~-----~~~~~a~a~l   92 (109)
                      ++..++||++||+++.++++++.++++++|+++++++.+|+.|+||||+||+|.||+.|+++|+.     ..|..+++. 
T Consensus       295 ~~~~~itr~~~e~l~~~~~~~i~~~v~~~L~~a~~~~~~i~~VvLvGG~sriP~v~~~l~~~fg~~~~~~~nPdeaVA~-  373 (605)
T 4b9q_A          295 HMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAI-  373 (605)
T ss_dssp             EEEEEEEHHHHHHHHHHHHHHTTHHHHHHHHHTTCCGGGCSEEEEESGGGGSHHHHHHHHHHHTSCCCSSSCTTTHHHH-
T ss_pred             eEEEEEeHHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHCcEEEEeCCccCchHHHHHHHHHhccCcCCCcChhHHHHH-
Confidence            35568999999999999999999999999999999999999999999999999999999999942     246688998 


Q ss_pred             ccchhheeecc
Q psy13580         93 GKKVTHAVVTV  103 (109)
Q Consensus        93 Gaai~~a~lt~  103 (109)
                      ||++++++++.
T Consensus       374 GAai~a~~l~~  384 (605)
T 4b9q_A          374 GAAVQGGVLTG  384 (605)
T ss_dssp             HHHHHHHHHHT
T ss_pred             hHHHHHHHhcC
Confidence            99999997764
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Back     alignment and structure
>4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Back     alignment and structure
>4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Back     alignment and structure
>4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Back     alignment and structure
>3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Back     alignment and structure
>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Back     alignment and structure
>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Back     alignment and structure
>3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* Back     alignment and structure
>1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5 Back     alignment and structure
>2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis} Back     alignment and structure
>4bc3_A Xylulose kinase; transferase, glucuronate xylulokinase pathway; HET: MSE EDO; 1.68A {Homo sapiens} PDB: 4bc2_A* 4bc4_A* 4bc5_A* Back     alignment and structure
>1nbw_A Glycerol dehydratase reactivase alpha subunit; molecular chaperone, actin-like ATPase domain, beta/BETA/alpha swiveling domain, hydrolase; 2.40A {Klebsiella pneumoniae} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 Back     alignment and structure
>3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* Back     alignment and structure
>2d0o_A DIOL dehydratase-reactivating factor large subunit; chaperone; HET: ADP; 2.00A {Klebsiella oxytoca} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 PDB: 2d0p_A Back     alignment and structure
>3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* Back     alignment and structure
>3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* Back     alignment and structure
>2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A Back     alignment and structure
>3ezw_A Glycerol kinase; glycerol metabolism, allosteric regulation, microfluidics, in SITU DATA collection, ATP-binding, kinase binding; 2.00A {Escherichia coli} PDB: 1gla_G 1bo5_O* 1bot_O 1glb_G* 1glc_G* 1gld_G* 1gle_G* 1glf_O* 1bu6_O 1bwf_Y* 1glj_Y* 1gll_Y* Back     alignment and structure
>3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O Back     alignment and structure
>4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti} Back     alignment and structure
>2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP} Back     alignment and structure
>2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* Back     alignment and structure
>2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* Back     alignment and structure
>1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* Back     alignment and structure
>2ews_A Pantothenate kinase; PANK, structural genomics, structural genomics consortium, S transferase; HET: ANP; 2.05A {Staphylococcus aureus subsp} SCOP: c.55.1.14 Back     alignment and structure
>1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A Back     alignment and structure
>2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa} Back     alignment and structure
>3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>3qbx_A Anhydro-N-acetylmuramic acid kinase; acetate and sugar kinases, HSP70, actin superfamily, anhydro-N-actetylmuramic acid binding; HET: AH0; 2.10A {Pseudomonas aeruginosa} PDB: 3qbw_A* Back     alignment and structure
>1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>3eno_A Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum} Back     alignment and structure
>3cqy_A Anhydro-N-acetylmuramic acid kinase; APC7501, SO_1313, structural genomics, PSI-2, shewanella one MR-1, protein structure initiative; 2.30A {Shewanella oneidensis} Back     alignment and structure
>4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665} Back     alignment and structure
>2ivn_A O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A* Back     alignment and structure
>1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A Back     alignment and structure
>4fo0_A Actin-related protein 8; chromatin remodeling, nucleosomes, NU gene regulation; HET: ATP; 2.60A {Homo sapiens} Back     alignment and structure
>3ov2_A Curcumin synthase; type III polyketide synthase, transferase; 2.32A {Curcuma longa} PDB: 3ov3_A Back     alignment and structure
>1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A Back     alignment and structure
>3euo_A Type III pentaketide synthase; alpha helix, acyltransferase, transferase; 1.75A {Neurospora crassa} PDB: 3eut_A* 3euq_A* Back     alignment and structure
>4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} Back     alignment and structure
>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D Back     alignment and structure
>3oit_A OS07G0271500 protein; type III polyketide synthases, transferase; 2.00A {Oryza sativa} PDB: 3ale_A Back     alignment and structure
>2gel_A Putative GRAM negative resuscitation promoting FA; YEAZ, RPF, actin-like-fold, glycoprotease, chaperone; 2.05A {Salmonella typhimurium} PDB: 2gem_A 1okj_A Back     alignment and structure
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1ee0_A 2-pyrone synthase; polyketide synthase, thiolase fold, transferase; HET: CAA; 2.05A {Gerbera hybrid cultivar} SCOP: c.95.1.2 c.95.1.2 PDB: 1qlv_A Back     alignment and structure
>3a5r_A Benzalacetone synthase; chalcone synthase, type III polyketide synthase, transferase, acyltransferase; HET: HC4; 1.60A {Rheum palmatum} PDB: 3a5q_A* 3a5s_A Back     alignment and structure
>1i88_A CHS2, chalcone synthase 2; polyketide synthase, transferase; 1.45A {Medicago sativa} SCOP: c.95.1.2 c.95.1.2 PDB: 1i89_A 1i86_A 1i8b_A 1bi5_A 1cml_A* 1d6f_A* 1chw_A* 1cgz_A* 1cgk_A* 1bq6_A* 1jwx_A 1d6i_A 1d6h_A* 1u0v_A 1u0w_A* 1z1e_A* 1z1f_A* Back     alignment and structure
>2p0u_A Stilbenecarboxylate synthase 2; polyketide synthase, PKS type transferase; 1.90A {Marchantia polymorpha} Back     alignment and structure
>1xes_A Dihydropinosylvin synthase; native structure, transferase; HET: 3IO; 1.70A {Pinus sylvestris} PDB: 1xet_A* 1u0u_A Back     alignment and structure
>3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A Back     alignment and structure
>3r6m_A YEAZ, resuscitation promoting factor; actin/HSP70 nucleotide-binding fold, bacterial resuscitation BUT non-culturable state, Y YJEE; 3.10A {Vibrio parahaemolyticus} Back     alignment and structure
>3awk_A Chalcone synthase-like polyketide synthase; type III polyketide synthase, transferase; 2.00A {Huperzia serrata} PDB: 3awj_A Back     alignment and structure
>1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} Back     alignment and structure
>4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 109
d1bupa2193 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATP 3e-12
d1dkgd2198 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATP 1e-09
d1dkgd1183 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPas 3e-07
d1bupa1185 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPas 2e-05
d1jcea2196 c.55.1.1 (A:141-336) Prokaryotic actin homolog Mre 1e-04
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 193 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Heat shock protein 70kDa, ATPase fragment
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 57.7 bits (139), Expect = 3e-12
 Identities = 25/55 (45%), Positives = 36/55 (65%)

Query: 29  EEINHASGLNGAGALTIVLEDADMNKKDVDEIVLVGGSTRIPKVQQLVKEFFNSK 83
           EE+N          +   L DA ++K  + +IVLVGGSTRIPK+Q+L+++FFN K
Sbjct: 115 EELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGK 169
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 198 Back     information, alignment and structure
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 183 Back     information, alignment and structure
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 185 Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 196 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
d1dkgd2198 Heat shock protein 70kDa, ATPase fragment {Escheri 99.8
d1bupa2193 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 99.78
d1jcea2196 Prokaryotic actin homolog MreB {Thermotoga maritim 99.32
d2zgya2163 Plasmid segregation protein ParM {Escherichia coli 97.93
d1e4ft2191 Cell division protein FtsA {Thermotoga maritima [T 97.82
d2fsja1161 Hypothetical protein Ta0583 {Archaeon Thermoplasma 97.21
d1huxa_259 Hydroxyglutaryl-CoA dehydratase component A {Acida 96.06
d2p3ra2247 Glycerol kinase {Escherichia coli [TaxId: 562]} 93.8
d1r59o2235 Glycerol kinase {Enterococcus casseliflavus [TaxId 92.2
d1k8ka2258 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 91.17
d1k8kb1190 Actin-related protein 2, Arp2 {Cow (Bos taurus) [T 90.89
d1u6ea2148 Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu 90.83
d1u0ma1200 Putative polyketide synthase SCO1206 {Streptomyces 90.31
d1ub7a2149 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 90.05
d1hnja2143 Ketoacyl-ACP synthase III (FabH) {Escherichia coli 89.89
d1teda_ 372 Polyketide synthase PKS18 {Mycobacterium tuberculo 89.69
d2fxua2225 Actin {Cow (Bos taurus) [TaxId: 9913]} 89.06
d1ub7a1172 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 88.94
d2ewca1120 Hypothetical protein SPy2060 {Streptococcus pyogen 88.4
d1mzja2153 Priming beta-ketosynthase from the r1128 polyketid 88.03
d1hnja1174 Ketoacyl-ACP synthase III (FabH) {Escherichia coli 87.9
d1dkgd1183 Heat shock protein 70kDa, ATPase fragment {Escheri 87.53
d1bupa1185 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 87.12
d1bi5a1235 Chalcone synthase {Alfalfa (Medicago sativa) [TaxI 86.76
d1okja1106 Hypothetical protein YeaZ {Escherichia coli [TaxId 86.69
d2ewsa1267 Type II pantothenate kinase, CoaW {Staphylococcus 86.17
d1u6ea1184 Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu 85.68
d2a6aa1103 Hypothetical protein TM0874 {Thermotoga maritima [ 84.11
d1nbwa3202 ATPase domain of the glycerol dehydratase reactiva 83.25
d1xhoa_112 Chorismate mutase {Clostridium thermocellum [TaxId 82.09
d2d0oa3203 Diol dehydratase-reactivating factor large subunit 82.03
d1jcea1137 Prokaryotic actin homolog MreB {Thermotoga maritim 80.74
d1u0ma2148 Putative polyketide synthase SCO1206 {Streptomyces 80.48
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Heat shock protein 70kDa, ATPase fragment
species: Escherichia coli, gene dnaK [TaxId: 562]

Probab=99.80  E-value=6.1e-21  Score=133.15  Aligned_cols=83  Identities=31%  Similarity=0.458  Sum_probs=75.7

Q ss_pred             CccccCHHHHHHHhHHHHHHHHHHHHHHHHhcCCCcccccEEEEecCccccchhhHHHHHHhccc-----chhHHHhhhc
Q psy13580         19 PQPSTSPEPREEINHASGLNGAGALTIVLEDADMNKKDVDEIVLVGGSTRIPKVQQLVKEFFNSK-----MKETAEAYLG   93 (109)
Q Consensus        19 ~~~~itr~~fe~l~~~~~~~~~~~v~~~l~~a~~~~~~I~~VilvGGssriP~V~~~l~~~f~~~-----~~~~a~a~lG   93 (109)
                      ++.+|||++|+++++|+++++.++++++|+++++++++|+.|+|+||+||+|.|++.|++.|+..     .|..+++. |
T Consensus       111 ~~~~itr~~~~~~~~~~~~~~~~~i~~~l~~a~~~~~~Id~v~lvGG~sr~p~l~~~i~~~f~~~~~~~~~p~~aVa~-G  189 (198)
T d1dkgd2         111 MNIKVTRAKLESLVEDLVNRSIELLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAI-G  189 (198)
T ss_dssp             EEEEEEHHHHHHHSHHHHHHHHHHHHHHHHTTTCCTTTCCEEEEESGGGGSHHHHHHHHHHHSSCCBCSSCTTTHHHH-H
T ss_pred             EEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHhCCChhHCcEEEEEcCccCCHHHHHHHHHHHCCCCCCCCChHHHHHH-H
Confidence            35679999999999999999999999999999999999999999999999999999999999532     24578888 9


Q ss_pred             cchhheeec
Q psy13580         94 KKVTHAVVT  102 (109)
Q Consensus        94 aai~~a~lt  102 (109)
                      ||++||++|
T Consensus       190 Aa~~aa~lS  198 (198)
T d1dkgd2         190 AAVQGGVLT  198 (198)
T ss_dssp             HHHHTTTTC
T ss_pred             HHHHHHhcC
Confidence            999999875
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1r59o2 c.55.1.4 (O:257-491) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} Back     information, alignment and structure
>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1u6ea2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u0ma1 c.95.1.2 (A:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ub7a2 c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hnja2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ub7a1 c.95.1.2 (A:2-173) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ewca1 d.79.1.1 (A:3-122) Hypothetical protein SPy2060 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Back     information, alignment and structure
>d1hnja1 c.95.1.2 (A:1-174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bi5a1 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1okja1 c.55.1.9 (A:1-106) Hypothetical protein YeaZ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ewsa1 c.55.1.14 (A:1-267) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2a6aa1 c.55.1.9 (A:1-103) Hypothetical protein TM0874 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nbwa3 c.55.1.6 (A:406-607) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1xhoa_ d.79.1.2 (A:) Chorismate mutase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2d0oa3 c.55.1.6 (A:404-606) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]} Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u0ma2 c.95.1.2 (A:202-349) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure