Psyllid ID: psy13599
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 120 | ||||||
| 322798371 | 696 | hypothetical protein SINV_02598 [Solenop | 0.525 | 0.090 | 0.666 | 3e-17 | |
| 307194680 | 687 | Uncharacterized aarF domain-containing p | 0.441 | 0.077 | 0.754 | 7e-17 | |
| 340725065 | 689 | PREDICTED: chaperone activity of bc1 com | 0.475 | 0.082 | 0.701 | 1e-16 | |
| 350398351 | 689 | PREDICTED: chaperone activity of bc1 com | 0.475 | 0.082 | 0.701 | 1e-16 | |
| 383865801 | 680 | PREDICTED: chaperone activity of bc1 com | 0.475 | 0.083 | 0.701 | 1e-16 | |
| 380021104 | 567 | PREDICTED: chaperone activity of bc1 com | 0.441 | 0.093 | 0.716 | 1e-16 | |
| 332021879 | 684 | Chaperone activity of bc1 complex-like, | 0.516 | 0.090 | 0.677 | 2e-16 | |
| 307167954 | 682 | Uncharacterized aarF domain-containing p | 0.525 | 0.092 | 0.634 | 2e-16 | |
| 345483054 | 701 | PREDICTED: chaperone activity of bc1 com | 0.475 | 0.081 | 0.719 | 2e-16 | |
| 328782774 | 688 | PREDICTED: chaperone activity of bc1 com | 0.475 | 0.082 | 0.684 | 3e-16 |
| >gi|322798371|gb|EFZ20095.1| hypothetical protein SINV_02598 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
Score = 92.4 bits (228), Expect = 3e-17, Method: Compositional matrix adjust.
Identities = 42/63 (66%), Positives = 47/63 (74%)
Query: 1 MILSEVFSEKIGEFDFGGQDTTKRITELVPTILNHRLCPPPEEIYSLHRKLSGKVLVHCL 60
MIL +VF +DFGGQD TKRI LVPTI+NHRLCPPPEEIYSLHRKLSG L+
Sbjct: 616 MILGQVFDNNREYYDFGGQDVTKRIQTLVPTIINHRLCPPPEEIYSLHRKLSGIFLLCAK 675
Query: 61 MGI 63
G+
Sbjct: 676 FGV 678
|
Source: Solenopsis invicta Species: Solenopsis invicta Genus: Solenopsis Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307194680|gb|EFN76939.1| Uncharacterized aarF domain-containing protein kinase 4 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|340725065|ref|XP_003400895.1| PREDICTED: chaperone activity of bc1 complex-like, mitochondrial-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350398351|ref|XP_003485168.1| PREDICTED: chaperone activity of bc1 complex-like, mitochondrial-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383865801|ref|XP_003708361.1| PREDICTED: chaperone activity of bc1 complex-like, mitochondrial-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|380021104|ref|XP_003694414.1| PREDICTED: chaperone activity of bc1 complex-like, mitochondrial-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|332021879|gb|EGI62215.1| Chaperone activity of bc1 complex-like, mitochondrial [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307167954|gb|EFN61320.1| Uncharacterized aarF domain-containing protein kinase 4 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|345483054|ref|XP_001605712.2| PREDICTED: chaperone activity of bc1 complex-like, mitochondrial-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|328782774|ref|XP_624948.3| PREDICTED: chaperone activity of bc1 complex-like, mitochondrial-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 120 | ||||||
| FB|FBgn0030976 | 226 | CG7378 [Drosophila melanogaste | 0.516 | 0.274 | 0.580 | 7.7e-16 | |
| FB|FBgn0052649 | 661 | CG32649 [Drosophila melanogast | 0.65 | 0.118 | 0.512 | 7.1e-15 | |
| MGI|MGI:1914209 | 211 | Dusp26 "dual specificity phosp | 0.566 | 0.322 | 0.507 | 6.2e-14 | |
| RGD|1310090 | 211 | Dusp26 "dual specificity phosp | 0.566 | 0.322 | 0.507 | 1e-13 | |
| UNIPROTKB|F1ME76 | 198 | DUSP13 "Uncharacterized protei | 0.516 | 0.313 | 0.532 | 1.3e-13 | |
| UNIPROTKB|J9NU56 | 286 | DUSP13 "Uncharacterized protei | 0.516 | 0.216 | 0.532 | 1.8e-13 | |
| ZFIN|ZDB-GENE-080204-69 | 189 | zgc:172281 "zgc:172281" [Danio | 0.525 | 0.333 | 0.523 | 2.7e-13 | |
| UNIPROTKB|E9PSD4 | 147 | DUSP13 "Dual-specificity prote | 0.525 | 0.428 | 0.507 | 3.4e-13 | |
| UNIPROTKB|F1S2G0 | 264 | DUSP13 "Uncharacterized protei | 0.516 | 0.234 | 0.516 | 3.4e-13 | |
| UNIPROTKB|I3LDI1 | 188 | LOC100152994 "Uncharacterized | 0.6 | 0.382 | 0.493 | 3.4e-13 |
| FB|FBgn0030976 CG7378 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 198 (74.8 bits), Expect = 7.7e-16, P = 7.7e-16
Identities = 36/62 (58%), Positives = 50/62 (80%)
Query: 53 GKVLVHCLMGISRSSTCILAYLILKKKFRLTEALRLLRQSRDVRPNYGFLRQLAYLDNQL 112
GK+LVHCL+G+SRS+TC+LAYL++ +K +A+R +R RD+RPN GFL+QLA LD +L
Sbjct: 159 GKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRDIRPNDGFLQQLADLDMEL 218
Query: 113 NR 114
R
Sbjct: 219 KR 220
|
|
| FB|FBgn0052649 CG32649 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914209 Dusp26 "dual specificity phosphatase 26 (putative)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1310090 Dusp26 "dual specificity phosphatase 26 (putative)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1ME76 DUSP13 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NU56 DUSP13 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-080204-69 zgc:172281 "zgc:172281" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PSD4 DUSP13 "Dual-specificity protein phosphatase 13 isoform MDSP" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S2G0 DUSP13 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LDI1 LOC100152994 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 120 | |||
| cd00127 | 139 | cd00127, DSPc, Dual specificity phosphatases (DSP) | 2e-18 | |
| pfam00782 | 131 | pfam00782, DSPc, Dual specificity phosphatase, cat | 1e-17 | |
| smart00195 | 138 | smart00195, DSPc, Dual specificity phosphatase, ca | 5e-16 | |
| COG2453 | 180 | COG2453, CDC14, Predicted protein-tyrosine phospha | 8e-11 | |
| PRK12361 | 547 | PRK12361, PRK12361, hypothetical protein; Provisio | 3e-06 | |
| smart00194 | 259 | smart00194, PTPc, Protein tyrosine phosphatase, ca | 0.002 | |
| COG5350 | 172 | COG5350, COG5350, Predicted protein tyrosine phosp | 0.003 |
| >gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
Score = 74.6 bits (184), Expect = 2e-18
Identities = 27/66 (40%), Positives = 38/66 (57%), Gaps = 3/66 (4%)
Query: 47 LHRKLS--GKVLVHCLMGISRSSTCILAYLILKKKFRLTEALRLLRQSR-DVRPNYGFLR 103
+ GKVLVHCL G+SRS+T ++AYL+ L EA ++ R + PN GF+R
Sbjct: 74 IDDAREKGGKVLVHCLAGVSRSATLVIAYLMKTLGLSLREAYEFVKSRRPIISPNAGFMR 133
Query: 104 QLAYLD 109
QL +
Sbjct: 134 QLKEYE 139
|
Structurally similar to tyrosine-specific phosphatases but with a shallower active site cleft and a distinctive active site signature motif, HCxxGxxR. Characterized as VHR- or Cdc25-like. Length = 139 |
| >gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|183473 PRK12361, PRK12361, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|227653 COG5350, COG5350, Predicted protein tyrosine phosphatase [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 120 | ||||
| 2pq5_A | 205 | Crystal Structure Of Dual Specificity Protein Phosp | 5e-14 | ||
| 2gwo_A | 198 | Crystal Structure Of Tmdp Length = 198 | 7e-14 | ||
| 2e0t_A | 151 | Crystal Structure Of Catalytic Domain Of Dual Speci | 2e-13 | ||
| 4hrf_A | 160 | Atomic Structure Of Dusp26 Length = 160 | 3e-12 | ||
| 3f81_A | 183 | Interaction Of Vhr With Sa3 Length = 183 | 5e-12 | ||
| 1vhr_A | 184 | Human Vh1-Related Dual-Specificity Phosphatase Leng | 5e-12 | ||
| 2y96_A | 219 | Structure Of Human Dual-Specificity Phosphatase 27 | 8e-12 | ||
| 1j4x_A | 184 | Human Vh1-Related Dual-Specificity Phosphatase C124 | 6e-11 | ||
| 2g6z_A | 211 | Crystal Structure Of Human Dusp5 Length = 211 | 1e-10 | ||
| 3ezz_A | 144 | Crystal Structure Of Human Mkp-2 Length = 144 | 3e-10 | ||
| 2wgp_A | 190 | Crystal Structure Of Human Dual Specificity Phospha | 8e-09 | ||
| 1m3g_A | 145 | Solution Structure Of The Catalytic Domain Of Mapk | 8e-09 | ||
| 2esb_A | 188 | Crystal Structure Of Human Dusp18 Length = 188 | 5e-08 | ||
| 3lj8_A | 146 | Crystal Structure Of Mkp-4 Length = 146 | 1e-07 | ||
| 1wrm_A | 165 | Crystal Structure Of Jsp-1 Length = 165 | 3e-07 | ||
| 2oud_A | 177 | Crystal Structure Of The Catalytic Domain Of Human | 5e-07 | ||
| 2hxp_A | 155 | Crystal Structure Of The Human Phosphatase (Dusp9) | 1e-06 | ||
| 1zzw_A | 149 | Crystal Structure Of Catalytic Domain Of Human Map | 1e-06 | ||
| 2nt2_A | 145 | Crystal Structure Of Slingshot Phosphatase 2 Length | 5e-06 | ||
| 1mkp_A | 144 | Crystal Structure Of Pyst1 (Mkp3) Length = 144 | 8e-06 | ||
| 2r0b_A | 154 | Crystal Structure Of Human Tyrosine Phosphatase-lik | 1e-05 | ||
| 3s4e_A | 144 | Crystal Structrue Of A Novel Mitogen-Activated Prot | 3e-05 | ||
| 2j16_B | 182 | Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 | 5e-05 | ||
| 2hcm_A | 164 | Crystal Structure Of Mouse Putative Dual Specificit | 1e-04 | ||
| 1yz4_A | 160 | Crystal Structure Of Dusp15 Length = 160 | 2e-04 | ||
| 2j17_A | 182 | Ptyr Bound Form Of Sdp-1 Length = 182 | 7e-04 |
| >pdb|2PQ5|A Chain A, Crystal Structure Of Dual Specificity Protein Phosphatase 13 (Dusp13) Length = 205 | Back alignment and structure |
|
| >pdb|2GWO|A Chain A, Crystal Structure Of Tmdp Length = 198 | Back alignment and structure |
| >pdb|2E0T|A Chain A, Crystal Structure Of Catalytic Domain Of Dual Specificity Phosphatase 26, Ms0830 From Homo Sapiens Length = 151 | Back alignment and structure |
| >pdb|4HRF|A Chain A, Atomic Structure Of Dusp26 Length = 160 | Back alignment and structure |
| >pdb|3F81|A Chain A, Interaction Of Vhr With Sa3 Length = 183 | Back alignment and structure |
| >pdb|1VHR|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase Length = 184 | Back alignment and structure |
| >pdb|2Y96|A Chain A, Structure Of Human Dual-Specificity Phosphatase 27 Length = 219 | Back alignment and structure |
| >pdb|1J4X|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase C124s Mutant- Peptide Complex Length = 184 | Back alignment and structure |
| >pdb|2G6Z|A Chain A, Crystal Structure Of Human Dusp5 Length = 211 | Back alignment and structure |
| >pdb|3EZZ|A Chain A, Crystal Structure Of Human Mkp-2 Length = 144 | Back alignment and structure |
| >pdb|2WGP|A Chain A, Crystal Structure Of Human Dual Specificity Phosphatase 14 Length = 190 | Back alignment and structure |
| >pdb|1M3G|A Chain A, Solution Structure Of The Catalytic Domain Of Mapk Phosphatase Pac-1: Insights Into Substrate-Induced Enzymatic Activation Length = 145 | Back alignment and structure |
| >pdb|2ESB|A Chain A, Crystal Structure Of Human Dusp18 Length = 188 | Back alignment and structure |
| >pdb|3LJ8|A Chain A, Crystal Structure Of Mkp-4 Length = 146 | Back alignment and structure |
| >pdb|1WRM|A Chain A, Crystal Structure Of Jsp-1 Length = 165 | Back alignment and structure |
| >pdb|2OUD|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mkp5 Length = 177 | Back alignment and structure |
| >pdb|2HXP|A Chain A, Crystal Structure Of The Human Phosphatase (Dusp9) Length = 155 | Back alignment and structure |
| >pdb|1ZZW|A Chain A, Crystal Structure Of Catalytic Domain Of Human Map Kinase Phosphatase 5 Length = 149 | Back alignment and structure |
| >pdb|2NT2|A Chain A, Crystal Structure Of Slingshot Phosphatase 2 Length = 145 | Back alignment and structure |
| >pdb|1MKP|A Chain A, Crystal Structure Of Pyst1 (Mkp3) Length = 144 | Back alignment and structure |
| >pdb|2R0B|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase-like Serine/threonine/tyrosine-interacting Protein Length = 154 | Back alignment and structure |
| >pdb|3S4E|A Chain A, Crystal Structrue Of A Novel Mitogen-Activated Protein Kinase Phosphatase, Skrp1 Length = 144 | Back alignment and structure |
| >pdb|2J16|B Chain B, Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 | Back alignment and structure |
| >pdb|2HCM|A Chain A, Crystal Structure Of Mouse Putative Dual Specificity Phosphatase Complexed With Zinc Tungstate, New York Structural Genomics Consortium Length = 164 | Back alignment and structure |
| >pdb|1YZ4|A Chain A, Crystal Structure Of Dusp15 Length = 160 | Back alignment and structure |
| >pdb|2J17|A Chain A, Ptyr Bound Form Of Sdp-1 Length = 182 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 120 | |||
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 2e-27 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 8e-27 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 1e-26 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 1e-26 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 8e-26 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 1e-25 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 2e-25 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 2e-25 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 4e-25 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 5e-25 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 8e-25 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 1e-24 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 1e-24 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 1e-24 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 1e-24 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 2e-24 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 3e-24 | |
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 5e-24 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 3e-23 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 4e-23 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 3e-21 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 9e-21 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 9e-13 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 4e-10 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 9e-10 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 9e-09 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 2e-08 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 2e-07 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 3e-07 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 5e-04 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 9e-04 |
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
Score = 97.7 bits (244), Expect = 2e-27
Identities = 31/66 (46%), Positives = 45/66 (68%)
Query: 49 RKLSGKVLVHCLMGISRSSTCILAYLILKKKFRLTEALRLLRQSRDVRPNYGFLRQLAYL 108
+ GK+LVHC +G+SRS+T +LAYL+L L EA++ ++ R + PN GFLRQL L
Sbjct: 82 SQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLAL 141
Query: 109 DNQLNR 114
D +L +
Sbjct: 142 DRRLRQ 147
|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Length = 339 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 120 | ||||
| d1vhra_ | 178 | c.45.1.1 (A:) VH1-related dual-specificity phospha | 7e-19 | |
| d1m3ga_ | 145 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 2e-16 | |
| d1mkpa_ | 144 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 2e-15 | |
| d1i9sa_ | 194 | c.45.1.1 (A:) mRNA capping enzyme, triphosphatase | 4e-13 | |
| d1ohea2 | 182 | c.45.1.1 (A:199-380) Proline directed phosphatase | 7e-11 | |
| d1fpza_ | 176 | c.45.1.1 (A:) Kinase associated phosphatase (kap) | 2e-06 | |
| d1d5ra2 | 174 | c.45.1.1 (A:14-187) Phoshphoinositide phosphatase | 2e-06 | |
| d1rxda_ | 152 | c.45.1.1 (A:) Protein tyrosine phosphatase type IV | 5e-05 | |
| d2pt0a1 | 313 | c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho | 1e-04 |
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: VH1-related dual-specificity phosphatase, VHR species: Human (Homo sapiens) [TaxId: 9606]
Score = 75.2 bits (184), Expect = 7e-19
Identities = 31/82 (37%), Positives = 52/82 (63%)
Query: 33 LNHRLCPPPEEIYSLHRKLSGKVLVHCLMGISRSSTCILAYLILKKKFRLTEALRLLRQS 92
L+ + I + +G+VLVHC G SRS T ++AYL++++K + AL ++RQ+
Sbjct: 91 LSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQN 150
Query: 93 RDVRPNYGFLRQLAYLDNQLNR 114
R++ PN GFL QL L+++L +
Sbjct: 151 REIGPNDGFLAQLCQLNDRLAK 172
|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 120 | |||
| d1vhra_ | 178 | VH1-related dual-specificity phosphatase, VHR {Hum | 99.91 | |
| d1mkpa_ | 144 | Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp | 99.89 | |
| d1m3ga_ | 145 | Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax | 99.88 | |
| d1i9sa_ | 194 | mRNA capping enzyme, triphosphatase domain {Mouse | 99.76 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 99.75 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 99.72 | |
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 99.7 | |
| d1d5ra2 | 174 | Phoshphoinositide phosphatase Pten (Pten tumor sup | 99.66 | |
| d1g4us2 | 243 | SptP tyrosine phosphatase, catalytic domain {Salmo | 99.13 | |
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 99.02 | |
| d1wcha_ | 308 | Tyrosine-protein phosphatase, non-receptor type 13 | 98.96 | |
| d1jlna_ | 297 | Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl | 98.91 | |
| d2pt0a1 | 313 | Myo-inositol hexaphosphate phosphohydrolase (phyta | 98.84 | |
| d2shpa1 | 307 | Tyrosine phosphatase {Human (Homo sapiens), shp-2 | 98.84 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 98.84 | |
| d2f71a1 | 297 | Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta | 98.84 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 98.83 | |
| d1fpra_ | 284 | Tyrosine phosphatase {Human (Homo sapiens), shp-1 | 98.81 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 98.77 | |
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 98.77 | |
| d1yfoa_ | 288 | Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: | 98.77 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 98.75 | |
| d1lyva_ | 283 | Protein-tyrosine phosphatase YopH, catalytic domai | 98.68 | |
| d1ywfa1 | 272 | Phosphotyrosine protein phosphatase PtpB {Mycobact | 97.63 | |
| d1ohea1 | 157 | Proline directed phosphatase CDC14b2 {Human (Homo | 96.34 | |
| d1tq1a_ | 119 | Thiosulfate sulfurtransferase/Senescence-associate | 90.17 | |
| d1zsqa2 | 387 | Myotubularin-related protein 2, C-terminal domain | 85.64 | |
| d1rhsa2 | 144 | Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | 84.16 | |
| d1urha2 | 120 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 80.43 |
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: VH1-related dual-specificity phosphatase, VHR species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.91 E-value=5.8e-25 Score=154.41 Aligned_cols=78 Identities=38% Similarity=0.690 Sum_probs=71.8
Q ss_pred ChHHHHHHHHhcC---CcEEEEeccCCchhHHHHHHHHHHHcCCCHHHHHHHHHhcCCCCCCHHHHHHHHHHHHHHhhcc
Q psy13599 40 PPEEIYSLHRKLS---GKVLVHCLMGISRSSTCILAYLILKKKFRLTEALRLLRQSRDVRPNYGFLRQLAYLDNQLNRSA 116 (120)
Q Consensus 40 ~~~~~~~i~~~~~---~~VlVHC~~G~~RS~~vv~ayLm~~~~~~~~~A~~~vr~~R~i~pn~~~~~~L~~~e~~l~~~~ 116 (120)
..+++.||++... ++|||||.+|+|||+++++||||++.||++++|+++||.+||+.||.+|+.||.+||+.|.+++
T Consensus 95 ~~~~~~fi~~~~~~~~~~VLVHC~~G~sRS~~vv~aYLm~~~~~s~~~A~~~vr~~R~i~pn~~f~~qL~~~e~~L~~~~ 174 (178)
T d1vhra_ 95 FERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEG 174 (178)
T ss_dssp HHHHHHHHHHHHTSTTCCEEEECSSSSSHHHHHHHHHHHHHSCCCHHHHHHHHHHHSCCCCCHHHHHHHHHHHHHHHHTT
T ss_pred HHHHHHHhhhhhhcCCceEEEEcCCCCccHHHHHHHHHHHhcCCCHHHHHHHHHhCCCCCCCHHHHHHHHHHHHHHHHcC
Confidence 3467888888664 6999999999999999999999999999999999999999999999999999999999998876
Q ss_pred c
Q psy13599 117 A 117 (120)
Q Consensus 117 ~ 117 (120)
+
T Consensus 175 ~ 175 (178)
T d1vhra_ 175 K 175 (178)
T ss_dssp C
T ss_pred C
Confidence 5
|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|