Psyllid ID: psy13599


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MILSEVFSEKIGEFDFGGQDTTKRITELVPTILNHRLCPPPEEIYSLHRKLSGKVLVHCLMGISRSSTCILAYLILKKKFRLTEALRLLRQSRDVRPNYGFLRQLAYLDNQLNRSAASQV
cccccccccccccccccccEEEEEEcccccHHHHccccccHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccc
ccccccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccc
MILSEVFSEkigefdfggqdtTKRITELVPTilnhrlcpppeeiySLHRKLSGKVLVHCLMGISRSSTCILAYLILKKKFRLTEALRLLRQSrdvrpnygfLRQLAYLDNQLnrsaasqv
MILSEVFSekigefdfggqdttkRITELVPTILNHRLCPPPEEIYSLHRKLSGKVLVHCLMGISRSSTCILAYLILKKKFRLTEALRLLrqsrdvrpnyGFLRQlayldnqlnrsaasqv
MILSEVFSEKIGEFDFGGQDTTKRITELVPTILNHRLCPPPEEIYSLHRKLSGKVLVHCLMGISRSSTCILAYLILKKKFRLTEALRLLRQSRDVRPNYGFLRQLAYLDNQLNRSAASQV
*********KIGEFDFGGQDTTKRITELVPTILNHRLCPPPEEIYSLHRKLSGKVLVHCLMGISRSSTCILAYLILKKKFRLTEALRLLRQSRDVRPNYGFLRQLAYLD***********
MILSEVFSEKIGEFDFGGQDTTKRITELVPTILNHRLCPPPEEIYSLHRKLSGKVLVHCLMGISRSSTCILAYLILKKKFRLTEALRLLRQSRDVRPNYGFLRQLAYLDN**********
MILSEVFSEKIGEFDFGGQDTTKRITELVPTILNHRLCPPPEEIYSLHRKLSGKVLVHCLMGISRSSTCILAYLILKKKFRLTEALRLLRQSRDVRPNYGFLRQLAYLDNQL********
*ILSEVFSEKIGEFDFGGQDTTKRITELVPTILNHRLCPPPEEIYSLHRKLSGKVLVHCLMGISRSSTCILAYLILKKKFRLTEALRLLRQSRDVRPNYGFLRQLAYLDNQLNRS*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILSEVFSEKIGEFDFGGQDTTKRITELVPTILNHRLCPPPEEIYSLHRKLSGKVLVHCLMGISRSSTCILAYLILKKKFRLTEALRLLRQSRDVRPNYGFLRQLAYLDNQLNRSAASQV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query120 2.2.26 [Sep-21-2011]
Q96D53544 Uncharacterized aarF doma no N/A 0.458 0.101 0.571 1e-13
Q9D700211 Dual specificity protein yes N/A 0.55 0.312 0.521 4e-13
Q5FVI9211 Dual specificity protein yes N/A 0.575 0.327 0.5 5e-13
Q9UII6198 Dual specificity protein no N/A 0.516 0.313 0.516 9e-13
Q6B8I0188 Dual specificity protein no N/A 0.6 0.382 0.48 1e-12
Q6B8I1188 Dual specificity protein no N/A 0.6 0.382 0.493 2e-12
Q5RGU1602 Chaperone activity of bc1 no N/A 0.466 0.093 0.561 2e-12
Q9BV47211 Dual specificity protein no N/A 0.575 0.327 0.486 3e-12
Q5R6H6211 Dual specificity protein no N/A 0.575 0.327 0.486 3e-12
Q60936645 Chaperone activity of bc1 no N/A 0.466 0.086 0.543 4e-12
>sp|Q96D53|ADCK4_HUMAN Uncharacterized aarF domain-containing protein kinase 4 OS=Homo sapiens GN=ADCK4 PE=1 SV=2 Back     alignment and function desciption
 Score = 75.1 bits (183), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 1/56 (1%)

Query: 1   MILSEVFSEKIGEFDFGGQDTTKRITELVPTILNHRLCPPPEEIYSLHRKLSGKVL 56
           MIL E F+ + G +DFG  +T +RI +L+P +L HRLCPPPEE Y+LHRKL+G  L
Sbjct: 443 MILGEPFATQ-GPYDFGSGETARRIQDLIPVLLRHRLCPPPEETYALHRKLAGAFL 497




The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr).
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: -
>sp|Q9D700|DUS26_MOUSE Dual specificity protein phosphatase 26 OS=Mus musculus GN=Dusp26 PE=2 SV=2 Back     alignment and function description
>sp|Q5FVI9|DUS26_RAT Dual specificity protein phosphatase 26 OS=Rattus norvegicus GN=Dusp26 PE=2 SV=1 Back     alignment and function description
>sp|Q9UII6|DUS13_HUMAN Dual specificity protein phosphatase 13 OS=Homo sapiens GN=DUSP13 PE=1 SV=3 Back     alignment and function description
>sp|Q6B8I0|MDSP_MOUSE Dual specificity protein phosphatase isoform MDSP OS=Mus musculus GN=Dusp13 PE=2 SV=1 Back     alignment and function description
>sp|Q6B8I1|MDSP_HUMAN Dual specificity protein phosphatase 13 isoform MDSP OS=Homo sapiens GN=DUSP13 PE=1 SV=1 Back     alignment and function description
>sp|Q5RGU1|ADCK3_DANRE Chaperone activity of bc1 complex-like, mitochondrial OS=Danio rerio GN=adck3 PE=2 SV=1 Back     alignment and function description
>sp|Q9BV47|DUS26_HUMAN Dual specificity protein phosphatase 26 OS=Homo sapiens GN=DUSP26 PE=1 SV=1 Back     alignment and function description
>sp|Q5R6H6|DUS26_PONAB Dual specificity protein phosphatase 26 OS=Pongo abelii GN=DUSP26 PE=2 SV=1 Back     alignment and function description
>sp|Q60936|ADCK3_MOUSE Chaperone activity of bc1 complex-like, mitochondrial OS=Mus musculus GN=Adck3 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query120
322798371 696 hypothetical protein SINV_02598 [Solenop 0.525 0.090 0.666 3e-17
307194680 687 Uncharacterized aarF domain-containing p 0.441 0.077 0.754 7e-17
340725065 689 PREDICTED: chaperone activity of bc1 com 0.475 0.082 0.701 1e-16
350398351 689 PREDICTED: chaperone activity of bc1 com 0.475 0.082 0.701 1e-16
383865801 680 PREDICTED: chaperone activity of bc1 com 0.475 0.083 0.701 1e-16
380021104 567 PREDICTED: chaperone activity of bc1 com 0.441 0.093 0.716 1e-16
332021879 684 Chaperone activity of bc1 complex-like, 0.516 0.090 0.677 2e-16
307167954 682 Uncharacterized aarF domain-containing p 0.525 0.092 0.634 2e-16
345483054 701 PREDICTED: chaperone activity of bc1 com 0.475 0.081 0.719 2e-16
328782774 688 PREDICTED: chaperone activity of bc1 com 0.475 0.082 0.684 3e-16
>gi|322798371|gb|EFZ20095.1| hypothetical protein SINV_02598 [Solenopsis invicta] Back     alignment and taxonomy information
 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/63 (66%), Positives = 47/63 (74%)

Query: 1   MILSEVFSEKIGEFDFGGQDTTKRITELVPTILNHRLCPPPEEIYSLHRKLSGKVLVHCL 60
           MIL +VF      +DFGGQD TKRI  LVPTI+NHRLCPPPEEIYSLHRKLSG  L+   
Sbjct: 616 MILGQVFDNNREYYDFGGQDVTKRIQTLVPTIINHRLCPPPEEIYSLHRKLSGIFLLCAK 675

Query: 61  MGI 63
            G+
Sbjct: 676 FGV 678




Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307194680|gb|EFN76939.1| Uncharacterized aarF domain-containing protein kinase 4 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340725065|ref|XP_003400895.1| PREDICTED: chaperone activity of bc1 complex-like, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350398351|ref|XP_003485168.1| PREDICTED: chaperone activity of bc1 complex-like, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383865801|ref|XP_003708361.1| PREDICTED: chaperone activity of bc1 complex-like, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380021104|ref|XP_003694414.1| PREDICTED: chaperone activity of bc1 complex-like, mitochondrial-like [Apis florea] Back     alignment and taxonomy information
>gi|332021879|gb|EGI62215.1| Chaperone activity of bc1 complex-like, mitochondrial [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307167954|gb|EFN61320.1| Uncharacterized aarF domain-containing protein kinase 4 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345483054|ref|XP_001605712.2| PREDICTED: chaperone activity of bc1 complex-like, mitochondrial-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328782774|ref|XP_624948.3| PREDICTED: chaperone activity of bc1 complex-like, mitochondrial-like [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query120
FB|FBgn0030976226 CG7378 [Drosophila melanogaste 0.516 0.274 0.580 7.7e-16
FB|FBgn0052649661 CG32649 [Drosophila melanogast 0.65 0.118 0.512 7.1e-15
MGI|MGI:1914209211 Dusp26 "dual specificity phosp 0.566 0.322 0.507 6.2e-14
RGD|1310090211 Dusp26 "dual specificity phosp 0.566 0.322 0.507 1e-13
UNIPROTKB|F1ME76198 DUSP13 "Uncharacterized protei 0.516 0.313 0.532 1.3e-13
UNIPROTKB|J9NU56286 DUSP13 "Uncharacterized protei 0.516 0.216 0.532 1.8e-13
ZFIN|ZDB-GENE-080204-69189 zgc:172281 "zgc:172281" [Danio 0.525 0.333 0.523 2.7e-13
UNIPROTKB|E9PSD4147 DUSP13 "Dual-specificity prote 0.525 0.428 0.507 3.4e-13
UNIPROTKB|F1S2G0264 DUSP13 "Uncharacterized protei 0.516 0.234 0.516 3.4e-13
UNIPROTKB|I3LDI1188 LOC100152994 "Uncharacterized 0.6 0.382 0.493 3.4e-13
FB|FBgn0030976 CG7378 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 198 (74.8 bits), Expect = 7.7e-16, P = 7.7e-16
 Identities = 36/62 (58%), Positives = 50/62 (80%)

Query:    53 GKVLVHCLMGISRSSTCILAYLILKKKFRLTEALRLLRQSRDVRPNYGFLRQLAYLDNQL 112
             GK+LVHCL+G+SRS+TC+LAYL++ +K    +A+R +R  RD+RPN GFL+QLA LD +L
Sbjct:   159 GKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRDIRPNDGFLQQLADLDMEL 218

Query:   113 NR 114
              R
Sbjct:   219 KR 220




GO:0006470 "protein dephosphorylation" evidence=IBA;NAS
GO:0008138 "protein tyrosine/serine/threonine phosphatase activity" evidence=IBA;NAS
GO:0005575 "cellular_component" evidence=ND
GO:0004725 "protein tyrosine phosphatase activity" evidence=IEA
FB|FBgn0052649 CG32649 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1914209 Dusp26 "dual specificity phosphatase 26 (putative)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310090 Dusp26 "dual specificity phosphatase 26 (putative)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1ME76 DUSP13 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NU56 DUSP13 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080204-69 zgc:172281 "zgc:172281" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E9PSD4 DUSP13 "Dual-specificity protein phosphatase 13 isoform MDSP" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S2G0 DUSP13 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LDI1 LOC100152994 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q18486COQ8_CAEELNo assigned EC number0.54710.43330.0688yesN/A
Q92338ABCI_SCHPONo assigned EC number0.51020.40830.0803yesN/A
Q75QN6DPHS1_ARATH3, ., 1, ., 3, ., 4, 80.53330.49160.0635yesN/A
Q9D700DUS26_MOUSE3, ., 1, ., 3, ., 4, 80.52170.550.3127yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.30.691
3rd Layer3.1.3.16LOW CONFIDENCE prediction!
3rd Layer3.1.3.480.737

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
cd00127139 cd00127, DSPc, Dual specificity phosphatases (DSP) 2e-18
pfam00782131 pfam00782, DSPc, Dual specificity phosphatase, cat 1e-17
smart00195138 smart00195, DSPc, Dual specificity phosphatase, ca 5e-16
COG2453180 COG2453, CDC14, Predicted protein-tyrosine phospha 8e-11
PRK12361 547 PRK12361, PRK12361, hypothetical protein; Provisio 3e-06
smart00194259 smart00194, PTPc, Protein tyrosine phosphatase, ca 0.002
COG5350172 COG5350, COG5350, Predicted protein tyrosine phosp 0.003
>gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
 Score = 74.6 bits (184), Expect = 2e-18
 Identities = 27/66 (40%), Positives = 38/66 (57%), Gaps = 3/66 (4%)

Query: 47  LHRKLS--GKVLVHCLMGISRSSTCILAYLILKKKFRLTEALRLLRQSR-DVRPNYGFLR 103
           +       GKVLVHCL G+SRS+T ++AYL+      L EA   ++  R  + PN GF+R
Sbjct: 74  IDDAREKGGKVLVHCLAGVSRSATLVIAYLMKTLGLSLREAYEFVKSRRPIISPNAGFMR 133

Query: 104 QLAYLD 109
           QL   +
Sbjct: 134 QLKEYE 139


Structurally similar to tyrosine-specific phosphatases but with a shallower active site cleft and a distinctive active site signature motif, HCxxGxxR. Characterized as VHR- or Cdc25-like. Length = 139

>gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183473 PRK12361, PRK12361, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|227653 COG5350, COG5350, Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
2pq5_A205 Crystal Structure Of Dual Specificity Protein Phosp 5e-14
2gwo_A198 Crystal Structure Of Tmdp Length = 198 7e-14
2e0t_A151 Crystal Structure Of Catalytic Domain Of Dual Speci 2e-13
4hrf_A160 Atomic Structure Of Dusp26 Length = 160 3e-12
3f81_A183 Interaction Of Vhr With Sa3 Length = 183 5e-12
1vhr_A184 Human Vh1-Related Dual-Specificity Phosphatase Leng 5e-12
2y96_A219 Structure Of Human Dual-Specificity Phosphatase 27 8e-12
1j4x_A184 Human Vh1-Related Dual-Specificity Phosphatase C124 6e-11
2g6z_A211 Crystal Structure Of Human Dusp5 Length = 211 1e-10
3ezz_A144 Crystal Structure Of Human Mkp-2 Length = 144 3e-10
2wgp_A190 Crystal Structure Of Human Dual Specificity Phospha 8e-09
1m3g_A145 Solution Structure Of The Catalytic Domain Of Mapk 8e-09
2esb_A188 Crystal Structure Of Human Dusp18 Length = 188 5e-08
3lj8_A146 Crystal Structure Of Mkp-4 Length = 146 1e-07
1wrm_A165 Crystal Structure Of Jsp-1 Length = 165 3e-07
2oud_A177 Crystal Structure Of The Catalytic Domain Of Human 5e-07
2hxp_A155 Crystal Structure Of The Human Phosphatase (Dusp9) 1e-06
1zzw_A149 Crystal Structure Of Catalytic Domain Of Human Map 1e-06
2nt2_A145 Crystal Structure Of Slingshot Phosphatase 2 Length 5e-06
1mkp_A144 Crystal Structure Of Pyst1 (Mkp3) Length = 144 8e-06
2r0b_A154 Crystal Structure Of Human Tyrosine Phosphatase-lik 1e-05
3s4e_A144 Crystal Structrue Of A Novel Mitogen-Activated Prot 3e-05
2j16_B182 Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 5e-05
2hcm_A164 Crystal Structure Of Mouse Putative Dual Specificit 1e-04
1yz4_A160 Crystal Structure Of Dusp15 Length = 160 2e-04
2j17_A182 Ptyr Bound Form Of Sdp-1 Length = 182 7e-04
>pdb|2PQ5|A Chain A, Crystal Structure Of Dual Specificity Protein Phosphatase 13 (Dusp13) Length = 205 Back     alignment and structure

Iteration: 1

Score = 72.8 bits (177), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 32/62 (51%), Positives = 47/62 (75%) Query: 53 GKVLVHCLMGISRSSTCILAYLILKKKFRLTEALRLLRQSRDVRPNYGFLRQLAYLDNQL 112 G+VLVHC MG+SRS+T +LA+L++ + L EA++ ++ R++ PN GFLRQL LDN+L Sbjct: 132 GRVLVHCAMGVSRSATLVLAFLMIYENMTLVEAIQTVQAHRNICPNSGFLRQLQVLDNRL 191 Query: 113 NR 114 R Sbjct: 192 GR 193
>pdb|2GWO|A Chain A, Crystal Structure Of Tmdp Length = 198 Back     alignment and structure
>pdb|2E0T|A Chain A, Crystal Structure Of Catalytic Domain Of Dual Specificity Phosphatase 26, Ms0830 From Homo Sapiens Length = 151 Back     alignment and structure
>pdb|4HRF|A Chain A, Atomic Structure Of Dusp26 Length = 160 Back     alignment and structure
>pdb|3F81|A Chain A, Interaction Of Vhr With Sa3 Length = 183 Back     alignment and structure
>pdb|1VHR|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase Length = 184 Back     alignment and structure
>pdb|2Y96|A Chain A, Structure Of Human Dual-Specificity Phosphatase 27 Length = 219 Back     alignment and structure
>pdb|1J4X|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase C124s Mutant- Peptide Complex Length = 184 Back     alignment and structure
>pdb|2G6Z|A Chain A, Crystal Structure Of Human Dusp5 Length = 211 Back     alignment and structure
>pdb|3EZZ|A Chain A, Crystal Structure Of Human Mkp-2 Length = 144 Back     alignment and structure
>pdb|2WGP|A Chain A, Crystal Structure Of Human Dual Specificity Phosphatase 14 Length = 190 Back     alignment and structure
>pdb|1M3G|A Chain A, Solution Structure Of The Catalytic Domain Of Mapk Phosphatase Pac-1: Insights Into Substrate-Induced Enzymatic Activation Length = 145 Back     alignment and structure
>pdb|2ESB|A Chain A, Crystal Structure Of Human Dusp18 Length = 188 Back     alignment and structure
>pdb|3LJ8|A Chain A, Crystal Structure Of Mkp-4 Length = 146 Back     alignment and structure
>pdb|1WRM|A Chain A, Crystal Structure Of Jsp-1 Length = 165 Back     alignment and structure
>pdb|2OUD|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mkp5 Length = 177 Back     alignment and structure
>pdb|2HXP|A Chain A, Crystal Structure Of The Human Phosphatase (Dusp9) Length = 155 Back     alignment and structure
>pdb|1ZZW|A Chain A, Crystal Structure Of Catalytic Domain Of Human Map Kinase Phosphatase 5 Length = 149 Back     alignment and structure
>pdb|2NT2|A Chain A, Crystal Structure Of Slingshot Phosphatase 2 Length = 145 Back     alignment and structure
>pdb|1MKP|A Chain A, Crystal Structure Of Pyst1 (Mkp3) Length = 144 Back     alignment and structure
>pdb|2R0B|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase-like Serine/threonine/tyrosine-interacting Protein Length = 154 Back     alignment and structure
>pdb|3S4E|A Chain A, Crystal Structrue Of A Novel Mitogen-Activated Protein Kinase Phosphatase, Skrp1 Length = 144 Back     alignment and structure
>pdb|2J16|B Chain B, Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 Back     alignment and structure
>pdb|2HCM|A Chain A, Crystal Structure Of Mouse Putative Dual Specificity Phosphatase Complexed With Zinc Tungstate, New York Structural Genomics Consortium Length = 164 Back     alignment and structure
>pdb|1YZ4|A Chain A, Crystal Structure Of Dusp15 Length = 160 Back     alignment and structure
>pdb|2J17|A Chain A, Ptyr Bound Form Of Sdp-1 Length = 182 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 2e-27
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 8e-27
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 1e-26
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 1e-26
2oud_A177 Dual specificity protein phosphatase 10; A central 8e-26
2hxp_A155 Dual specificity protein phosphatase 9; human phos 1e-25
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 2e-25
2hcm_A164 Dual specificity protein phosphatase; structural g 2e-25
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 4e-25
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 5e-25
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 8e-25
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 1e-24
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 1e-24
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 1e-24
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 1e-24
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 2e-24
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 3e-24
3emu_A161 Leucine rich repeat and phosphatase domain contain 5e-24
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 3e-23
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 4e-23
2q05_A195 Late protein H1, dual specificity protein phosphat 3e-21
3cm3_A176 Late protein H1, dual specificity protein phosphat 9e-21
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 9e-13
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 4e-10
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 9e-10
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 9e-09
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 2e-08
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 2e-07
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 3e-07
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 5e-04
3v0d_A 339 Voltage-sensor containing phosphatase; PTP, hydrol 9e-04
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 Back     alignment and structure
 Score = 97.7 bits (244), Expect = 2e-27
 Identities = 31/66 (46%), Positives = 45/66 (68%)

Query: 49  RKLSGKVLVHCLMGISRSSTCILAYLILKKKFRLTEALRLLRQSRDVRPNYGFLRQLAYL 108
            +  GK+LVHC +G+SRS+T +LAYL+L     L EA++ ++  R + PN GFLRQL  L
Sbjct: 82  SQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLAL 141

Query: 109 DNQLNR 114
           D +L +
Sbjct: 142 DRRLRQ 147


>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Length = 339 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 120
d1vhra_178 c.45.1.1 (A:) VH1-related dual-specificity phospha 7e-19
d1m3ga_145 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 2e-16
d1mkpa_144 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 2e-15
d1i9sa_194 c.45.1.1 (A:) mRNA capping enzyme, triphosphatase 4e-13
d1ohea2182 c.45.1.1 (A:199-380) Proline directed phosphatase 7e-11
d1fpza_176 c.45.1.1 (A:) Kinase associated phosphatase (kap) 2e-06
d1d5ra2174 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase 2e-06
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 5e-05
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 1e-04
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: VH1-related dual-specificity phosphatase, VHR
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 75.2 bits (184), Expect = 7e-19
 Identities = 31/82 (37%), Positives = 52/82 (63%)

Query: 33  LNHRLCPPPEEIYSLHRKLSGKVLVHCLMGISRSSTCILAYLILKKKFRLTEALRLLRQS 92
           L+       + I     + +G+VLVHC  G SRS T ++AYL++++K  +  AL ++RQ+
Sbjct: 91  LSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQN 150

Query: 93  RDVRPNYGFLRQLAYLDNQLNR 114
           R++ PN GFL QL  L+++L +
Sbjct: 151 REIGPNDGFLAQLCQLNDRLAK 172


>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query120
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 99.91
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 99.89
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 99.88
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 99.76
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 99.75
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 99.72
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.7
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 99.66
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 99.13
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 99.02
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 98.96
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 98.91
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 98.84
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 98.84
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 98.84
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 98.84
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 98.83
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 98.81
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 98.77
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 98.77
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 98.77
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 98.75
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 98.68
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 97.63
d1ohea1157 Proline directed phosphatase CDC14b2 {Human (Homo 96.34
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 90.17
d1zsqa2 387 Myotubularin-related protein 2, C-terminal domain 85.64
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 84.16
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 80.43
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: VH1-related dual-specificity phosphatase, VHR
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.91  E-value=5.8e-25  Score=154.41  Aligned_cols=78  Identities=38%  Similarity=0.690  Sum_probs=71.8

Q ss_pred             ChHHHHHHHHhcC---CcEEEEeccCCchhHHHHHHHHHHHcCCCHHHHHHHHHhcCCCCCCHHHHHHHHHHHHHHhhcc
Q psy13599         40 PPEEIYSLHRKLS---GKVLVHCLMGISRSSTCILAYLILKKKFRLTEALRLLRQSRDVRPNYGFLRQLAYLDNQLNRSA  116 (120)
Q Consensus        40 ~~~~~~~i~~~~~---~~VlVHC~~G~~RS~~vv~ayLm~~~~~~~~~A~~~vr~~R~i~pn~~~~~~L~~~e~~l~~~~  116 (120)
                      ..+++.||++...   ++|||||.+|+|||+++++||||++.||++++|+++||.+||+.||.+|+.||.+||+.|.+++
T Consensus        95 ~~~~~~fi~~~~~~~~~~VLVHC~~G~sRS~~vv~aYLm~~~~~s~~~A~~~vr~~R~i~pn~~f~~qL~~~e~~L~~~~  174 (178)
T d1vhra_          95 FERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEG  174 (178)
T ss_dssp             HHHHHHHHHHHHTSTTCCEEEECSSSSSHHHHHHHHHHHHHSCCCHHHHHHHHHHHSCCCCCHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHhhhhhhcCCceEEEEcCCCCccHHHHHHHHHHHhcCCCHHHHHHHHHhCCCCCCCHHHHHHHHHHHHHHHHcC
Confidence            3467888888664   6999999999999999999999999999999999999999999999999999999999998876


Q ss_pred             c
Q psy13599        117 A  117 (120)
Q Consensus       117 ~  117 (120)
                      +
T Consensus       175 ~  175 (178)
T d1vhra_         175 K  175 (178)
T ss_dssp             C
T ss_pred             C
Confidence            5



>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure