GTPase-activating protein for the ADP ribosylation factor family. May serve as a scaffold to bring together molecules to form signaling modules controlling vesicle trafficking, adhesion and cytoskeletal organization. Increases the speed of cell migration, as well as the size and rate of formation of protrusions, possibly by targeting PAK1 to adhesions and the leading edge of lamellipodia. Sequesters inactive non-tyrosine-phosphorylated paxillin in cytoplasmic complexes.
Rattus norvegicus (taxid: 10116)
>sp|Q9Y2X7|GIT1_HUMAN ARF GTPase-activating protein GIT1 OS=Homo sapiens GN=GIT1 PE=1 SV=2
GTPase-activating protein for the ADP ribosylation factor family. May serve as a scaffold to bring together molecules to form signaling modules controlling vesicle trafficking, adhesion and cytoskeletal organization. Increases the speed of cell migration, as well as the size and rate of formation of protrusions, possibly by targeting PAK1 to adhesions and the leading edge of lamellipodia. Sequesters inactive non-tyrosine-phosphorylated paxillin in cytoplasmic complexes.
Homo sapiens (taxid: 9606)
>sp|Q68FF6|GIT1_MOUSE ARF GTPase-activating protein GIT1 OS=Mus musculus GN=Git1 PE=1 SV=1
GTPase-activating protein for the ADP ribosylation factor family. May serve as a scaffold to bring together molecules to form signaling modules controlling vesicle trafficking, adhesion and cytoskeletal organization. Increases the speed of cell migration, as well as the size and rate of formation of protrusions, possibly by targeting PAK1 to adhesions and the leading edge of lamellipodia. Sequesters inactive non-tyrosine-phosphorylated paxillin in cytoplasmic complexes.
Mus musculus (taxid: 10090)
Close Homologs in the Non-Redundant Database Detected by BLAST
Score = 84.9 bits (210), Expect = 2e-22
Identities = 51/118 (43%), Positives = 78/118 (66%), Gaps = 14/118 (11%)
Query: 20 MPQSEEVVRRTDQVTKRIQELAAHMRSSD--KCHSFVPHAERIRIAVSELSAIFPQNTNN 77
+P +E+V+R+T+Q+TK IQEL +R++ K SFVP +E I AV+E++A+FP+ N+
Sbjct: 8 LPSTEDVIRKTEQITKNIQEL---LRAAQEGKHESFVPCSENILTAVNEMAALFPERPNS 64
Query: 78 DLIRHALRSLNTSTVRLQAEC--AQLEGSA-------ERVRSCAYNMAKANKQLLTQF 126
+ +R++LR L +S RLQ EC A G A ++V CAY++AKA KQL+T
Sbjct: 65 ETVRNSLRLLTSSAERLQNECKKAVPPGIAVDMQLVTQQVIQCAYDIAKAAKQLVTIT 122
This domain family is found in eukaryotes, and is approximately 120 amino acids in length. The family is found in association with pfam01412, pfam00023, pfam08518. GIT1 plays an important role in cell adhesion, motility, cytoskeletal remodeling and membrane trafficking. To perform this function, it localises p21-activated kinase (PAK) and PAK-interactive exchange factor to focal adhesions. Its activation is regulated by interaction between its paxillin-binding C terminal and the LD motifs of paxillin. The C terminal folds into a four helix bundle. Length = 123
VBS: Vinculin Binding Site; InterPro: IPR015009 Vi
82.96
>PF12205 GIT1_C: G protein-coupled receptor kinase-interacting protein 1 C term; InterPro: IPR022018 This domain family is found in eukaryotes, and is approximately 120 amino acids in length
The family is found in association with PF01412 from PFAM, PF00023 from PFAM, PF08518 from PFAM. GIT1 plays an important role in cell adhesion, motility, cytoskeletal remodeling and membrane trafficking. To perform this function, it localises p21-activated kinase (PAK) and PAK-interactive exchange factor to focal adhesions. Its activation is regulated by interaction between its paxillin-binding C-terminal and the LD motifs of paxillin. The C-terminal folds into a four helix bundle. ; PDB: 2JX0_A.
>PF03623 Focal_AT: Focal adhesion targeting region; InterPro: IPR005189 Focal adhesion kinase (FAK) is a tyrosine kinase found in focal adhesions, intracellular signalling complexes that are formed following engagement of the extracellular matrix by integrins
The C-terminal "focal adhesion targeting" (FAT) region is necessary and sufficient for localizing FAK to focal adhesions. The crystal structure of FAT shows it forms a four-helix bundle that resembles those found in two other proteins involved in cell adhesion, alpha-catenin and vinculin []. The binding of FAT to the focal adhesion protein, paxillin, requires the integrity of the helical bundle, whereas binding to another focal adhesion protein, talin, does not.; GO: 0004713 protein tyrosine kinase activity, 0004871 signal transducer activity, 0006468 protein phosphorylation, 0007172 signal complex assembly, 0005925 focal adhesion; PDB: 1K05_C 1OW8_C 1OW7_C 3S9O_C 3B71_B 1K04_A 1OW6_C 3GM1_B 3GM3_A 3GM2_A ....
>PF12026 DUF3513: Domain of unknown function (DUF3513); InterPro: IPR021901 This presumed domain is functionally uncharacterised
This domain is found in eukaryotes. This domain is typically between 192 to 218 amino acids in length. This domain is found associated with PF00018 from PFAM, PF08824 from PFAM. This domain has a conserved QPP sequence motif. ; PDB: 3T6G_D 1X27_N.
>PF08913 VBS: Vinculin Binding Site; InterPro: IPR015009 Vinculin binding sites are predominantly found in talin and talin-like molecules, enabling binding of vinculin to talin, stabilising integrin-mediated cell-matrix junctions
Talin, in turn, links integrins to the actin cytoskeleton. The consensus sequence for Vinculin binding sites is LxxAAxxVAxxVxxLIxxA, with a secondary structure prediction of four amphipathic helices. The hydrophobic residues that define the VBS are themselves 'masked' and are buried in the core of a series of helical bundles that make up the talin rod []. ; PDB: 2L10_A 2KVP_A 2B0H_A 1RKC_B 1XWJ_B.
