Psyllid ID: psy13762

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
MRAYLCFGVSLLAVLVSCGQAATKSKVKYIPINLEDNPPPKKILCYYNHEAYKREGKGKVATEELRPALTTCTHLVYAYAGISNSDYHIKSLDKELDTDKNKGHELYKQVTALKTSYPDLNIILGVGGFEDQKDKEKYLDLVIHTVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGEKYVLVKSAKHHLK
cHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEccccccccccccccccccccccccccEEEEEEEEEEccccEEEEccccccccccccHHHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEEccEEEcccccccccccccccHHHccEEEEEEEEcccccEEEEEccccccccccccccHHHHHHHHHHcccccEEEEEEccccccccccHHHHHHccHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHccc
MRAYLCFGVSLLAVLVSCGqaatkskvkyipinlednpppkkilcyynheaykregkgkvateelrpaltTCTHLVYAyagisnsdyHIKSLDKeldtdknkghELYKQVTALktsypdlniilgvggfedqkdkEKYLDLVIHTVGVKAAYAKQNGLAGVAMVDLSlddfkgncgeKYVLVKSAKHHLK
MRAYLCFGVSLLAVLVSCGQAATKSKVkyipinlednpppkKILCYYNHEAYKREGKGKVATEELRPALTTCTHLVYAYAGISNSDYHIKSLDKELDTDKNKGHELYKQVtalktsypdLNIILGVGGFEDQKDKEKYLDLVIHTVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGEKYVLVKSAKHHLK
MRAYLCFGVSLLAVLVSCGQAATKSKVKYIPINLEDNPPPKKILCYYNHEAYKREGKGKVATEELRPALTTCTHLVYAYAGISNSDYHIKSLDKELDTDKNKGHELYKQVTALKTSYPDLNIILGVGGFEDQKDKEKYLDLVIHTVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGEKYVLVKSAKHHLK
**AYLCFGVSLLAVLVSCGQAATKSKVKYIPINLEDNPPPKKILCYYNHEAYKREGKGKVATEELRPALTTCTHLVYAYAGISNSDYHIKSLDKEL*****KGHELYKQVTALKTSYPDLNIILGVGGFEDQKDKEKYLDLVIHTVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGEKYVLVK*******
**AYLCFGVSLLAVLVSCGQAATK*****************KILCYYNHEAYKREGKGKVATEELRPALTTCTHLVYAYAGISNSDYHIKSLDKELDTDKNKGHELYKQVTALKTSYPDLNIILGVGGFEDQKDKEKYLDLVIHTVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGEKYVLVKSAKHHL*
MRAYLCFGVSLLAVLVSCGQAATKSKVKYIPINLEDNPPPKKILCYYNHEAYKREGKGKVATEELRPALTTCTHLVYAYAGISNSDYHIKSLDKELDTDKNKGHELYKQVTALKTSYPDLNIILGVGGFEDQKDKEKYLDLVIHTVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGEKYVLV********
*RAYLCFGVSLLAVLVSCGQAATKSKVKYIPINLEDNPPPKKILCYYNHEAYKREGKGKVATEELRPALTTCTHLVYAYAGISNSDYHIKSLDKELDTDKNKGHELYKQVTALKTSYPDLNIILGVGGFEDQKDKEKYLDLVIHTVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGEKYVLVKSAKHHLK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRAYLCFGVSLLAVLVSCGQAATKSKVKYIPINLEDNPPPKKILCYYNHEAYKREGKGKVATEELRPALTTCTHLVYAYAGISNSDYHIKSLDKELDTDKNKGHELYKQVTALKTSYPDLNIILGVGGFEDQKDKEKYLDLVIHTVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGEKYVLVKSAKHHLK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query190 2.2.26 [Sep-21-2011]
Q9GV28 433 Chitinase-like protein EN N/A N/A 0.626 0.274 0.372 9e-19
Q23997 452 Chitinase-like protein CG yes N/A 0.689 0.289 0.383 1e-17
Q9W303 442 Chitinase-like protein Id no N/A 0.515 0.221 0.470 3e-17
Q8T0R7 444 Chitinase-like protein Id no N/A 0.621 0.265 0.360 3e-16
Q2PQM7 444 Chitinase-like protein Id N/A N/A 0.515 0.220 0.421 2e-15
Q8MX40 439 Chitinase-like protein Id N/A N/A 0.615 0.266 0.354 3e-14
Q9V3D4 440 Chitinase-like protein Id no N/A 0.742 0.320 0.306 3e-14
Q8MM24 439 Chitinase-like protein Id no N/A 0.626 0.271 0.353 5e-14
Q8MX31 441 Chitinase-like protein Id N/A N/A 0.505 0.217 0.33 6e-14
Q8MX41 439 Chitinase-like protein Id N/A N/A 0.747 0.323 0.325 7e-14
>sp|Q9GV28|IDGFL_BOMMO Chitinase-like protein EN03 OS=Bombyx mori GN=EN03 PE=1 SV=1 Back     alignment and function desciption
 Score = 93.2 bits (230), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 78/129 (60%), Gaps = 10/129 (7%)

Query: 42  KILCYYNHEAYKREGKGKVATEELRPALTTCTHLVYAYAGISNSDYHIKSLDKELDTDKN 101
           K+LCYY+  +Y RE + ++   +L PAL+ CTHL+Y YA I    Y + SL++ LD D+ 
Sbjct: 24  KVLCYYDSRSYVRESQARMLPLDLDPALSFCTHLLYGYAVIQPDTYKLVSLNENLDIDRT 83

Query: 102 KGHELYKQVTALKTSYPDLNIILGVGGFEDQKDKEKYLDLVIHTVGVKAAY-------AK 154
             H+ Y+ +T+LK  YP L ++L VGG  D ++ EKY +L++ +   + A+       A+
Sbjct: 84  --HDNYRAITSLKAKYPGLTVLLSVGGDADTEEPEKY-NLLLESQQARTAFINSGVLLAE 140

Query: 155 QNGLAGVAM 163
           Q G  G+ +
Sbjct: 141 QYGFDGIDL 149

Bombyx mori (taxid: 7091)
>sp|Q23997|C5210_DROME Chitinase-like protein CG5210 OS=Drosophila melanogaster GN=CG5210 PE=1 SV=2 Back     alignment and function description
>sp|Q9W303|IDGF4_DROME Chitinase-like protein Idgf4 OS=Drosophila melanogaster GN=Idgf4 PE=2 SV=1 Back     alignment and function description
>sp|Q8T0R7|IDGF5_DROME Chitinase-like protein Idgf5 OS=Drosophila melanogaster GN=Idgf5 PE=2 SV=3 Back     alignment and function description
>sp|Q2PQM7|IDGF4_GLOMM Chitinase-like protein Idgf4 OS=Glossina morsitans morsitans GN=Idgf4 PE=2 SV=1 Back     alignment and function description
>sp|Q8MX40|IDGF1_DROYA Chitinase-like protein Idgf1 OS=Drosophila yakuba GN=Idgf1 PE=3 SV=1 Back     alignment and function description
>sp|Q9V3D4|IDGF2_DROME Chitinase-like protein Idgf2 OS=Drosophila melanogaster GN=Idgf2 PE=1 SV=1 Back     alignment and function description
>sp|Q8MM24|IDGF1_DROME Chitinase-like protein Idgf1 OS=Drosophila melanogaster GN=Idgf1 PE=1 SV=2 Back     alignment and function description
>sp|Q8MX31|IDGF3_DROYA Chitinase-like protein Idgf3 OS=Drosophila yakuba GN=Idgf3 PE=3 SV=1 Back     alignment and function description
>sp|Q8MX41|IDGF1_DROSI Chitinase-like protein Idgf1 OS=Drosophila simulans GN=Idgf1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query190
357625069 434 hemocyte aggregation inhibitor protein p 0.642 0.281 0.386 6e-20
259493819 434 hemocyte aggregation inhibitor protein p 0.636 0.278 0.366 1e-18
274327724 442 imaginal disk growth factor precursor [A 0.642 0.276 0.424 1e-18
152061158 434 imaginal disk growth factor [Bombyx mori 0.626 0.274 0.379 4e-18
94468662 439 bacteria-responsive protein 1 AgBR1 [Aed 0.647 0.280 0.379 1e-17
157125714 441 imaginal disc growth factor [Aedes aegyp 0.647 0.278 0.379 1e-17
47607477 433 imaginal disc growth factor [Pieris rapa 0.647 0.284 0.353 1e-17
85726208 433 imaginal disc growth factor-like protein 0.647 0.284 0.360 2e-17
117970190 433 pxImaginal disk growth factor [Plutella 0.631 0.277 0.361 2e-17
170033615 449 bacteria responsive protein 1; AgBR1 [Cu 0.573 0.242 0.431 2e-17
>gi|357625069|gb|EHJ75621.1| hemocyte aggregation inhibitor protein precursor [Danaus plexippus] Back     alignment and taxonomy information
 Score =  102 bits (255), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 51/132 (38%), Positives = 83/132 (62%), Gaps = 10/132 (7%)

Query: 39  PPKKILCYYNHEAYKREGKGKVATEELRPALTTCTHLVYAYAGISNSDYHIKSLDKELDT 98
           PP K++CYY+ ++Y RE + ++   +L PAL+ CTHLVY YAGI    Y + SL++ LD 
Sbjct: 21  PPSKVVCYYDSKSYVRESQARMLPLDLDPALSFCTHLVYGYAGIQPDTYKMVSLNENLDI 80

Query: 99  DKNKGHELYKQVTALKTSYPDLNIILGVGGFEDQKDKEKYLDLVIHTVGVKAAY------ 152
           D+N  H  Y+ +T  KT YP L ++L VGG  D ++++KY +L++ +   + A+      
Sbjct: 81  DRN--HANYRALTNFKTKYPGLKVLLSVGGDADTEEEQKY-NLLLESPQARTAFVNSGVL 137

Query: 153 -AKQNGLAGVAM 163
            A+Q+G  G+ +
Sbjct: 138 LAEQHGFDGIDL 149

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|259493819|gb|ACW82749.1| hemocyte aggregation inhibitor protein precursor [Manduca sexta] Back     alignment and taxonomy information
>gi|274327724|ref|NP_001162142.1| imaginal disk growth factor precursor [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|152061158|dbj|BAF73623.1| imaginal disk growth factor [Bombyx mori] Back     alignment and taxonomy information
>gi|94468662|gb|ABF18180.1| bacteria-responsive protein 1 AgBR1 [Aedes aegypti] Back     alignment and taxonomy information
>gi|157125714|ref|XP_001660745.1| imaginal disc growth factor [Aedes aegypti] gi|108882598|gb|EAT46823.1| AAEL001965-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|47607477|gb|AAT36640.1| imaginal disc growth factor [Pieris rapae] Back     alignment and taxonomy information
>gi|85726208|gb|ABC79625.1| imaginal disc growth factor-like protein [Mamestra brassicae] Back     alignment and taxonomy information
>gi|117970190|dbj|BAF36822.1| pxImaginal disk growth factor [Plutella xylostella] Back     alignment and taxonomy information
>gi|170033615|ref|XP_001844672.1| bacteria responsive protein 1; AgBR1 [Culex quinquefasciatus] gi|167874640|gb|EDS38023.1| bacteria responsive protein 1; AgBR1 [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query190
UNIPROTKB|Q9GV28 433 EN03 "Chitinase-like protein E 0.568 0.249 0.396 2.5e-31
FB|FBgn0013763 452 CG5210 [Drosophila melanogaste 0.563 0.236 0.448 4.4e-28
FB|FBgn0026415 442 Idgf4 "Imaginal disc growth fa 0.515 0.221 0.470 4.6e-28
UNIPROTKB|Q8MX40 439 Idgf1 "Chitinase-like protein 0.494 0.214 0.401 1.4e-27
FB|FBgn0020415 440 Idgf2 "Imaginal disc growth fa 0.605 0.261 0.375 6.4e-26
UNIPROTKB|Q8MX41 439 Idgf1 "Chitinase-like protein 0.494 0.214 0.401 1e-25
FB|FBgn0064237 444 Idgf5 "Imaginal disc growth fa 0.510 0.218 0.415 1.8e-25
FB|FBgn0020416 439 Idgf1 "Imaginal disc growth fa 0.494 0.214 0.401 2.1e-25
UNIPROTKB|Q8MX32 441 Idgf3 "Chitinase-like protein 0.505 0.217 0.33 1.1e-21
UNIPROTKB|Q8MX31 441 Idgf3 "Chitinase-like protein 0.505 0.217 0.34 2.6e-21
UNIPROTKB|Q9GV28 EN03 "Chitinase-like protein EN03" [Bombyx mori (taxid:7091)] Back     alignment and assigned GO terms
 Score = 233 (87.1 bits), Expect = 2.5e-31, Sum P(2) = 2.5e-31
 Identities = 44/111 (39%), Positives = 71/111 (63%)

Query:    42 KILCYYNHEAYKREGKGKVATEELRPALTTCTHLVYAYAGISNSDYHIKSLDKELDTDKN 101
             K+LCYY+  +Y RE + ++   +L PAL+ CTHL+Y YA I    Y + SL++ LD D+ 
Sbjct:    24 KVLCYYDSRSYVRESQARMLPLDLDPALSFCTHLLYGYAVIQPDTYKLVSLNENLDIDRT 83

Query:   102 KGHELYKQVTALKTSYPDLNIILGVGGFEDQKDKEKYLDLVIHTVGVKAAY 152
               H+ Y+ +T+LK  YP L ++L VGG  D ++ EKY +L++ +   + A+
Sbjct:    84 --HDNYRAITSLKAKYPGLTVLLSVGGDADTEEPEKY-NLLLESQQARTAF 131
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
FB|FBgn0013763 CG5210 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0026415 Idgf4 "Imaginal disc growth factor 4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MX40 Idgf1 "Chitinase-like protein Idgf1" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
FB|FBgn0020415 Idgf2 "Imaginal disc growth factor 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MX41 Idgf1 "Chitinase-like protein Idgf1" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
FB|FBgn0064237 Idgf5 "Imaginal disc growth factor 5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0020416 Idgf1 "Imaginal disc growth factor 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MX32 Idgf3 "Chitinase-like protein Idgf3" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MX31 Idgf3 "Chitinase-like protein Idgf3" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
cd02873 413 cd02873, GH18_IDGF, The IDGF's (imaginal disc grow 2e-30
cd02872 362 cd02872, GH18_chitolectin_chitotriosidase, This co 8e-19
cd02873413 cd02873, GH18_IDGF, The IDGF's (imaginal disc grow 7e-13
smart00636 334 smart00636, Glyco_18, Glyco_18 domain 1e-09
cd02872362 cd02872, GH18_chitolectin_chitotriosidase, This co 1e-07
cd06548 322 cd06548, GH18_chitinase, The GH18 (glycosyl hydrol 1e-05
pfam00704 325 pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam 2e-05
>gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster Back     alignment and domain information 
 Score =  114 bits (287), Expect = 2e-30
 Identities = 50/103 (48%), Positives = 69/103 (66%), Gaps = 7/103 (6%)

Query: 42  KILCYYNHEAYKREGKGKVATEELRPALTTCTHLVYAYAGISNSDYHIKSLDKELDTDKN 101
           K++CYY+ ++Y REG  K++ E+L PAL  CTHLVY YAGI    Y IKSL+++LD DK+
Sbjct: 1   KLVCYYDSKSYLREGLAKMSLEDLEPALQFCTHLVYGYAGIDADTYKIKSLNEDLDLDKS 60

Query: 102 KGHELYKQVTALKTSYPDLNIILGVGGFEDQKDK---EKYLDL 141
                Y+ +T+LK  YP L ++L VGG  D  ++   EKYL L
Sbjct: 61  ----HYRAITSLKRKYPHLKVLLSVGGDRDTDEEGENEKYLLL 99

The IDGF's have an eight-stranded alpha/beta barrel fold and are related to the glycosyl hydrolase family 18 (GH18) chitinases, but they have an amino acid substitution known to abolish chitinase catalytic activity. IDGFs may have evolved from chitinases to gain new functions as growth factors, interacting with cell surface glycoproteins involved in growth-promoting processes. Length = 413
>gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases Back     alignment and domain information
>gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster Back     alignment and domain information
>gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain Back     alignment and domain information
>gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases Back     alignment and domain information
>gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites Back     alignment and domain information
>gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 190
cd02873 413 GH18_IDGF The IDGF's (imaginal disc growth factors 100.0
COG3325 441 ChiA Chitinase [Carbohydrate transport and metabol 100.0
cd02872 362 GH18_chitolectin_chitotriosidase This conserved do 99.97
cd02879 299 GH18_plant_chitinase_class_V The class V plant chi 99.97
cd06548 322 GH18_chitinase The GH18 (glycosyl hydrolases, fami 99.97
cd02878 345 GH18_zymocin_alpha Zymocin, alpha subunit. Zymocin 99.96
smart00636 334 Glyco_18 Glycosyl hydrolase family 18. 99.94
cd06546 256 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 99.94
KOG2806|consensus 432 99.93
PF00704 343 Glyco_hydro_18: Glycosyl hydrolases family 18; Int 99.92
cd06544 253 GH18_narbonin Narbonin is a plant 2S protein from 99.92
cd00598210 GH18_chitinase-like The GH18 (glycosyl hydrolase, 99.9
cd06545 253 GH18_3CO4_chitinase The Bacteroides thetaiotaomicr 99.88
cd02876 318 GH18_SI-CLP Stabilin-1 interacting chitinase-like 99.88
cd02871 312 GH18_chitinase_D-like GH18 domain of Chitinase D ( 99.87
cd02874 313 GH18_CFLE_spore_hydrolase Cortical fragment-lytic 99.62
cd06542 255 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases 99.61
cd06543 294 GH18_PF-ChiA-like PF-ChiA is an uncharacterized ch 99.5
cd06549 298 GH18_trifunctional GH18 domain of an uncharacteriz 99.47
cd02875 358 GH18_chitobiase Chitobiase (also known as di-N-ace 99.39
cd02877 280 GH18_hevamine_XipI_class_III This conserved domain 99.26
COG3469 332 Chitinase [Carbohydrate transport and metabolism] 99.15
cd02872362 GH18_chitolectin_chitotriosidase This conserved do 97.02
KOG4701|consensus 568 96.79
cd02873413 GH18_IDGF The IDGF's (imaginal disc growth factors 96.68
cd06547 339 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENG 96.17
PF03644 311 Glyco_hydro_85: Glycosyl hydrolase family 85 ; Int 94.81
KOG2091|consensus 392 93.52
TIGR01370 315 cysRS possible cysteinyl-tRNA synthetase, Methanoc 87.56
cd02810 289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 84.73
cd04740 296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 84.2
COG3858 423 Predicted glycosyl hydrolase [General function pre 83.29
PRK07565 334 dihydroorotate dehydrogenase 2; Reviewed 80.27
>cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster Back     alignment and domain information 
Probab=100.00  E-value=3.9e-35  Score=258.38  Aligned_cols=122  Identities=43%  Similarity=0.808  Sum_probs=107.2

Q ss_pred             eEEEEEcCCccccCCCCCCCCccCCCCCCCccEEEEeeeeeeCCCceeeecCccccccccchhhHHHHHHHHHHhCCCce
Q psy13762         42 KILCYYNHEAYKREGKGKVATEELRPALTTCTHLVYAYAGISNSDYHIKSLDKELDTDKNKGHELYKQVTALKTSYPDLN  121 (190)
Q Consensus        42 ~vv~Yy~~w~~~r~g~~~~~~~~i~~~~~~~THiiyaf~~i~~~~~~i~~~d~~~d~~~~~~~~~~~~l~~lk~~np~lK  121 (190)
                      ++||||++|+.||.|.++|+|++||+.+++||||+|||++|+++++++...+++.|.+    .+.+++|..||++||++|
T Consensus         1 ~vvcyy~~~a~~r~~~~~~~~~~i~~~~~~~THl~yaf~~i~~~~~~~~~~~~~~~~~----~~~~~~~~~lk~~~p~lK   76 (413)
T cd02873           1 KLVCYYDSKSYLREGLAKMSLEDLEPALQFCTHLVYGYAGIDADTYKIKSLNEDLDLD----KSHYRAITSLKRKYPHLK   76 (413)
T ss_pred             CEEEEecchhhcCCCCCeeCHHHcCCccccCCeEEEEEEEEeCCCCEEEecCcccchh----hhHHHHHHHHHhhCCCCe
Confidence            5899999999999999999999999974459999999999999878888888777654    577999999999999999


Q ss_pred             EEEEecCCCCCCC---hhHhHHHH---------HHHHHHHHHHHHhcCCCeEEeecCCCCC
Q psy13762        122 IILGVGGFEDQKD---KEKYLDLV---------IHTVGVKAAYAKQNGLAGVAMVDLSLDD  170 (190)
Q Consensus       122 vllSvGGw~~~~~---s~~fs~~~---------i~si~~~~~fl~~~gfDGIDIDWeyp~~  170 (190)
                      +|+|||||+.++.   +..|+.++         ++++   ++|+++|+|||||||||||..
T Consensus        77 vllSiGGw~~~~~~~~s~~fs~~~~~~~~R~~Fi~si---v~~l~~~~fDGidiDWEyP~~  134 (413)
T cd02873          77 VLLSVGGDRDTDEEGENEKYLLLLESSESRNAFINSA---HSLLKTYGFDGLDLAWQFPKN  134 (413)
T ss_pred             EEEeecCCCCCCCcccchhhHHHhCCHHHHHHHHHHH---HHHHHHcCCCCeEeeeeCCCC
Confidence            9999999986432   46788775         7777   999999999999999999963

The IDGF's have an eight-stranded alpha/beta barrel fold and are related to the glycosyl hydrolase family 18 (GH18) chitinases, but they have an amino acid substitution known to abolish chitinase catalytic activity. IDGFs may have evolved from chitinases to gain new functions as growth factors, interacting with cell surface glycoproteins involved in growth-promoting processes.
>COG3325 ChiA Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02872 GH18_chitolectin_chitotriosidase This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases Back     alignment and domain information
>cd02879 GH18_plant_chitinase_class_V The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes Back     alignment and domain information
>cd06548 GH18_chitinase The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites Back     alignment and domain information
>cd02878 GH18_zymocin_alpha Zymocin, alpha subunit Back     alignment and domain information
>smart00636 Glyco_18 Glycosyl hydrolase family 18 Back     alignment and domain information
>cd06546 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii Back     alignment and domain information
>KOG2806|consensus Back     alignment and domain information
>PF00704 Glyco_hydro_18: Glycosyl hydrolases family 18; InterPro: IPR001223 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L Back     alignment and domain information
>cd00598 GH18_chitinase-like The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods Back     alignment and domain information
>cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas Back     alignment and domain information
>cd02876 GH18_SI-CLP Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome Back     alignment and domain information
>cd02871 GH18_chitinase_D-like GH18 domain of Chitinase D (ChiD) Back     alignment and domain information
>cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination Back     alignment and domain information
>cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins Back     alignment and domain information
>cd06543 GH18_PF-ChiA-like PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain Back     alignment and domain information
>cd06549 GH18_trifunctional GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain Back     alignment and domain information
>cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes Back     alignment and domain information
>cd02877 GH18_hevamine_XipI_class_III This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain Back     alignment and domain information
>COG3469 Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02872 GH18_chitolectin_chitotriosidase This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases Back     alignment and domain information
>KOG4701|consensus Back     alignment and domain information
>cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster Back     alignment and domain information
>cd06547 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins Back     alignment and domain information
>PF03644 Glyco_hydro_85: Glycosyl hydrolase family 85 ; InterPro: IPR005201 O-Glycosyl hydrolases 3 Back     alignment and domain information
>KOG2091|consensus Back     alignment and domain information
>TIGR01370 cysRS possible cysteinyl-tRNA synthetase, Methanococcus type Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>COG3858 Predicted glycosyl hydrolase [General function prediction only] Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
1jnd_A 420 Crystal Structure Of Imaginal Disc Growth Factor-2 4e-15
1jnd_A420 Crystal Structure Of Imaginal Disc Growth Factor-2 4e-06
1hki_A 365 Crystal Structure Of Human Chitinase In Complex Wit 2e-10
1hkk_A 364 High Resoultion Crystal Structure Of Human Chitinas 3e-10
1guv_A 366 Structure Of Human Chitotriosidase Length = 366 3e-10
1lg1_A 365 Crystal Structure Of Human Chitotriosidase In Compl 3e-10
1waw_A 445 Specificity And Affinity Of Natural Product Cyclope 3e-10
1tfv_A 361 Crystal Structure Of A Buffalo Signaling Glycoprote 3e-09
1xhg_A 361 Crystal Structure Of A 40 Kda Signalling Protein Fr 3e-09
1owq_A 361 Crystal Structure Of A 40 Kda Signalling Protein (S 4e-09
2esc_A 361 Crystal Structure Of A 40 Kda Protective Signalling 4e-09
4ay1_A 365 Human Ykl-39 Is A Pseudo-Chitinase With Retained Ch 5e-09
1sr0_A 361 Crystal Structure Of Signalling Protein From Sheep( 7e-09
1zbv_A 361 Crystal Structure Of The Goat Signalling Protein (S 7e-09
1syt_A 361 Crystal Structure Of Signalling Protein From Goat S 7e-09
1ljy_A 361 Crystal Structure Of A Novel Regulatory 40 Kda Mamm 7e-09
2pi6_A 361 Crystal Structure Of The Sheep Signalling Glycoprot 9e-09
1hjv_A 362 Crystal Structure Of Hcgp-39 In Complex With Chitin 2e-07
3fxy_A 395 Acidic Mammalian Chinase, Catalytic Domain Length = 3e-07
2ybt_A 381 Crystal Structure Of Human Acidic Chitinase In Comp 3e-07
1e9l_A 377 The Crystal Structure Of Novel Mammalian Lectin Ym1 7e-05
>pdb|1JND|A Chain A, Crystal Structure Of Imaginal Disc Growth Factor-2 Length = 420 Back     alignment and structure 
Iteration: 1

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 74/131 (56%), Gaps = 13/131 (9%)
Query: 43  ILCYYNHEAYKREGKGKVATEELRPALTTCTHLVYAYAGISNSDYHIKSLDKELDTDKNK 102
           ++CYY+  +Y REG GK+   +L  AL  C+HLVY YAG+   +    S+++ LD  K++
Sbjct: 4   LVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGENLQAYSMNENLDIYKHQ 63
Query: 103 GHELYKQVTALKTSYPDLNIILGVGGFE--DQKDKEKYLDLV----IHTVG-VKAAY--A 153
               + +VT+LK  YP L ++L VGG    D     KY+DL+    +  +G +++AY   
Sbjct: 64  ----FSEVTSLKRKYPHLKVLLSVGGDHDIDPDHPNKYIDLLEGEKVRQIGFIRSAYELV 119
Query: 154 KQNGLAGVAMV 164
           K  G  G+ + 
Sbjct: 120 KTYGFDGLDLA 130
>pdb|1JND|A Chain A, Crystal Structure Of Imaginal Disc Growth Factor-2 Length = 420 Back     alignment and structure
>pdb|1HKI|A Chain A, Crystal Structure Of Human Chitinase In Complex With Glucoallosamidin B Length = 365 Back     alignment and structure
>pdb|1HKK|A Chain A, High Resoultion Crystal Structure Of Human Chitinase In Complex With Allosamidin Length = 364 Back     alignment and structure
>pdb|1GUV|A Chain A, Structure Of Human Chitotriosidase Length = 366 Back     alignment and structure
>pdb|1LG1|A Chain A, Crystal Structure Of Human Chitotriosidase In Complex With Chitobiose Length = 365 Back     alignment and structure
>pdb|1WAW|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitor Argadin Against Human Chitinase Length = 445 Back     alignment and structure
>pdb|1TFV|A Chain A, Crystal Structure Of A Buffalo Signaling Glycoprotein (Spb-40) Secreted During Involution Length = 361 Back     alignment and structure
>pdb|1XHG|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein From Porcine (spp-40) At 2.89a Resolution Length = 361 Back     alignment and structure
>pdb|1OWQ|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein (Spc-40) Secreted During Involution Length = 361 Back     alignment and structure
>pdb|2ESC|A Chain A, Crystal Structure Of A 40 Kda Protective Signalling Protein From Bovine (Spc-40) At 2.1 A Resolution Length = 361 Back     alignment and structure
>pdb|4AY1|A Chain A, Human Ykl-39 Is A Pseudo-Chitinase With Retained Chitooligosaccharide Binding Properties Length = 365 Back     alignment and structure
>pdb|1SR0|A Chain A, Crystal Structure Of Signalling Protein From Sheep(Sps-40) At 3.0a Resolution Using Crystal Grown In The Presence Of Polysaccharides Length = 361 Back     alignment and structure
>pdb|1ZBV|A Chain A, Crystal Structure Of The Goat Signalling Protein (Spg-40) Complexed With A Designed Peptide Trp-Pro-Trp At 3.2a Resolution Length = 361 Back     alignment and structure
>pdb|1SYT|A Chain A, Crystal Structure Of Signalling Protein From Goat Spg-40 In The Presense Of N,n',n''-triacetyl-chitotriose At 2.6a Resolution Length = 361 Back     alignment and structure
>pdb|1LJY|A Chain A, Crystal Structure Of A Novel Regulatory 40 Kda Mammary Gland Protein (Mgp-40) Secreted During Involution Length = 361 Back     alignment and structure
>pdb|2PI6|A Chain A, Crystal Structure Of The Sheep Signalling Glycoprotein (Sps-40) Complex With 2-Methyl-2-4-Pentanediol At 1.65a Resolution Reveals Specific Binding Characteristics Of Sps-40 Length = 361 Back     alignment and structure
>pdb|1HJV|A Chain A, Crystal Structure Of Hcgp-39 In Complex With Chitin Tetramer Length = 362 Back     alignment and structure
>pdb|3FXY|A Chain A, Acidic Mammalian Chinase, Catalytic Domain Length = 395 Back     alignment and structure
>pdb|2YBT|A Chain A, Crystal Structure Of Human Acidic Chitinase In Complex With Bisdionin C Length = 381 Back     alignment and structure
>pdb|1E9L|A Chain A, The Crystal Structure Of Novel Mammalian Lectin Ym1 Suggests A Saccharide Binding Site Length = 377 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
1jnd_A 420 Imaginal DISC growth factor-2; IDGF, chitinase, in 2e-24
1jnd_A420 Imaginal DISC growth factor-2; IDGF, chitinase, in 7e-11
4ay1_A 365 Chitinase-3-like protein 2; chilectin, lectin, chi 1e-16
4ay1_A365 Chitinase-3-like protein 2; chilectin, lectin, chi 5e-10
1wb0_A 445 Chitinase 1, chitotriosidase 1; cyclopentapeptide 1e-16
1wb0_A445 Chitinase 1, chitotriosidase 1; cyclopentapeptide 8e-09
2pi6_A 361 Chitinase-3-like protein 1; complex, signaling pro 2e-16
2pi6_A361 Chitinase-3-like protein 1; complex, signaling pro 8e-10
1vf8_A 377 YM1, secretory protein; chitinase, CHI-lectin, str 7e-16
1vf8_A377 YM1, secretory protein; chitinase, CHI-lectin, str 3e-09
3fy1_A 395 Amcase, TSA1902, acidic mammalian chitinase; struc 3e-15
3fy1_A395 Amcase, TSA1902, acidic mammalian chitinase; struc 5e-08
1w9p_A 433 Chitinase; peptide inhibitors, argifin, argadin, g 1e-14
1goi_A 499 Chitinase B; chitin degradation, hydrolase, glycos 5e-13
1goi_A499 Chitinase B; chitin degradation, hydrolase, glycos 2e-04
3qok_A 420 Putative chitinase II; structural genomics, PSI-bi 2e-12
3qok_A420 Putative chitinase II; structural genomics, PSI-bi 3e-04
3g6m_A 406 Chitinase, crchi1; inhibitor, caffeine, glycosidas 2e-11
3alf_A 353 Chitinase, class V; hydrolase; 1.20A {Nicotiana ta 2e-11
3alf_A353 Chitinase, class V; hydrolase; 1.20A {Nicotiana ta 1e-07
1ll7_A 392 Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { 4e-11
1ll7_A392 Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { 3e-04
3oa5_A 574 CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers 3e-10
3oa5_A574 CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers 3e-04
3aqu_A 356 AT4G19810; stress response, TIM barrel, hydrolase, 3e-10
3aqu_A356 AT4G19810; stress response, TIM barrel, hydrolase, 3e-06
1kfw_A 435 Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob 4e-10
3sim_A 275 Protein, family 18 chitinase; family 18 plant chit 6e-10
3fnd_A 312 Chitinase; TIM-barrel, structural genomics, PSI-2, 4e-08
3fnd_A312 Chitinase; TIM-barrel, structural genomics, PSI-2, 7e-06
1edq_A 540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 6e-08
1itx_A 419 Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) 6e-07
1itx_A419 Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) 4e-04
2y8v_A 290 CHIC, class III chitinase, putative; afchic, hydro 3e-06
3arx_A 584 Chitinase A; TIM barrel, inhibitor complex, glycos 9e-06
1nar_A 290 Narbonin; plant SEED protein; 1.80A {Vicia narbone 1e-05
1edt_A 271 Endo-beta-N-acetylglucosaminidase H, endo H; hydro 2e-05
3n12_A 333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 3e-05
3cz8_A319 Putative sporulation-specific glycosylase YDHD; st 2e-04
>1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 Back     alignment and structure
 Score = 97.6 bits (243), Expect = 2e-24
 Identities = 40/103 (38%), Positives = 60/103 (58%), Gaps = 6/103 (5%)

Query: 42  KILCYYNHEAYKREGKGKVATEELRPALTTCTHLVYAYAGISNSDYHIKSLDKELDTDKN 101
            ++CYY+  +Y REG GK+   +L  AL  C+HLVY YAG+   +    S+++ LD  K+
Sbjct: 3   NLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGENLQAYSMNENLDIYKH 62

Query: 102 KGHELYKQVTALKTSYPDLNIILGVGG--FEDQKDKEKYLDLV 142
                + +VT+LK  YP L ++L VGG    D     KY+DL+
Sbjct: 63  ----QFSEVTSLKRKYPHLKVLLSVGGDHDIDPDHPNKYIDLL 101
>1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 Back     alignment and structure
>4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 Back     alignment and structure
>4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 Back     alignment and structure
>1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 Back     alignment and structure
>1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 Back     alignment and structure
>2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 Back     alignment and structure
>2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 Back     alignment and structure
>1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 Back     alignment and structure
>1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 Back     alignment and structure
>3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 Back     alignment and structure
>3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 Back     alignment and structure
>1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 Back     alignment and structure
>1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 Back     alignment and structure
>1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 Back     alignment and structure
>3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 Back     alignment and structure
>3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 Back     alignment and structure
>3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 Back     alignment and structure
>3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 Back     alignment and structure
>3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 Back     alignment and structure
>1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 Back     alignment and structure
>1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 Back     alignment and structure
>3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 Back     alignment and structure
>3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 Back     alignment and structure
>3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 Back     alignment and structure
>3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 Back     alignment and structure
>1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Length = 435 Back     alignment and structure
>3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Length = 275 Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 Back     alignment and structure
>1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 Back     alignment and structure
>1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 Back     alignment and structure
>2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Length = 290 Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 Back     alignment and structure
>1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Length = 290 Back     alignment and structure
>1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Length = 271 Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Length = 333 Back     alignment and structure
>3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query190
4ay1_A 365 Chitinase-3-like protein 2; chilectin, lectin, chi 100.0
3fy1_A 395 Amcase, TSA1902, acidic mammalian chitinase; struc 100.0
1wb0_A 445 Chitinase 1, chitotriosidase 1; cyclopentapeptide 100.0
1itx_A 419 Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) 100.0
3g6m_A 406 Chitinase, crchi1; inhibitor, caffeine, glycosidas 100.0
1jnd_A 420 Imaginal DISC growth factor-2; IDGF, chitinase, in 100.0
1vf8_A 377 YM1, secretory protein; chitinase, CHI-lectin, str 99.98
2pi6_A 361 Chitinase-3-like protein 1; complex, signaling pro 99.97
1w9p_A 433 Chitinase; peptide inhibitors, argifin, argadin, g 99.97
3qok_A 420 Putative chitinase II; structural genomics, PSI-bi 99.97
1ll7_A 392 Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { 99.97
1kfw_A 435 Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob 99.97
1edq_A 540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 99.97
3oa5_A 574 CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers 99.97
3arx_A 584 Chitinase A; TIM barrel, inhibitor complex, glycos 99.97
1goi_A 499 Chitinase B; chitin degradation, hydrolase, glycos 99.96
3aqu_A 356 AT4G19810; stress response, TIM barrel, hydrolase, 99.96
3alf_A 353 Chitinase, class V; hydrolase; 1.20A {Nicotiana ta 99.95
2y8v_A 290 CHIC, class III chitinase, putative; afchic, hydro 99.95
3ian_A 321 Chitinase; structural genomics, hydrolase, glycosi 99.94
3n12_A 333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 99.94
1nar_A 290 Narbonin; plant SEED protein; 1.80A {Vicia narbone 99.94
1edt_A 271 Endo-beta-N-acetylglucosaminidase H, endo H; hydro 99.93
3ebv_A 302 Chinitase A; chitinase A, CHIA, glycosidase, struc 99.93
4ac1_X 283 Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, g 99.93
3fnd_A 312 Chitinase; TIM-barrel, structural genomics, PSI-2, 99.93
3sim_A 275 Protein, family 18 chitinase; family 18 plant chit 99.93
3bxw_B 393 Chitinase domain-containing protein 1; TIM barrel, 99.92
2ebn_A 289 Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl 99.91
4axn_A 328 Chitinase C1; hydrolase; 1.68A {Serratia marcescen 99.91
3cz8_A 319 Putative sporulation-specific glycosylase YDHD; st 99.86
2uy2_A 294 Endochitinase; carbohydrate metabolism, polysaccha 99.82
1eok_A 290 Endo-beta-N-acetylglucosaminidase F3; alpha/beta-b 99.8
2gsj_A 271 Protein PPL-2; mimosoideae, chimerolectin, endochi 99.78
2hvm_A 273 Hevamine; hydrolase, chitinase/lysozyme; 1.80A {He 99.75
1cnv_A 299 Concanavalin B; plant chitinase, chitin binding pr 99.72
3poh_A 451 Endo-beta-N-acetylglucosaminidase F1; TIM barrel, 99.72
1ta3_A 274 XIP-1, xylanase inhibitor protein I; beta alpha ba 99.64
2xtk_A 310 CHIA1, class III chitinase CHIA1; hydrolase, GH18; 99.58
2dsk_A 311 Chitinase; catalytic domain, active domain, crysta 99.32
3mu7_A 273 XAIP-II, xylanase and alpha-amylase inhibitor prot 99.28
1jnd_A420 Imaginal DISC growth factor-2; IDGF, chitinase, in 96.95
3fy1_A395 Amcase, TSA1902, acidic mammalian chitinase; struc 96.8
2pi6_A361 Chitinase-3-like protein 1; complex, signaling pro 96.5
4ay1_A365 Chitinase-3-like protein 2; chilectin, lectin, chi 96.5
1vf8_A377 YM1, secretory protein; chitinase, CHI-lectin, str 96.14
1wb0_A445 Chitinase 1, chitotriosidase 1; cyclopentapeptide 96.0
2vtf_A 626 Endo-beta-N-acetylglucosaminidase; hydrolase, fami 92.34
4ac1_X283 Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, g 90.79
3g6m_A406 Chitinase, crchi1; inhibitor, caffeine, glycosidas 90.78
1itx_A419 Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) 90.62
1ll7_A392 Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { 89.14
2w91_A 653 Endo-beta-N-acetylglucosaminidase D; hydrolase, N- 88.68
1kfw_A435 Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob 87.17
1w9p_A433 Chitinase; peptide inhibitors, argifin, argadin, g 87.02
3qok_A420 Putative chitinase II; structural genomics, PSI-bi 86.38
>4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=7.7e-36  Score=257.19  Aligned_cols=132  Identities=25%  Similarity=0.524  Sum_probs=109.0

Q ss_pred             CCeEEEEEcCCccccCCCCCCCCccCCCCCCCccEEEEeeeeeeCCCceeeecCccccccccchhhHHHHHHHHHHhCCC
Q psy13762         40 PKKILCYYNHEAYKREGKGKVATEELRPALTTCTHLVYAYAGISNSDYHIKSLDKELDTDKNKGHELYKQVTALKTSYPD  119 (190)
Q Consensus        40 ~~~vv~Yy~~w~~~r~g~~~~~~~~i~~~~~~~THiiyaf~~i~~~~~~i~~~d~~~d~~~~~~~~~~~~l~~lk~~np~  119 (190)
                      .+|+||||++|+.||++.++|.|++||++  +||||+|||+.|+++  .+...++. +      ...++++.+||++||+
T Consensus         1 a~rvV~Yy~~W~~~r~~~~~~~~~~i~~~--~~THi~yaFa~i~~~--~~~~~~~~-~------~~~~~~~~~lK~~~p~   69 (365)
T 4ay1_A            1 AYKLVCYFTNWSQDRQEPGKFTPENIDPF--LCSHLIYSFASIENN--KVIIKDKS-E------VMLYQTINSLKTKNPK   69 (365)
T ss_dssp             CCEEEEEEESGGGGSCTTSCCCGGGCCTT--TCSEEEEEEEEEETT--EEECCCTT-H------HHHHHHHHHHHHHCTT
T ss_pred             CeEEEEEECCccccCCCCCCCChhHCCcc--cCCEEEEEeEEecCC--eeEECCcc-H------HHHHHHHHHHHHHCCC
Confidence            37999999999999999999999999998  899999999999986  33333432 1      4678999999999999


Q ss_pred             ceEEEEecCCCCCCChhHhHHH---------HHHHHHHHHHHHHhcCCCeEEeecCCCCCCCCCCCCcchHHHHHHhhc
Q psy13762        120 LNIILGVGGFEDQKDKEKYLDL---------VIHTVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGEKYVLVKSAKHHL  189 (190)
Q Consensus       120 lKvllSvGGw~~~~~s~~fs~~---------~i~si~~~~~fl~~~gfDGIDIDWeyp~~~~g~~~~~~~ll~~ir~~l  189 (190)
                      +|+|||||||+.+  +..|+++         |++|+   ++|+++|||||||||||||..-  ...++..||+++|++|
T Consensus        70 lKvllSiGGw~~~--s~~Fs~~~~~~~~R~~Fi~si---v~~~~~~~fDGiDiDWEyP~~~--d~~~~~~ll~elr~~~  141 (365)
T 4ay1_A           70 LKILLSIGGYLFG--SKGFHPMVDSSTSRLEFINSI---ILFLRNHNFDGLDVSWIYPDQK--ENTHFTVLIHELAEAF  141 (365)
T ss_dssp             CEEEEEEEETTTT--TGGGTTGGGSHHHHHHHHHHH---HHHHHHTTCCEEEEEESCCHHH--HHHHHHHHHHHHHHHH
T ss_pred             CEEEEEEeCCCCC--CchHHHHHcCHHHHHHHHHHH---HHHHHhcCCceEEEeeecCCcc--cccccHHHHHHHHHHH
Confidence            9999999999874  4566654         48888   9999999999999999998531  1223457899999875
>3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Back     alignment and structure
>1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Back     alignment and structure
>1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Back     alignment and structure
>1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Back     alignment and structure
>1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Back     alignment and structure
>2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Back     alignment and structure
>1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Back     alignment and structure
>3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Back     alignment and structure
>1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Back     alignment and structure
>3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Back     alignment and structure
>3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Back     alignment and structure
>3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Back     alignment and structure
>2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Back     alignment and structure
>3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Back     alignment and structure
>1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Back     alignment and structure
>1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Back     alignment and structure
>3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Back     alignment and structure
>4ac1_X Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, glycoside hydrolase family 18, deglycosylation; HET: NAG; 1.30A {Hypocrea jecorina} Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Back     alignment and structure
>3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Back     alignment and structure
>3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Back     alignment and structure
>4axn_A Chitinase C1; hydrolase; 1.68A {Serratia marcescens} Back     alignment and structure
>3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Back     alignment and structure
>2uy2_A Endochitinase; carbohydrate metabolism, polysaccharide degradation, glycopr chitin-binding, chitin degradation, CAZY, hydrolase; 1.60A {Saccharomyces cerevisiae} PDB: 2uy3_A* 2uy4_A* 2uy5_A* Back     alignment and structure
>1eok_A Endo-beta-N-acetylglucosaminidase F3; alpha/beta-barrel, hydrolase; 1.80A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 PDB: 1eom_A* Back     alignment and structure
>2gsj_A Protein PPL-2; mimosoideae, chimerolectin, endochitinase, glycosyl hydrolase family 18, equilibrium sedimentation, X-RAY; 1.73A {Parkia platycephala} Back     alignment and structure
>2hvm_A Hevamine; hydrolase, chitinase/lysozyme; 1.80A {Hevea brasiliensis} SCOP: c.1.8.5 PDB: 1hvq_A* 1llo_A 1kr0_A* 1kr1_A* 1kqy_A* 1kqz_A* Back     alignment and structure
>1cnv_A Concanavalin B; plant chitinase, chitin binding protein, SEED protein; 1.65A {Canavalia ensiformis} SCOP: c.1.8.5 Back     alignment and structure
>3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ta3_A XIP-1, xylanase inhibitor protein I; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Triticum aestivum} SCOP: c.1.8.5 PDB: 1om0_A* 1te1_A* Back     alignment and structure
>2xtk_A CHIA1, class III chitinase CHIA1; hydrolase, GH18; HET: AZM; 2.00A {Aspergillus fumigatus} PDB: 2xuc_A 2xvp_A 2xvn_A* Back     alignment and structure
>2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A Back     alignment and structure
>3mu7_A XAIP-II, xylanase and alpha-amylase inhibitor protein; TIM barell, amylase/xylanase inhibitory protein, hydrolase I; 1.29A {Scadoxus multiflorus} SCOP: c.1.8.0 PDB: 3o9n_A 3oih_A* 3hu7_A 3m7s_A* 3d5h_A* Back     alignment and structure
>1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Back     alignment and structure
>3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Back     alignment and structure
>2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Back     alignment and structure
>4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Back     alignment and structure
>1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Back     alignment and structure
>2vtf_A Endo-beta-N-acetylglucosaminidase; hydrolase, family 85, glycosidase, carbohydrat binding; HET: B3P PGE; 1.79A {Arthrobacter protophormiae} PDB: 3fhq_A* 3fha_A* Back     alignment and structure
>4ac1_X Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, glycoside hydrolase family 18, deglycosylation; HET: NAG; 1.30A {Hypocrea jecorina} Back     alignment and structure
>3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Back     alignment and structure
>1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Back     alignment and structure
>2w91_A Endo-beta-N-acetylglucosaminidase D; hydrolase, N-glycan, secreted, oxazoline, NAG-thiazoline, substrate-participation; 1.40A {Streptococcus pneumoniae} PDB: 2w92_A* Back     alignment and structure
>1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Back     alignment and structure
>3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 190
d1jnda1 327 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f 1e-21
d1jnda1327 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f 6e-12
d2pi6a1 292 c.1.8.5 (A:1-239,A:308-361) Signal processing prot 2e-14
d2pi6a1292 c.1.8.5 (A:1-239,A:308-361) Signal processing prot 4e-10
d1wb0a1 297 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma 9e-13
d1wb0a1297 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma 8e-09
d1goia2 356 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic 4e-12
d1goia2356 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic 2e-05
d1vf8a1 302 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin 8e-12
d1vf8a1302 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin 6e-08
d1w9pa1 333 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil 2e-09
d1ll7a1 330 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus ( 2e-09
d1kfwa1 374 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina 4e-08
d1itxa1 347 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu 9e-07
d1itxa1347 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu 5e-04
d1edqa2 358 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt 2e-06
d1nara_ 289 c.1.8.5 (A:) Seed storage protein {Vicia narbonens 1e-05
d2ebna_ 285 c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl 1e-04
d1edta_ 265 c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {St 0.001
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Imaginal disc growth factor-2
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

 Score = 87.9 bits (217), Expect = 1e-21
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 4/90 (4%)

Query: 42  KILCYYNHEAYKREGKGKVATEELRPALTTCTHLVYAYAGISNSDYHIKSLDKELDTDKN 101
            ++CYY+  +Y REG GK+   +L  AL  C+HLVY YAG+   +    S+++ LD  K+
Sbjct: 2   NLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGENLQAYSMNENLDIYKH 61

Query: 102 KGHELYKQVTALKTSYPDLNIILGVGGFED 131
                + +VT+LK  YP L ++L VGG  D
Sbjct: 62  ----QFSEVTSLKRKYPHLKVLLSVGGDHD 87
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 Back     information, alignment and structure
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 Back     information, alignment and structure
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 Back     information, alignment and structure
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 Back     information, alignment and structure
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 Back     information, alignment and structure
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 Back     information, alignment and structure
>d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 Back     information, alignment and structure
>d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Length = 330 Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 Back     information, alignment and structure
>d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Length = 289 Back     information, alignment and structure
>d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Length = 285 Back     information, alignment and structure
>d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Length = 265 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query190
d1w9pa1 333 Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} 100.0
d1jnda1 327 Imaginal disc growth factor-2 {Fruit fly (Drosophi 100.0
d1itxa1 347 Chitinase A1 {Bacillus circulans [TaxId: 1397]} 100.0
d1vf8a1 302 Chitinase-like lectin ym1, saccharide binding doma 100.0
d1ll7a1 330 Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 100.0
d1wb0a1 297 Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 100.0
d1edqa2 358 Chitinase A, catalytic domain {Serratia marcescens 100.0
d2pi6a1 292 Signal processing protein (SPC-40, MGP-40) {Sheep 100.0
d1kfwa1 374 Psychrophilic chitinase B {Arthrobacter sp., tad20 100.0
d1goia2 356 Chitinase B, catalytic domain {Serratia marcescens 99.96
d1edta_ 265 Endo-beta-N-acetylglucosaminidase {Streptomyces pl 99.92
d2ebna_ 285 Endo-beta-N-acetylglucosaminidase {Flavobacterium 99.89
d1nara_ 289 Seed storage protein {Vicia narbonensis, Narbonin 99.86
d2hvma_ 273 Hevamine A (chitinase/lysozyme) {Para rubber tree 99.71
d1ta3a_ 274 Xylanase inhibitor protein I, XIP-I {Wheat (Tritic 99.66
d1eoka_ 282 Endo-beta-N-acetylglucosaminidase {Flavobacterium 99.54
d1cnva_ 283 Seed storage protein {Jack bean (Canavalia ensifor 99.51
d1jnda1327 Imaginal disc growth factor-2 {Fruit fly (Drosophi 97.92
d2pi6a1292 Signal processing protein (SPC-40, MGP-40) {Sheep 97.69
d1wb0a1297 Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 97.54
d1vf8a1302 Chitinase-like lectin ym1, saccharide binding doma 97.36
d1itxa1347 Chitinase A1 {Bacillus circulans [TaxId: 1397]} 92.07
d1goia2356 Chitinase B, catalytic domain {Serratia marcescens 89.07
d1kfwa1374 Psychrophilic chitinase B {Arthrobacter sp., tad20 88.04
>d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Chitinase 1
species: Aspergillus fumigatus [TaxId: 5085]

Probab=100.00  E-value=6.9e-37  Score=259.37  Aligned_cols=140  Identities=18%  Similarity=0.253  Sum_probs=118.4

Q ss_pred             CCCCeEEEEEcCCccccCCCCCCCCccCCCCCCCccEEEEeeeeeeCCCceeeecCcccccccc-----------chhhH
Q psy13762         38 PPPKKILCYYNHEAYKREGKGKVATEELRPALTTCTHLVYAYAGISNSDYHIKSLDKELDTDKN-----------KGHEL  106 (190)
Q Consensus        38 ~~~~~vv~Yy~~w~~~r~g~~~~~~~~i~~~~~~~THiiyaf~~i~~~~~~i~~~d~~~d~~~~-----------~~~~~  106 (190)
                      ++++||||||++|+.|++   +|+|++||++  +||||+|||+.|+++++++...|++.|.+..           ...+.
T Consensus         2 ~~g~kvv~Yy~~W~~y~~---~~~~~~i~~~--~~THI~yaFa~i~~~~g~~~~~d~~~d~~~~~~~~~~~~~~~~~~~~   76 (333)
T d1w9pa1           2 SSGYRSVVYFVNWAIYGR---NHNPQDLPVE--RLTHVLYAFANVRPETGEVYMTDSWADIEKHYPGDSWSDTGNNVYGC   76 (333)
T ss_dssp             BCCBEEEEEEEGGGGSTT---CCCGGGSCGG--GCSEEEEEEEEECTTTCCEEESCHHHHHTCCCTTCCSSCCSSCCCHH
T ss_pred             CCCCEEEEEECcccccCC---CCChhHCCcc--cCCeEEEeeEEecCCCCeEEecChHHhhccccCCccccccccchhhH
Confidence            467899999999999874   4789999998  8999999999999988999999988876531           11367


Q ss_pred             HHHHHHHHHhCCCceEEEEecCCCCCCChhHhHHHH---------HHHHHHHHHHHHhcCCCeEEeecCCCCCCCCCCCC
Q psy13762        107 YKQVTALKTSYPDLNIILGVGGFEDQKDKEKYLDLV---------IHTVGVKAAYAKQNGLAGVAMVDLSLDDFKGNCGE  177 (190)
Q Consensus       107 ~~~l~~lk~~np~lKvllSvGGw~~~~~s~~fs~~~---------i~si~~~~~fl~~~gfDGIDIDWeyp~~~~g~~~~  177 (190)
                      ++++..||++||++|||||||||+.   +..|+.++         ++++   ++|+++|+|||||||||||... ....+
T Consensus        77 ~~~~~~lk~~~p~lKvllSiGGw~~---s~~f~~~~~~~~~R~~Fi~si---v~~l~~y~fDGiDiDWE~p~~~-~~~~~  149 (333)
T d1w9pa1          77 IKQLYLLKKQNRNLKVLLSIGGWTY---SPNFAPAASTDAGRKNFAKTA---VKLLQDLGFDGLDIDWEYPEND-QQAND  149 (333)
T ss_dssp             HHHHHHHHHHCTTCEEEEEEECTTT---GGGHHHHHTSHHHHHHHHHHH---HHHHHHHTCSEEEEECSCCCSH-HHHHH
T ss_pred             HHHHHHHHhccCCceEEEEEeCCcC---CCcccccccCHHHHHHHHHHH---HHHHHHhcCCceeeeeeecccc-cccch
Confidence            8999999999999999999999998   67888775         7788   9999999999999999998642 11223


Q ss_pred             cchHHHHHHhhc
Q psy13762        178 KYVLVKSAKHHL  189 (190)
Q Consensus       178 ~~~ll~~ir~~l  189 (190)
                      ...+|++||++|
T Consensus       150 ~~~llkelr~~L  161 (333)
T d1w9pa1         150 FVLLLKEVRTAL  161 (333)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHH
Confidence            457899999987
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Back     information, alignment and structure
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Back     information, alignment and structure
>d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Back     information, alignment and structure
>d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Back     information, alignment and structure
>d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Back     information, alignment and structure
>d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} Back     information, alignment and structure
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Back     information, alignment and structure