Psyllid ID: psy13875
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 105 | ||||||
| 242018701 | 226 | Peroxiredoxin-1, putative [Pediculus hum | 0.819 | 0.380 | 0.724 | 5e-29 | |
| 193627312 | 239 | PREDICTED: thioredoxin-dependent peroxid | 0.790 | 0.347 | 0.734 | 6e-28 | |
| 321452529 | 230 | hypothetical protein DAPPUDRAFT_305931 [ | 0.819 | 0.373 | 0.689 | 3e-27 | |
| 345324856 | 222 | PREDICTED: peroxiredoxin-2-like [Ornitho | 0.885 | 0.418 | 0.625 | 2e-26 | |
| 384497087 | 154 | peroxiredoxin-1 [Rhizopus delemar RA 99- | 0.819 | 0.558 | 0.701 | 2e-26 | |
| 170048401 | 232 | peroxiredoxin-2 [Culex quinquefasciatus] | 0.819 | 0.370 | 0.666 | 2e-26 | |
| 384485578 | 154 | peroxiredoxin-1 [Rhizopus delemar RA 99- | 0.819 | 0.558 | 0.689 | 2e-26 | |
| 67083703 | 233 | mitochondrial truncated thioredoxin-depe | 0.790 | 0.356 | 0.710 | 3e-26 | |
| 67083335 | 233 | thioredoxin-dependent peroxide reductase | 0.790 | 0.356 | 0.710 | 3e-26 | |
| 442749885 | 233 | Putative alkyl hydroperoxide reductase t | 0.790 | 0.356 | 0.710 | 3e-26 |
| >gi|242018701|ref|XP_002429812.1| Peroxiredoxin-1, putative [Pediculus humanus corporis] gi|212514830|gb|EEB17074.1| Peroxiredoxin-1, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 131 bits (330), Expect = 5e-29, Method: Compositional matrix adjust.
Identities = 63/87 (72%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
Query: 10 VWLEDVKQGDGGLGDLKYPLLADFKKEIATSYGVLIESAGIPLRGLFIIDTKGVLRQITV 69
W ++V + DGG+G +KYPLL+DF K IA SYGVLIES+GI LRGLFIID KG++R +V
Sbjct: 111 AW-QNVSKKDGGIGSIKYPLLSDFTKTIAKSYGVLIESSGIALRGLFIIDDKGIIRHTSV 169
Query: 70 NDLPVGRSVEEVLRLVKAFQFVDKHGE 96
NDLPVGRSV+EVLRLVKAFQF DKHGE
Sbjct: 170 NDLPVGRSVDEVLRLVKAFQFNDKHGE 196
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|193627312|ref|XP_001948034.1| PREDICTED: thioredoxin-dependent peroxide reductase, mitochondrial-like isoform 2 [Acyrthosiphon pisum] gi|328698588|ref|XP_003240676.1| PREDICTED: thioredoxin-dependent peroxide reductase, mitochondrial-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|321452529|gb|EFX63892.1| hypothetical protein DAPPUDRAFT_305931 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|345324856|ref|XP_001510098.2| PREDICTED: peroxiredoxin-2-like [Ornithorhynchus anatinus] | Back alignment and taxonomy information |
|---|
| >gi|384497087|gb|EIE87578.1| peroxiredoxin-1 [Rhizopus delemar RA 99-880] | Back alignment and taxonomy information |
|---|
| >gi|170048401|ref|XP_001852614.1| peroxiredoxin-2 [Culex quinquefasciatus] gi|167870535|gb|EDS33918.1| peroxiredoxin-2 [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|384485578|gb|EIE77758.1| peroxiredoxin-1 [Rhizopus delemar RA 99-880] | Back alignment and taxonomy information |
|---|
| >gi|67083703|gb|AAY66786.1| mitochondrial truncated thioredoxin-dependent peroxide reductase precursor, partial [Ixodes scapularis] | Back alignment and taxonomy information |
|---|
| >gi|67083335|gb|AAY66603.1| thioredoxin-dependent peroxide reductase [Ixodes scapularis] | Back alignment and taxonomy information |
|---|
| >gi|442749885|gb|JAA67102.1| Putative alkyl hydroperoxide reductase thiol specific antioxidant [Ixodes ricinus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 105 | ||||||
| UNIPROTKB|G1K326 | 201 | PRDX1 "Peroxiredoxin-1" [Gallu | 0.809 | 0.422 | 0.662 | 1.8e-25 | |
| UNIPROTKB|P0CB50 | 199 | PRDX1 "Peroxiredoxin-1" [Gallu | 0.809 | 0.427 | 0.662 | 1.8e-25 | |
| UNIPROTKB|F1S3U9 | 197 | PRDX1 "Uncharacterized protein | 0.876 | 0.467 | 0.612 | 4.6e-25 | |
| TIGR_CMR|GSU_3246 | 201 | GSU_3246 "thioredoxin peroxida | 0.742 | 0.388 | 0.653 | 4.6e-25 | |
| FB|FBgn0038519 | 234 | Prx3 "Peroxiredoxin 3" [Drosop | 0.809 | 0.363 | 0.616 | 9.7e-25 | |
| UNIPROTKB|F1SDX9 | 198 | PRDX2 "Peroxiredoxin-2" [Sus s | 0.809 | 0.429 | 0.651 | 9.7e-25 | |
| UNIPROTKB|Q9NL98 | 195 | Q9NL98 "Peroxiredoxin" [Ascari | 0.809 | 0.435 | 0.639 | 1.2e-24 | |
| RGD|620039 | 199 | Prdx1 "peroxiredoxin 1" [Rattu | 0.809 | 0.427 | 0.639 | 1.2e-24 | |
| MGI|MGI:99523 | 199 | Prdx1 "peroxiredoxin 1" [Mus m | 0.809 | 0.427 | 0.627 | 1.6e-24 | |
| CGD|CAL0005458 | 196 | TSA1 [Candida albicans (taxid: | 0.866 | 0.464 | 0.569 | 2e-24 |
| UNIPROTKB|G1K326 PRDX1 "Peroxiredoxin-1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 289 (106.8 bits), Expect = 1.8e-25, P = 1.8e-25
Identities = 57/86 (66%), Positives = 67/86 (77%)
Query: 11 WLEDVKQGDGGLGDLKYPLLADFKKEIATSYGVLIESAGIPLRGLFIIDTKGVLRQITVN 70
W+ K+ GGLG +K PL++D K+ IA YGVL E GI RGLFIID KG+LRQIT+N
Sbjct: 89 WINTPKK-QGGLGTMKIPLVSDTKRVIAKDYGVLKEDEGIAYRGLFIIDEKGILRQITIN 147
Query: 71 DLPVGRSVEEVLRLVKAFQFVDKHGE 96
DLPVGRSV+E LRLV+AFQF DKHGE
Sbjct: 148 DLPVGRSVDETLRLVQAFQFTDKHGE 173
|
|
| UNIPROTKB|P0CB50 PRDX1 "Peroxiredoxin-1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S3U9 PRDX1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_3246 GSU_3246 "thioredoxin peroxidase" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0038519 Prx3 "Peroxiredoxin 3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SDX9 PRDX2 "Peroxiredoxin-2" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NL98 Q9NL98 "Peroxiredoxin" [Ascaris suum (taxid:6253)] | Back alignment and assigned GO terms |
|---|
| RGD|620039 Prdx1 "peroxiredoxin 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:99523 Prdx1 "peroxiredoxin 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0005458 TSA1 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 105 | |||
| cd03015 | 173 | cd03015, PRX_Typ2cys, Peroxiredoxin (PRX) family, | 2e-44 | |
| PTZ00253 | 199 | PTZ00253, PTZ00253, tryparedoxin peroxidase; Provi | 1e-37 | |
| COG0450 | 194 | COG0450, AhpC, Peroxiredoxin [Posttranslational mo | 3e-33 | |
| PRK15000 | 200 | PRK15000, PRK15000, peroxidase; Provisional | 6e-24 | |
| cd03016 | 203 | cd03016, PRX_1cys, Peroxiredoxin (PRX) family, 1-c | 2e-18 | |
| TIGR03137 | 187 | TIGR03137, AhpC, peroxiredoxin | 5e-18 | |
| cd02971 | 140 | cd02971, PRX_family, Peroxiredoxin (PRX) family; c | 1e-17 | |
| PTZ00137 | 261 | PTZ00137, PTZ00137, 2-Cys peroxiredoxin; Provision | 2e-17 | |
| PRK13189 | 222 | PRK13189, PRK13189, peroxiredoxin; Provisional | 1e-15 | |
| PRK13190 | 202 | PRK13190, PRK13190, putative peroxiredoxin; Provis | 2e-14 | |
| PRK13191 | 215 | PRK13191, PRK13191, putative peroxiredoxin; Provis | 4e-13 | |
| pfam00578 | 124 | pfam00578, AhpC-TSA, AhpC/TSA family | 6e-12 | |
| PRK13599 | 215 | PRK13599, PRK13599, putative peroxiredoxin; Provis | 6e-10 | |
| cd03018 | 149 | cd03018, PRX_AhpE_like, Peroxiredoxin (PRX) family | 9e-10 | |
| PRK10382 | 187 | PRK10382, PRK10382, alkyl hydroperoxide reductase | 3e-09 | |
| COG1225 | 157 | COG1225, Bcp, Peroxiredoxin [Posttranslational mod | 2e-08 | |
| cd03017 | 140 | cd03017, PRX_BCP, Peroxiredoxin (PRX) family, Bact | 4e-06 | |
| pfam08534 | 142 | pfam08534, Redoxin, Redoxin | 5e-04 |
| >gnl|CDD|239313 cd03015, PRX_Typ2cys, Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides | Back alignment and domain information |
|---|
Score = 141 bits (357), Expect = 2e-44
Identities = 49/78 (62%), Positives = 63/78 (80%)
Query: 19 DGGLGDLKYPLLADFKKEIATSYGVLIESAGIPLRGLFIIDTKGVLRQITVNDLPVGRSV 78
+GGLG + +PLLAD KK+I+ YGVL E G+ LRG FIID +G++R ITVNDLPVGRSV
Sbjct: 87 EGGLGKINFPLLADPKKKISRDYGVLDEEEGVALRGTFIIDPEGIIRHITVNDLPVGRSV 146
Query: 79 EEVLRLVKAFQFVDKHGE 96
+E LR++ A QFV++HGE
Sbjct: 147 DETLRVLDALQFVEEHGE 164
|
The functional unit of typical 2-cys PRX is a homodimer. A unique intermolecular redox-active disulfide center is utilized for its activity. Upon reaction with peroxides, its peroxidatic cysteine is oxidized into a sulfenic acid intermediate which is resolved by bonding with the resolving cysteine from the other subunit of the homodimer. This intermolecular disulfide bond is then reduced by thioredoxin, tryparedoxin or AhpF. Typical 2-cys PRXs, like 1-cys PRXs, form decamers which are stabilized by reduction of the active site cysteine. Typical 2-cys PRX interacts through beta strands at one edge of the monomer (B-type interface) to form the functional homodimer, and uses an A-type interface (similar to the dimeric interface in atypical 2-cys PRX and PRX5) at the opposite end of the monomer to form the stable decameric (pentamer of dimers) structure. Length = 173 |
| >gnl|CDD|140280 PTZ00253, PTZ00253, tryparedoxin peroxidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223527 COG0450, AhpC, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|184962 PRK15000, PRK15000, peroxidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239314 cd03016, PRX_1cys, Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine | Back alignment and domain information |
|---|
| >gnl|CDD|211789 TIGR03137, AhpC, peroxiredoxin | Back alignment and domain information |
|---|
| >gnl|CDD|239269 cd02971, PRX_family, Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified | Back alignment and domain information |
|---|
| >gnl|CDD|173427 PTZ00137, PTZ00137, 2-Cys peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237297 PRK13189, PRK13189, peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|106159 PRK13190, PRK13190, putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183885 PRK13191, PRK13191, putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216002 pfam00578, AhpC-TSA, AhpC/TSA family | Back alignment and domain information |
|---|
| >gnl|CDD|106544 PRK13599, PRK13599, putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239316 cd03018, PRX_AhpE_like, Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE | Back alignment and domain information |
|---|
| >gnl|CDD|182423 PRK10382, PRK10382, alkyl hydroperoxide reductase subunit C; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224146 COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|239315 cd03017, PRX_BCP, Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides | Back alignment and domain information |
|---|
| >gnl|CDD|219888 pfam08534, Redoxin, Redoxin | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 105 | |||
| COG0450 | 194 | AhpC Peroxiredoxin [Posttranslational modification | 99.94 | |
| KOG0852|consensus | 196 | 99.91 | ||
| PRK10382 | 187 | alkyl hydroperoxide reductase subunit C; Provision | 99.86 | |
| PRK15000 | 200 | peroxidase; Provisional | 99.86 | |
| PRK13191 | 215 | putative peroxiredoxin; Provisional | 99.85 | |
| PTZ00137 | 261 | 2-Cys peroxiredoxin; Provisional | 99.84 | |
| PRK13190 | 202 | putative peroxiredoxin; Provisional | 99.81 | |
| PRK13189 | 222 | peroxiredoxin; Provisional | 99.81 | |
| PRK13599 | 215 | putative peroxiredoxin; Provisional | 99.81 | |
| cd03016 | 203 | PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub | 99.79 | |
| PTZ00253 | 199 | tryparedoxin peroxidase; Provisional | 99.77 | |
| COG1225 | 157 | Bcp Peroxiredoxin [Posttranslational modification, | 99.77 | |
| TIGR03137 | 187 | AhpC peroxiredoxin. This gene contains two invaria | 99.76 | |
| KOG0854|consensus | 224 | 99.71 | ||
| cd03015 | 173 | PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- | 99.7 | |
| PRK00522 | 167 | tpx lipid hydroperoxide peroxidase; Provisional | 99.49 | |
| cd03013 | 155 | PRX5_like Peroxiredoxin (PRX) family, PRX5-like su | 99.46 | |
| cd03014 | 143 | PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical | 99.35 | |
| cd03018 | 149 | PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik | 99.27 | |
| PRK09437 | 154 | bcp thioredoxin-dependent thiol peroxidase; Review | 99.18 | |
| cd03017 | 140 | PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit | 99.16 | |
| cd02971 | 140 | PRX_family Peroxiredoxin (PRX) family; composed of | 99.06 | |
| cd03012 | 126 | TlpA_like_DipZ_like TlpA-like family, DipZ-like su | 99.0 | |
| cd02970 | 149 | PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot | 99.0 | |
| KOG0855|consensus | 211 | 99.0 | ||
| PF00578 | 124 | AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per | 98.99 | |
| COG2077 | 158 | Tpx Peroxiredoxin [Posttranslational modification, | 98.97 | |
| PRK15412 | 185 | thiol:disulfide interchange protein DsbE; Provisio | 98.87 | |
| PF08534 | 146 | Redoxin: Redoxin; InterPro: IPR013740 This redoxin | 98.84 | |
| TIGR00385 | 173 | dsbE periplasmic protein thiol:disulfide oxidoredu | 98.82 | |
| cd02969 | 171 | PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot | 98.81 | |
| TIGR01626 | 184 | ytfJ_HI0045 conserved hypothetical protein YtfJ-fa | 98.78 | |
| PRK03147 | 173 | thiol-disulfide oxidoreductase; Provisional | 98.75 | |
| PLN02412 | 167 | probable glutathione peroxidase | 98.74 | |
| TIGR02540 | 153 | gpx7 putative glutathione peroxidase Gpx7. This mo | 98.7 | |
| cd03010 | 127 | TlpA_like_DsbE TlpA-like family, DsbE (also known | 98.64 | |
| cd00340 | 152 | GSH_Peroxidase Glutathione (GSH) peroxidase family | 98.63 | |
| cd03011 | 123 | TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso | 98.54 | |
| TIGR02661 | 189 | MauD methylamine dehydrogenase accessory protein M | 98.46 | |
| PTZ00056 | 199 | glutathione peroxidase; Provisional | 98.41 | |
| cd02968 | 142 | SCO SCO (an acronym for Synthesis of Cytochrome c | 98.36 | |
| cd02966 | 116 | TlpA_like_family TlpA-like family; composed of Tlp | 98.33 | |
| PLN02399 | 236 | phospholipid hydroperoxide glutathione peroxidase | 98.33 | |
| PTZ00256 | 183 | glutathione peroxidase; Provisional | 98.31 | |
| cd02967 | 114 | mauD Methylamine utilization (mau) D family; mauD | 98.08 | |
| PRK14018 | 521 | trifunctional thioredoxin/methionine sulfoxide red | 98.0 | |
| PRK13728 | 181 | conjugal transfer protein TrbB; Provisional | 97.88 | |
| cd03008 | 146 | TryX_like_RdCVF Tryparedoxin (TryX)-like family, R | 97.78 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 97.75 | |
| cd03009 | 131 | TryX_like_TryX_NRX Tryparedoxin (TryX)-like family | 97.2 | |
| PF13911 | 115 | AhpC-TSA_2: AhpC/TSA antioxidant enzyme | 97.18 | |
| TIGR02738 | 153 | TrbB type-F conjugative transfer system pilin asse | 96.89 | |
| PF09695 | 160 | YtfJ_HI0045: Bacterial protein of unknown function | 96.82 | |
| cd02964 | 132 | TryX_like_family Tryparedoxin (TryX)-like family; | 96.72 | |
| PF13905 | 95 | Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ | 96.62 | |
| COG0678 | 165 | AHP1 Peroxiredoxin [Posttranslational modification | 96.59 | |
| PF13098 | 112 | Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ | 96.37 | |
| cd02950 | 142 | TxlA TRX-like protein A (TxlA) family; TxlA was or | 96.09 | |
| KOG0541|consensus | 171 | 96.06 | ||
| cd02951 | 125 | SoxW SoxW family; SoxW is a bacterial periplasmic | 95.94 | |
| COG3054 | 184 | Predicted transcriptional regulator [General funct | 95.87 | |
| PRK10606 | 183 | btuE putative glutathione peroxidase; Provisional | 95.57 | |
| PF00837 | 237 | T4_deiodinase: Iodothyronine deiodinase; InterPro: | 95.31 | |
| TIGR02740 | 271 | TraF-like TraF-like protein. This protein is relat | 95.07 | |
| cd03065 | 120 | PDI_b_Calsequestrin_N PDIb family, Calsequestrin s | 94.92 | |
| cd02956 | 96 | ybbN ybbN protein family; ybbN is a hypothetical p | 94.74 | |
| cd02953 | 104 | DsbDgamma DsbD gamma family; DsbD gamma is the C-t | 94.35 | |
| cd02963 | 111 | TRX_DnaJ TRX domain, DnaJ domain containing protei | 94.33 | |
| PRK11509 | 132 | hydrogenase-1 operon protein HyaE; Provisional | 94.1 | |
| cd02948 | 102 | TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus | 93.91 | |
| cd02958 | 114 | UAS UAS family; UAS is a domain of unknown functio | 93.82 | |
| PRK09381 | 109 | trxA thioredoxin; Provisional | 93.48 | |
| TIGR01126 | 102 | pdi_dom protein disulfide-isomerase domain. This m | 93.21 | |
| cd02994 | 101 | PDI_a_TMX PDIa family, TMX subfamily; composed of | 92.97 | |
| PRK10996 | 139 | thioredoxin 2; Provisional | 92.71 | |
| TIGR01068 | 101 | thioredoxin thioredoxin. Several proteins, such as | 92.69 | |
| PF05176 | 252 | ATP-synt_10: ATP10 protein; InterPro: IPR007849 Th | 92.13 | |
| PF02630 | 174 | SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This fam | 92.05 | |
| cd02961 | 101 | PDI_a_family Protein Disulfide Isomerase (PDIa) fa | 92.04 | |
| PF13728 | 215 | TraF: F plasmid transfer operon protein | 91.41 | |
| cd03005 | 102 | PDI_a_ERp46 PDIa family, endoplasmic reticulum pro | 91.39 | |
| COG1999 | 207 | Uncharacterized protein SCO1/SenC/PrrC, involved i | 91.25 | |
| cd02985 | 103 | TRX_CDSP32 TRX family, chloroplastic drought-induc | 90.64 | |
| cd02949 | 97 | TRX_NTR TRX domain, novel NADPH thioredoxin reduct | 90.44 | |
| PRK00293 | 571 | dipZ thiol:disulfide interchange protein precursor | 90.15 | |
| KOG0910|consensus | 150 | 90.15 | ||
| cd02955 | 124 | SSP411 TRX domain, SSP411 protein family; members | 89.94 | |
| PF13778 | 118 | DUF4174: Domain of unknown function (DUF4174) | 89.8 | |
| COG0386 | 162 | BtuE Glutathione peroxidase [Posttranslational mod | 89.72 | |
| cd02996 | 108 | PDI_a_ERp44 PDIa family, endoplasmic reticulum pro | 89.45 | |
| PF00085 | 103 | Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio | 88.61 | |
| cd03004 | 104 | PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam | 88.58 | |
| cd02954 | 114 | DIM1 Dim1 family; Dim1 is also referred to as U5 s | 88.03 | |
| cd03002 | 109 | PDI_a_MPD1_like PDI family, MPD1-like subfamily; c | 87.91 | |
| PTZ00443 | 224 | Thioredoxin domain-containing protein; Provisional | 86.62 | |
| cd02965 | 111 | HyaE HyaE family; HyaE is also called HupG and Hox | 86.53 | |
| cd02997 | 104 | PDI_a_PDIR PDIa family, PDIR subfamily; composed o | 86.48 | |
| cd02998 | 105 | PDI_a_ERp38 PDIa family, endoplasmic reticulum pro | 86.11 | |
| cd02984 | 97 | TRX_PICOT TRX domain, PICOT (for PKC-interacting c | 85.33 | |
| cd03001 | 103 | PDI_a_P5 PDIa family, P5 subfamily; composed of eu | 84.01 | |
| PF03544 | 79 | TonB_C: Gram-negative bacterial TonB protein C-ter | 83.78 | |
| cd02947 | 93 | TRX_family TRX family; composed of two groups: Gro | 83.76 | |
| TIGR01352 | 74 | tonB_Cterm TonB family C-terminal domain. This mod | 83.42 | |
| cd02999 | 100 | PDI_a_ERp44_like PDIa family, endoplasmic reticulu | 82.98 | |
| KOG1651|consensus | 171 | 82.51 | ||
| TIGR02739 | 256 | TraF type-F conjugative transfer system pilin asse | 82.29 | |
| cd02975 | 113 | PfPDO_like_N Pyrococcus furiosus protein disulfide | 81.96 | |
| COG0810 | 244 | TonB Periplasmic protein TonB, links inner and out | 81.77 | |
| smart00594 | 122 | UAS UAS domain. | 81.25 | |
| PTZ00051 | 98 | thioredoxin; Provisional | 80.88 | |
| cd03000 | 104 | PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o | 80.23 |
| >COG0450 AhpC Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.94 E-value=1.9e-26 Score=163.71 Aligned_cols=96 Identities=47% Similarity=0.826 Sum_probs=89.1
Q ss_pred chHHHHHHHHhhhcCCCCCCCCCceEEeeCcchHHhhhCCccccCCccceeEEEECCCCCEEEEEeccCCCCCCHHHHHH
Q psy13875 4 VDEGDEVWLEDVKQGDGGLGDLKYPLLADFKKEIATSYGVLIESAGIPLRGLFIIDTKGVLRQITVNDLPVGRSVEEVLR 83 (105)
Q Consensus 4 ~~~sh~~w~~~~~~~~~~~~~l~fpllsD~~~~vak~ygv~~~~~G~~~ratfiID~~G~V~~~~~~~~~~~~~~~eil~ 83 (105)
.++||++|++. .++.+++++++|||++|.+++||++||+..++.|.+.|++||||++|+||++.+++.+.+|+++|+||
T Consensus 77 s~fsH~aW~~~-~~~~~gi~~i~~PmiaD~~~~vs~~ygvl~~~~g~a~R~~FIIDp~g~ir~~~v~~~~iGRn~dEilR 155 (194)
T COG0450 77 SVFSHKAWKAT-IREAGGIGKIKFPMIADPKGEIARAYGVLHPEEGLALRGTFIIDPDGVIRHILVNPLTIGRNVDEILR 155 (194)
T ss_pred cHHHHHHHHhc-HHhcCCccceecceEEcCchhHHHHcCCcccCCCcceeEEEEECCCCeEEEEEEecCCCCcCHHHHHH
Confidence 46899999954 45557888899999999999999999999988899999999999999999999999999999999999
Q ss_pred HHHhhhhhhhcCCcccC
Q psy13875 84 LVKAFQFVDKHGEGSKR 100 (105)
Q Consensus 84 ~l~~l~~~~~~~~~~~~ 100 (105)
.|++||..++||++||+
T Consensus 156 ~idAlq~~~~hg~vcPa 172 (194)
T COG0450 156 VIDALQFVAKHGEVCPA 172 (194)
T ss_pred HHHHHHHHHHhCCCccC
Confidence 99999999999999997
|
|
| >KOG0852|consensus | Back alignment and domain information |
|---|
| >PRK10382 alkyl hydroperoxide reductase subunit C; Provisional | Back alignment and domain information |
|---|
| >PRK15000 peroxidase; Provisional | Back alignment and domain information |
|---|
| >PRK13191 putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >PTZ00137 2-Cys peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK13190 putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK13189 peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK13599 putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine | Back alignment and domain information |
|---|
| >PTZ00253 tryparedoxin peroxidase; Provisional | Back alignment and domain information |
|---|
| >COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03137 AhpC peroxiredoxin | Back alignment and domain information |
|---|
| >KOG0854|consensus | Back alignment and domain information |
|---|
| >cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides | Back alignment and domain information |
|---|
| >PRK00522 tpx lipid hydroperoxide peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol | Back alignment and domain information |
|---|
| >cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) | Back alignment and domain information |
|---|
| >cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE | Back alignment and domain information |
|---|
| >PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed | Back alignment and domain information |
|---|
| >cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides | Back alignment and domain information |
|---|
| >cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified | Back alignment and domain information |
|---|
| >cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain | Back alignment and domain information |
|---|
| >cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs | Back alignment and domain information |
|---|
| >KOG0855|consensus | Back alignment and domain information |
|---|
| >PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells | Back alignment and domain information |
|---|
| >COG2077 Tpx Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15412 thiol:disulfide interchange protein DsbE; Provisional | Back alignment and domain information |
|---|
| >PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins | Back alignment and domain information |
|---|
| >TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily | Back alignment and domain information |
|---|
| >cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs | Back alignment and domain information |
|---|
| >TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 | Back alignment and domain information |
|---|
| >PRK03147 thiol-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN02412 probable glutathione peroxidase | Back alignment and domain information |
|---|
| >TIGR02540 gpx7 putative glutathione peroxidase Gpx7 | Back alignment and domain information |
|---|
| >cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif | Back alignment and domain information |
|---|
| >cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate | Back alignment and domain information |
|---|
| >cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif | Back alignment and domain information |
|---|
| >TIGR02661 MauD methylamine dehydrogenase accessory protein MauD | Back alignment and domain information |
|---|
| >PTZ00056 glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold | Back alignment and domain information |
|---|
| >cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins | Back alignment and domain information |
|---|
| >PLN02399 phospholipid hydroperoxide glutathione peroxidase | Back alignment and domain information |
|---|
| >PTZ00256 glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source | Back alignment and domain information |
|---|
| >PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional | Back alignment and domain information |
|---|
| >PRK13728 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif | Back alignment and domain information |
|---|
| >PF13911 AhpC-TSA_2: AhpC/TSA antioxidant enzyme | Back alignment and domain information |
|---|
| >TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | Back alignment and domain information |
|---|
| >PF09695 YtfJ_HI0045: Bacterial protein of unknown function (YtfJ_HI0045); InterPro: IPR006513 These are sequences from gammaproteobacteria that are related to the Escherichia coli protein, YtfJ | Back alignment and domain information |
|---|
| >cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX | Back alignment and domain information |
|---|
| >PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A | Back alignment and domain information |
|---|
| >COG0678 AHP1 Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A | Back alignment and domain information |
|---|
| >cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus | Back alignment and domain information |
|---|
| >KOG0541|consensus | Back alignment and domain information |
|---|
| >cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation | Back alignment and domain information |
|---|
| >COG3054 Predicted transcriptional regulator [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10606 btuE putative glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >PF00837 T4_deiodinase: Iodothyronine deiodinase; InterPro: IPR000643 Iodothyronine deiodinase (1 | Back alignment and domain information |
|---|
| >TIGR02740 TraF-like TraF-like protein | Back alignment and domain information |
|---|
| >cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain | Back alignment and domain information |
|---|
| >cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD | Back alignment and domain information |
|---|
| >cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain | Back alignment and domain information |
|---|
| >PRK11509 hydrogenase-1 operon protein HyaE; Provisional | Back alignment and domain information |
|---|
| >cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein | Back alignment and domain information |
|---|
| >cd02958 UAS UAS family; UAS is a domain of unknown function | Back alignment and domain information |
|---|
| >PRK09381 trxA thioredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR01126 pdi_dom protein disulfide-isomerase domain | Back alignment and domain information |
|---|
| >cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX | Back alignment and domain information |
|---|
| >PRK10996 thioredoxin 2; Provisional | Back alignment and domain information |
|---|
| >TIGR01068 thioredoxin thioredoxin | Back alignment and domain information |
|---|
| >PF05176 ATP-synt_10: ATP10 protein; InterPro: IPR007849 This entry represents the ATPase assembly factor ATP10 found in mitochondria, which is essential for the assembly of the mitochondrial F1-F0 complex | Back alignment and domain information |
|---|
| >PF02630 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This family is involved in biogenesis of respiratory and photosynthetic systems | Back alignment and domain information |
|---|
| >cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >PF13728 TraF: F plasmid transfer operon protein | Back alignment and domain information |
|---|
| >cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains | Back alignment and domain information |
|---|
| >COG1999 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only] | Back alignment and domain information |
|---|
| >cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif | Back alignment and domain information |
|---|
| >cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains | Back alignment and domain information |
|---|
| >PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional | Back alignment and domain information |
|---|
| >KOG0910|consensus | Back alignment and domain information |
|---|
| >cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif | Back alignment and domain information |
|---|
| >PF13778 DUF4174: Domain of unknown function (DUF4174) | Back alignment and domain information |
|---|
| >COG0386 BtuE Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein | Back alignment and domain information |
|---|
| >cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein | Back alignment and domain information |
|---|
| >PTZ00443 Thioredoxin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO | Back alignment and domain information |
|---|
| >cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 | Back alignment and domain information |
|---|
| >cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes | Back alignment and domain information |
|---|
| >cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >PF03544 TonB_C: Gram-negative bacterial TonB protein C-terminal; InterPro: IPR006260 The sequences in this set all contain a conserved C-terminal domain which is characteristic of TonB and is homologs | Back alignment and domain information |
|---|
| >cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >TIGR01352 tonB_Cterm TonB family C-terminal domain | Back alignment and domain information |
|---|
| >cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 | Back alignment and domain information |
|---|
| >KOG1651|consensus | Back alignment and domain information |
|---|
| >TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF | Back alignment and domain information |
|---|
| >cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding | Back alignment and domain information |
|---|
| >COG0810 TonB Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >smart00594 UAS UAS domain | Back alignment and domain information |
|---|
| >PTZ00051 thioredoxin; Provisional | Back alignment and domain information |
|---|
| >cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 105 | ||||
| 3tue_A | 219 | The Structure Of Tryparedoxin Peroxidase I From Lei | 7e-27 | ||
| 2z9s_A | 199 | Crystal Structure Analysis Of Rat Hbp23PEROXIREDOXI | 5e-26 | ||
| 1qq2_A | 199 | Crystal Structure Of A Mammalian 2-Cys Peroxiredoxi | 5e-26 | ||
| 2rii_A | 199 | Crystal Structure Of Human Peroxiredoxin I In Compl | 8e-26 | ||
| 3hy2_A | 206 | Crystal Structure Of Sulfiredoxin In Complex With P | 9e-26 | ||
| 3qpm_A | 240 | Crystal Structure Of Peroxiredoxin Prx4 From Pseudo | 2e-25 | ||
| 3tkp_A | 246 | Crystal Structure Of Full-Length Human Peroxiredoxi | 3e-25 | ||
| 3tks_A | 246 | Crystal Structure Of Full-Length Human Peroxiredoxi | 3e-25 | ||
| 3tjk_A | 254 | Crystal Structure Of Human Peroxiredoxin Iv C245a M | 3e-25 | ||
| 3tjf_A | 254 | Crystal Structure Of Human Peroxiredoxin Iv C51a Mu | 3e-25 | ||
| 3tkr_A | 246 | Crystal Structure Of Full-Length Human Peroxiredoxi | 3e-25 | ||
| 3tjj_A | 254 | Crystal Structure Of Human Peroxiredoxin Iv C245a M | 3e-25 | ||
| 3tjb_A | 254 | Crystal Structure Of Wild-Type Human Peroxiredoxin | 4e-25 | ||
| 2pn8_A | 211 | Crystal Structure Of Human Peroxiredoxin 4 (Thiored | 4e-25 | ||
| 1zye_A | 220 | Crystal Strucutre Analysis Of Bovine Mitochondrial | 9e-25 | ||
| 3zvj_A | 219 | Crystal Structure Of High Molecular Weight (Hmw) Fo | 1e-24 | ||
| 3ztl_A | 222 | Crystal Structure Of Decameric Form Of Peroxiredoxi | 1e-24 | ||
| 1qmv_A | 197 | Thioredoxin Peroxidase B From Red Blood Cells Lengt | 1e-24 | ||
| 3zvj_D | 219 | Crystal Structure Of High Molecular Weight (Hmw) Fo | 2e-24 | ||
| 1uul_A | 202 | Tryparedoxin Peroxidase (Txnpx) From Trypanosoma Cr | 3e-24 | ||
| 3sbc_A | 216 | Crystal Structure Of Saccharomyces Cerevisiae Tsa1c | 7e-24 | ||
| 1e2y_A | 188 | Tryparedoxin Peroxidase From Crithidia Fasciculata | 2e-21 | ||
| 2c0d_A | 221 | Structure Of The Mitochondrial 2-Cys Peroxiredoxin | 2e-16 | ||
| 1zof_A | 198 | Crystal Structure Of Alkyl Hydroperoxide-Reductase | 1e-14 | ||
| 2h01_A | 192 | Py00414- Plasmodium Yoelii Thioredoxin Peroxidase I | 3e-14 | ||
| 2h66_A | 213 | The Crystal Structure Of Plasmodium Vivax 2-Cys Per | 2e-13 | ||
| 2e2g_A | 250 | Crystal Structure Of Archaeal Peroxiredoxin, Thiore | 4e-08 | ||
| 2e2m_A | 250 | Crystal Structure Of Archaeal Peroxiredoxin, Thiore | 4e-08 | ||
| 3a5w_A | 249 | Peroxiredoxin (Wild Type) From Aeropyrum Pernix K1 | 5e-08 | ||
| 3a2w_A | 249 | Peroxiredoxin (C50s) From Aeropytum Pernix K1 (Pero | 5e-08 | ||
| 3a2v_A | 249 | Peroxiredoxin (C207s) From Aeropyrum Pernix K1 Comp | 5e-08 | ||
| 2zct_A | 249 | Oxidation Of Archaeal Peroxiredoxin Involves A Hype | 5e-08 | ||
| 1we0_A | 187 | Crystal Structure Of Peroxiredoxin (Ahpc) From Amph | 2e-07 | ||
| 2v2g_A | 233 | Crystal Structure Of The C45s Mutant Of The Peroxir | 2e-07 | ||
| 1x0r_A | 249 | Thioredoxin Peroxidase From Aeropyrum Pernix K1 Len | 2e-07 | ||
| 2cv4_A | 250 | Crystal Structure Of An Archaeal Peroxiredoxin From | 2e-07 | ||
| 2bmx_A | 195 | Mycobacterium Tuberculosis Ahpc Length = 195 | 3e-06 | ||
| 1yex_A | 186 | Structural And Biochemical Analysis Of The Link Bet | 5e-06 | ||
| 1n8j_A | 186 | Crystal Structure Of Ahpc With Active Site Cysteine | 6e-06 | ||
| 3emp_A | 186 | Crystal Structure Of The S-Acetanilide Modified For | 6e-06 | ||
| 1yep_A | 186 | Structural And Biochemical Analysis Of The Link Bet | 6e-06 | ||
| 1yf0_A | 186 | Structural And Biochemical Analysis Of The Link Bet | 6e-06 | ||
| 1yf1_A | 186 | Structural And Biochemical Analysis Of The Link Bet | 6e-06 | ||
| 1xcc_A | 220 | 1-Cys Peroxidoxin From Plasmodium Yoelli Length = 2 | 7e-06 | ||
| 3tb2_A | 220 | 1-Cys Peroxidoxin From Plasmodium Yoelli Length = 2 | 7e-06 | ||
| 1xvw_A | 160 | Crystal Structure Of Ahpe From Mycobacterium Tuberc | 1e-04 | ||
| 1xxu_A | 153 | Crystal Structure Of Ahpe From Mycrobacterium Tuber | 2e-04 |
| >pdb|3TUE|A Chain A, The Structure Of Tryparedoxin Peroxidase I From Leishmania Major Length = 219 | Back alignment and structure |
|
| >pdb|2Z9S|A Chain A, Crystal Structure Analysis Of Rat Hbp23PEROXIREDOXIN I, Cys52ser Mutant Length = 199 | Back alignment and structure |
| >pdb|1QQ2|A Chain A, Crystal Structure Of A Mammalian 2-Cys Peroxiredoxin, Hbp23. Length = 199 | Back alignment and structure |
| >pdb|2RII|A Chain A, Crystal Structure Of Human Peroxiredoxin I In Complex With Sulfiredoxin Length = 199 | Back alignment and structure |
| >pdb|3HY2|A Chain A, Crystal Structure Of Sulfiredoxin In Complex With Peroxiredoxin I And Atp:mg2+ Length = 206 | Back alignment and structure |
| >pdb|3QPM|A Chain A, Crystal Structure Of Peroxiredoxin Prx4 From Pseudosciaena Crocea Length = 240 | Back alignment and structure |
| >pdb|3TKP|A Chain A, Crystal Structure Of Full-Length Human Peroxiredoxin 4 In The Reduced Form Length = 246 | Back alignment and structure |
| >pdb|3TKS|A Chain A, Crystal Structure Of Full-Length Human Peroxiredoxin 4 In Three Different Redox States Length = 246 | Back alignment and structure |
| >pdb|3TJK|A Chain A, Crystal Structure Of Human Peroxiredoxin Iv C245a Mutant In Reduced Form Length = 254 | Back alignment and structure |
| >pdb|3TJF|A Chain A, Crystal Structure Of Human Peroxiredoxin Iv C51a Mutant In Reduced Form Length = 254 | Back alignment and structure |
| >pdb|3TKR|A Chain A, Crystal Structure Of Full-Length Human Peroxiredoxin 4 With T118e Mutation Length = 246 | Back alignment and structure |
| >pdb|3TJJ|A Chain A, Crystal Structure Of Human Peroxiredoxin Iv C245a Mutant In Sulfenylated Form Length = 254 | Back alignment and structure |
| >pdb|3TJB|A Chain A, Crystal Structure Of Wild-Type Human Peroxiredoxin Iv Length = 254 | Back alignment and structure |
| >pdb|2PN8|A Chain A, Crystal Structure Of Human Peroxiredoxin 4 (Thioredoxin Peroxidase) Length = 211 | Back alignment and structure |
| >pdb|1ZYE|A Chain A, Crystal Strucutre Analysis Of Bovine Mitochondrial Peroxiredoxin Iii Length = 220 | Back alignment and structure |
| >pdb|3ZVJ|A Chain A, Crystal Structure Of High Molecular Weight (Hmw) Form Of Peroxiredoxin I From Schistosoma Mansoni Length = 219 | Back alignment and structure |
| >pdb|3ZTL|A Chain A, Crystal Structure Of Decameric Form Of Peroxiredoxin I From Schistosoma Mansoni Length = 222 | Back alignment and structure |
| >pdb|1QMV|A Chain A, Thioredoxin Peroxidase B From Red Blood Cells Length = 197 | Back alignment and structure |
| >pdb|3ZVJ|D Chain D, Crystal Structure Of High Molecular Weight (Hmw) Form Of Peroxiredoxin I From Schistosoma Mansoni Length = 219 | Back alignment and structure |
| >pdb|1UUL|A Chain A, Tryparedoxin Peroxidase (Txnpx) From Trypanosoma Cruzi In The Reduced State Length = 202 | Back alignment and structure |
| >pdb|3SBC|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Tsa1c47s Mutant Protein Length = 216 | Back alignment and structure |
| >pdb|1E2Y|A Chain A, Tryparedoxin Peroxidase From Crithidia Fasciculata Length = 188 | Back alignment and structure |
| >pdb|2C0D|A Chain A, Structure Of The Mitochondrial 2-Cys Peroxiredoxin From Plasmodium Falciparum Length = 221 | Back alignment and structure |
| >pdb|1ZOF|A Chain A, Crystal Structure Of Alkyl Hydroperoxide-Reductase (Ahpc) From Helicobacter Pylori Length = 198 | Back alignment and structure |
| >pdb|2H01|A Chain A, Py00414- Plasmodium Yoelii Thioredoxin Peroxidase I Length = 192 | Back alignment and structure |
| >pdb|2H66|A Chain A, The Crystal Structure Of Plasmodium Vivax 2-Cys Peroxiredoxin Length = 213 | Back alignment and structure |
| >pdb|2E2G|A Chain A, Crystal Structure Of Archaeal Peroxiredoxin, Thioredoxin Peroxidase From Aeropyrum Pernix K1 (Pre-Oxidation Form) Length = 250 | Back alignment and structure |
| >pdb|2E2M|A Chain A, Crystal Structure Of Archaeal Peroxiredoxin, Thioredoxin Peroxidase From Aeropyrum Pernix K1 (Sulfinic Acid Form) Length = 250 | Back alignment and structure |
| >pdb|3A5W|A Chain A, Peroxiredoxin (Wild Type) From Aeropyrum Pernix K1 (Reduced Form) Length = 249 | Back alignment and structure |
| >pdb|3A2W|A Chain A, Peroxiredoxin (C50s) From Aeropytum Pernix K1 (Peroxide-Bound Form) Length = 249 | Back alignment and structure |
| >pdb|3A2V|A Chain A, Peroxiredoxin (C207s) From Aeropyrum Pernix K1 Complexed With Hydrogen Peroxide Length = 249 | Back alignment and structure |
| >pdb|2ZCT|A Chain A, Oxidation Of Archaeal Peroxiredoxin Involves A Hypervalent Sulfur Intermediate Length = 249 | Back alignment and structure |
| >pdb|1WE0|A Chain A, Crystal Structure Of Peroxiredoxin (Ahpc) From Amphibacillus Xylanus Length = 187 | Back alignment and structure |
| >pdb|2V2G|A Chain A, Crystal Structure Of The C45s Mutant Of The Peroxiredoxin 6 Of Arenicola Marina. Monoclinic Form Length = 233 | Back alignment and structure |
| >pdb|1X0R|A Chain A, Thioredoxin Peroxidase From Aeropyrum Pernix K1 Length = 249 | Back alignment and structure |
| >pdb|2CV4|A Chain A, Crystal Structure Of An Archaeal Peroxiredoxin From The Aerobic Hyperthermophilic Crenarchaeon Aeropyrum Pernix K1 Length = 250 | Back alignment and structure |
| >pdb|2BMX|A Chain A, Mycobacterium Tuberculosis Ahpc Length = 195 | Back alignment and structure |
| >pdb|1YEX|A Chain A, Structural And Biochemical Analysis Of The Link Between Enzymatic Activity And Oligomerization In Ahpc, A Bacterial Peroxiredoxin. Length = 186 | Back alignment and structure |
| >pdb|1N8J|A Chain A, Crystal Structure Of Ahpc With Active Site Cysteine Mutated To Serine (C46s) Length = 186 | Back alignment and structure |
| >pdb|3EMP|A Chain A, Crystal Structure Of The S-Acetanilide Modified Form Of C165s Ahpc Length = 186 | Back alignment and structure |
| >pdb|1YEP|A Chain A, Structural And Biochemical Analysis Of The Link Between Enzymatic Activity And Olgomerization In Ahpc, A Bacterial Peroxiredoxin. Length = 186 | Back alignment and structure |
| >pdb|1YF0|A Chain A, Structural And Biochemical Analysis Of The Link Between Enzymatic Activity And Oligomerization In Ahpc, A Bacterial Peroxiredoxin. Length = 186 | Back alignment and structure |
| >pdb|1YF1|A Chain A, Structural And Biochemical Analysis Of The Link Between Enzymatic Activity And Oligomerization In Ahpc, A Bacterial Peroxiredoxin. Length = 186 | Back alignment and structure |
| >pdb|1XCC|A Chain A, 1-Cys Peroxidoxin From Plasmodium Yoelli Length = 220 | Back alignment and structure |
| >pdb|3TB2|A Chain A, 1-Cys Peroxidoxin From Plasmodium Yoelli Length = 220 | Back alignment and structure |
| >pdb|1XVW|A Chain A, Crystal Structure Of Ahpe From Mycobacterium Tuberculosis, A 1-Cys Peroxiredoxin Length = 160 | Back alignment and structure |
| >pdb|1XXU|A Chain A, Crystal Structure Of Ahpe From Mycrobacterium Tuberculosis, A 1-Cys Peroxiredoxin Length = 153 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 105 | |||
| 3ztl_A | 222 | Thioredoxin peroxidase; oxidoreductase, reductase, | 6e-47 | |
| 1e2y_A | 188 | TRYP, tryparedoxin peroxidase; 2-Cys peroxiredoxin | 7e-47 | |
| 3qpm_A | 240 | Peroxiredoxin; oxidoreductase, thioredoxin fold, p | 8e-47 | |
| 3tjj_A | 254 | Peroxiredoxin-4; thioredoxin fold, sulfenylation, | 9e-47 | |
| 1qmv_A | 197 | Human thioredoxin peroxidase-B; peroxiredoxin, sul | 1e-46 | |
| 3sbc_A | 216 | Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c | 1e-46 | |
| 1uul_A | 202 | Tryparedoxin peroxidase homologue; peroxiredoxin, | 1e-46 | |
| 2pn8_A | 211 | Peroxiredoxin-4; thioredoxin, oxidoreductase, stru | 1e-46 | |
| 1zye_A | 220 | Thioredoxin-dependent peroxide reductase; catenane | 2e-46 | |
| 2c0d_A | 221 | Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th | 9e-45 | |
| 2i81_A | 213 | 2-Cys peroxiredoxin; structural genomics consortiu | 2e-44 | |
| 2h01_A | 192 | 2-Cys peroxiredoxin; thioredoxin peroxidase, struc | 2e-44 | |
| 1zof_A | 198 | Alkyl hydroperoxide-reductase; decamer, toroide-sh | 4e-44 | |
| 1we0_A | 187 | Alkyl hydroperoxide reductase C; peroxiredoxin, AH | 2e-43 | |
| 1n8j_A | 186 | AHPC, alkyl hydroperoxide reductase C22 protein; p | 1e-42 | |
| 2bmx_A | 195 | Alkyl hydroperoxidase C; peroxiredoxin, antioxidan | 4e-37 | |
| 2v2g_A | 233 | Peroxiredoxin 6; oxidoreductase, antioxidant enzym | 6e-37 | |
| 1xcc_A | 220 | 1-Cys peroxiredoxin; unknown function, structural | 7e-37 | |
| 1prx_A | 224 | HORF6; peroxiredoxin, hydrogen peroxide, redox reg | 3e-36 | |
| 3a2v_A | 249 | Probable peroxiredoxin; thioredoxin peroxidase, hy | 3e-35 | |
| 1xvw_A | 160 | Hypothetical protein RV2238C/MT2298; thioredoxin f | 9e-26 | |
| 2ywn_A | 157 | Peroxiredoxin-like protein; redox protein, structu | 9e-13 | |
| 2cx4_A | 164 | Bacterioferritin comigratory protein; oxidoreducta | 1e-12 | |
| 3drn_A | 161 | Peroxiredoxin, bacterioferritin comigratory prote | 8e-09 | |
| 1psq_A | 163 | Probable thiol peroxidase; structural genomics, NY | 3e-07 | |
| 3p7x_A | 166 | Probable thiol peroxidase; thioredoxin fold, oxido | 3e-06 | |
| 1xvq_A | 175 | Thiol peroxidase; thioredoxin fold, structural gen | 1e-05 | |
| 2jsy_A | 167 | Probable thiol peroxidase; solution structure, ant | 2e-05 | |
| 3gkn_A | 163 | Bacterioferritin comigratory protein; BCP, PRX, at | 2e-05 | |
| 3ixr_A | 179 | Bacterioferritin comigratory protein; alpha beta p | 2e-05 | |
| 2yzh_A | 171 | Probable thiol peroxidase; redox protein, antioxid | 3e-05 | |
| 4evm_A | 138 | Thioredoxin family protein; structural genomics, n | 8e-05 | |
| 2lrn_A | 152 | Thiol:disulfide interchange protein; structural ge | 2e-04 | |
| 2ls5_A | 159 | Uncharacterized protein; structural genomics, unkn | 2e-04 | |
| 2f9s_A | 151 | Thiol-disulfide oxidoreductase RESA; thioredoxin-l | 7e-04 |
| >3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Length = 222 | Back alignment and structure |
|---|
Score = 148 bits (377), Expect = 6e-47
Identities = 53/86 (61%), Positives = 65/86 (75%), Gaps = 1/86 (1%)
Query: 11 WLEDVKQGDGGLGDLKYPLLADFKKEIATSYGVLIESAGIPLRGLFIIDTKGVLRQITVN 70
W ++ + GGLG +K PLLAD K+EI+ +YGV E G RGLFIID G+LRQIT+N
Sbjct: 120 WD-NLDRKSGGLGHMKIPLLADRKQEISKAYGVFDEEDGNAFRGLFIIDPNGILRQITIN 178
Query: 71 DLPVGRSVEEVLRLVKAFQFVDKHGE 96
D PVGRSV+E LRL+ AFQFV+KHGE
Sbjct: 179 DKPVGRSVDETLRLLDAFQFVEKHGE 204
|
| >1e2y_A TRYP, tryparedoxin peroxidase; 2-Cys peroxiredoxin, oxidoreductase; 3.2A {Crithidia fasciculata} SCOP: c.47.1.10 Length = 188 | Back alignment and structure |
|---|
| >3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} Length = 240 | Back alignment and structure |
|---|
| >3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C Length = 254 | Back alignment and structure |
|---|
| >1qmv_A Human thioredoxin peroxidase-B; peroxiredoxin, sulphinic acid; 1.7A {Homo sapiens} SCOP: c.47.1.10 PDB: 1qq2_A 2z9s_A 2rii_A 3hy2_A* Length = 197 | Back alignment and structure |
|---|
| >3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} Length = 216 | Back alignment and structure |
|---|
| >1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Length = 202 | Back alignment and structure |
|---|
| >2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Length = 220 | Back alignment and structure |
|---|
| >2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Length = 221 | Back alignment and structure |
|---|
| >2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Length = 213 | Back alignment and structure |
|---|
| >2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Length = 192 | Back alignment and structure |
|---|
| >1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Length = 198 | Back alignment and structure |
|---|
| >1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Length = 187 | Back alignment and structure |
|---|
| >1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Length = 186 | Back alignment and structure |
|---|
| >2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Length = 195 | Back alignment and structure |
|---|
| >2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A Length = 233 | Back alignment and structure |
|---|
| >1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A Length = 220 | Back alignment and structure |
|---|
| >1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 Length = 224 | Back alignment and structure |
|---|
| >3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Length = 249 | Back alignment and structure |
|---|
| >1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Length = 160 | Back alignment and structure |
|---|
| >2ywn_A Peroxiredoxin-like protein; redox protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.60A {Sulfolobus tokodaii} PDB: 3hjp_A Length = 157 | Back alignment and structure |
|---|
| >2cx4_A Bacterioferritin comigratory protein; oxidoreductase, antioxidant enzyme, reactive oxygen species, thioredoxin fold, structural genomics; 2.30A {Aeropyrum pernix} SCOP: c.47.1.10 PDB: 2cx3_A Length = 164 | Back alignment and structure |
|---|
| >3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} Length = 161 | Back alignment and structure |
|---|
| >1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Length = 163 | Back alignment and structure |
|---|
| >3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} Length = 166 | Back alignment and structure |
|---|
| >1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Length = 175 | Back alignment and structure |
|---|
| >2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Length = 167 | Back alignment and structure |
|---|
| >3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Length = 163 | Back alignment and structure |
|---|
| >3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Length = 179 | Back alignment and structure |
|---|
| >2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} Length = 171 | Back alignment and structure |
|---|
| >4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Length = 138 | Back alignment and structure |
|---|
| >2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Length = 152 | Back alignment and structure |
|---|
| >2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Length = 159 | Back alignment and structure |
|---|
| >2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Length = 151 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 105 | |||
| 3sbc_A | 216 | Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c | 99.93 | |
| 3tue_A | 219 | Tryparedoxin peroxidase; thioredoxin fold, peroxir | 99.92 | |
| 3a2v_A | 249 | Probable peroxiredoxin; thioredoxin peroxidase, hy | 99.75 | |
| 4eo3_A | 322 | Bacterioferritin comigratory protein/NADH dehydro; | 99.73 | |
| 1xcc_A | 220 | 1-Cys peroxiredoxin; unknown function, structural | 99.73 | |
| 1prx_A | 224 | HORF6; peroxiredoxin, hydrogen peroxide, redox reg | 99.72 | |
| 3tjj_A | 254 | Peroxiredoxin-4; thioredoxin fold, sulfenylation, | 99.72 | |
| 2v2g_A | 233 | Peroxiredoxin 6; oxidoreductase, antioxidant enzym | 99.71 | |
| 3qpm_A | 240 | Peroxiredoxin; oxidoreductase, thioredoxin fold, p | 99.7 | |
| 4gqc_A | 164 | Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f | 99.69 | |
| 4g2e_A | 157 | Peroxiredoxin; redox protein, structural genomics, | 99.67 | |
| 1n8j_A | 186 | AHPC, alkyl hydroperoxide reductase C22 protein; p | 99.67 | |
| 1uul_A | 202 | Tryparedoxin peroxidase homologue; peroxiredoxin, | 99.65 | |
| 2i81_A | 213 | 2-Cys peroxiredoxin; structural genomics consortiu | 99.65 | |
| 2pn8_A | 211 | Peroxiredoxin-4; thioredoxin, oxidoreductase, stru | 99.64 | |
| 1zye_A | 220 | Thioredoxin-dependent peroxide reductase; catenane | 99.63 | |
| 2c0d_A | 221 | Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th | 99.62 | |
| 1qmv_A | 197 | Human thioredoxin peroxidase-B; peroxiredoxin, sul | 99.61 | |
| 1xiy_A | 182 | Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin | 99.61 | |
| 2h01_A | 192 | 2-Cys peroxiredoxin; thioredoxin peroxidase, struc | 99.61 | |
| 3keb_A | 224 | Probable thiol peroxidase; structural genomics, AP | 99.6 | |
| 3mng_A | 173 | Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, | 99.6 | |
| 3ztl_A | 222 | Thioredoxin peroxidase; oxidoreductase, reductase, | 99.57 | |
| 2xhf_A | 171 | Peroxiredoxin 5; oxidoreductase, antioxidant enzym | 99.51 | |
| 4f82_A | 176 | Thioredoxin reductase; structural genomics, niaid, | 99.51 | |
| 1we0_A | 187 | Alkyl hydroperoxide reductase C; peroxiredoxin, AH | 99.5 | |
| 3p7x_A | 166 | Probable thiol peroxidase; thioredoxin fold, oxido | 99.49 | |
| 1psq_A | 163 | Probable thiol peroxidase; structural genomics, NY | 99.46 | |
| 1zof_A | 198 | Alkyl hydroperoxide-reductase; decamer, toroide-sh | 99.46 | |
| 3drn_A | 161 | Peroxiredoxin, bacterioferritin comigratory prote | 99.44 | |
| 3ixr_A | 179 | Bacterioferritin comigratory protein; alpha beta p | 99.39 | |
| 2bmx_A | 195 | Alkyl hydroperoxidase C; peroxiredoxin, antioxidan | 99.39 | |
| 3uma_A | 184 | Hypothetical peroxiredoxin protein; nysgrc, PSI bi | 99.37 | |
| 3gkn_A | 163 | Bacterioferritin comigratory protein; BCP, PRX, at | 99.37 | |
| 1xvw_A | 160 | Hypothetical protein RV2238C/MT2298; thioredoxin f | 99.36 | |
| 2yzh_A | 171 | Probable thiol peroxidase; redox protein, antioxid | 99.34 | |
| 3zrd_A | 200 | Thiol peroxidase; oxidoreductase, 2Cys peroxiredox | 99.32 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 99.31 | |
| 1tp9_A | 162 | Peroxiredoxin, PRX D (type II); oligomer, thioredo | 99.3 | |
| 1q98_A | 165 | Thiol peroxidase, TPX; structural genomics, NYSGXR | 99.29 | |
| 2pwj_A | 171 | Mitochondrial peroxiredoxin; alpha and beta protei | 99.29 | |
| 2jsy_A | 167 | Probable thiol peroxidase; solution structure, ant | 99.23 | |
| 1xvq_A | 175 | Thiol peroxidase; thioredoxin fold, structural gen | 99.16 | |
| 2wfc_A | 167 | Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan | 99.15 | |
| 2a4v_A | 159 | Peroxiredoxin DOT5; yeast nuclear thiol peroxidase | 99.08 | |
| 3eyt_A | 158 | Uncharacterized protein SPOA0173; thioredoxin-like | 98.99 | |
| 2f9s_A | 151 | Thiol-disulfide oxidoreductase RESA; thioredoxin-l | 98.97 | |
| 3lor_A | 160 | Thiol-disulfide isomerase and thioredoxins; PSI, M | 98.97 | |
| 3kcm_A | 154 | Thioredoxin family protein; SGX, thioredoxin prote | 98.96 | |
| 3u5r_E | 218 | Uncharacterized protein; structural genomics, PSI- | 98.91 | |
| 2ywi_A | 196 | Hypothetical conserved protein; uncharacterized co | 98.91 | |
| 4evm_A | 138 | Thioredoxin family protein; structural genomics, n | 98.89 | |
| 3gl3_A | 152 | Putative thiol:disulfide interchange protein DSBE; | 98.89 | |
| 3raz_A | 151 | Thioredoxin-related protein; structural genomics, | 98.84 | |
| 1lu4_A | 136 | Soluble secreted antigen MPT53; thioredoxin-like f | 98.84 | |
| 2b5x_A | 148 | YKUV protein, TRXY; thioredoxin-like, oxidoreducta | 98.83 | |
| 2hyx_A | 352 | Protein DIPZ; thioredoxin fold, jelly-roll, struct | 98.83 | |
| 1xzo_A | 174 | BSSCO, hypothetical protein YPMQ; thioredoxin-like | 98.82 | |
| 3erw_A | 145 | Sporulation thiol-disulfide oxidoreductase A; thio | 98.81 | |
| 1jfu_A | 186 | Thiol:disulfide interchange protein TLPA; thioredo | 98.81 | |
| 3hdc_A | 158 | Thioredoxin family protein; ATCC53774, DSM 7210, , | 98.81 | |
| 3kh7_A | 176 | Thiol:disulfide interchange protein DSBE; TRX-like | 98.8 | |
| 2cvb_A | 188 | Probable thiol-disulfide isomerase/thioredoxin; re | 98.8 | |
| 3ia1_A | 154 | THIO-disulfide isomerase/thioredoxin; oxidoreducta | 98.78 | |
| 2l5o_A | 153 | Putative thioredoxin; structural genomics, unknown | 98.76 | |
| 3lwa_A | 183 | Secreted thiol-disulfide isomerase; thioredoxin, P | 98.75 | |
| 3fw2_A | 150 | Thiol-disulfide oxidoreductase; structural genomic | 98.74 | |
| 2ggt_A | 164 | SCO1 protein homolog, mitochondrial; copper chaper | 98.73 | |
| 1zzo_A | 136 | RV1677; thioredoxin fold, structural genomics, PSI | 98.71 | |
| 2rli_A | 171 | SCO2 protein homolog, mitochondrial; copper protei | 98.71 | |
| 2k6v_A | 172 | Putative cytochrome C oxidase assembly protein; th | 98.7 | |
| 2b1k_A | 168 | Thiol:disulfide interchange protein DSBE; C-termin | 98.69 | |
| 1kng_A | 156 | Thiol:disulfide interchange protein CYCY; thioredo | 98.69 | |
| 4h86_A | 199 | Peroxiredoxin type-2; oxidoreductase; 2.00A {Sacch | 98.68 | |
| 3ewl_A | 142 | Uncharacterized conserved protein BF1870; alpha-be | 98.64 | |
| 2h30_A | 164 | Thioredoxin, peptide methionine sulfoxide reductas | 98.64 | |
| 3hcz_A | 148 | Possible thiol-disulfide isomerase; APC61559.2, cy | 98.63 | |
| 2lrn_A | 152 | Thiol:disulfide interchange protein; structural ge | 98.62 | |
| 3ha9_A | 165 | Uncharacterized thioredoxin-like protein; PSI, MCS | 98.55 | |
| 3fkf_A | 148 | Thiol-disulfide oxidoreductase; structural genomic | 98.54 | |
| 3or5_A | 165 | Thiol:disulfide interchange protein, thioredoxin p | 98.54 | |
| 4fo5_A | 143 | Thioredoxin-like protein; AHPC/TSA family protein, | 98.52 | |
| 3me7_A | 170 | Putative uncharacterized protein; electron transfe | 98.45 | |
| 2ls5_A | 159 | Uncharacterized protein; structural genomics, unkn | 97.82 | |
| 2b7k_A | 200 | SCO1 protein; metallochaperone, cytochrome C oxida | 98.43 | |
| 2lja_A | 152 | Putative thiol-disulfide oxidoreductase; structura | 98.43 | |
| 3eur_A | 142 | Uncharacterized protein; PSI2,MCSG, conserved prot | 98.38 | |
| 2lrt_A | 152 | Uncharacterized protein; structural genomics, thio | 98.37 | |
| 2vup_A | 190 | Glutathione peroxidase-like protein; oxidoreductas | 98.35 | |
| 2p5q_A | 170 | Glutathione peroxidase 5; thioredoxin fold, oxidor | 98.34 | |
| 2obi_A | 183 | PHGPX, GPX-4, phospholipid hydroperoxide glutathio | 98.32 | |
| 2p31_A | 181 | CL683, glutathione peroxidase 7; thioredoxin fold, | 98.28 | |
| 2i3y_A | 215 | Epididymal secretory glutathione peroxidase; thior | 98.28 | |
| 3cmi_A | 171 | Peroxiredoxin HYR1; thioredoxin-like fold, oxidore | 98.27 | |
| 2r37_A | 207 | Glutathione peroxidase 3; plasma, structural genom | 98.26 | |
| 2gs3_A | 185 | PHGPX, GPX-4, phospholipid hydroperoxide glutathio | 98.24 | |
| 2v1m_A | 169 | Glutathione peroxidase; selenium, selenocysteine, | 98.22 | |
| 3dwv_A | 187 | Glutathione peroxidase-like protein; alpha beta, 3 | 98.13 | |
| 3kij_A | 180 | Probable glutathione peroxidase 8; human PDI-perox | 98.07 | |
| 2f8a_A | 208 | Glutathione peroxidase 1; thioredoxin fold, struct | 98.05 | |
| 4hde_A | 170 | SCO1/SENC family lipoprotein; structural genomics, | 97.92 | |
| 2lus_A | 143 | Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci | 96.94 | |
| 2ju5_A | 154 | Thioredoxin disulfide isomerase; protein, oxidored | 97.7 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 97.45 | |
| 2kuc_A | 130 | Putative disulphide-isomerase; structural genomics | 97.43 | |
| 1i5g_A | 144 | Tryparedoxin II; electron transport; HET: TS5; 1.4 | 97.32 | |
| 2fwh_A | 134 | Thiol:disulfide interchange protein DSBD; thioredo | 97.24 | |
| 3fk8_A | 133 | Disulphide isomerase; APC61824.1, xylella fastidio | 97.22 | |
| 1o8x_A | 146 | Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot | 97.2 | |
| 1o73_A | 144 | Tryparedoxin; electron transport, trypanosomatid, | 97.05 | |
| 2l5l_A | 136 | Thioredoxin; structural genomics, electron transpo | 96.94 | |
| 3s9f_A | 165 | Tryparedoxin; thioredoxin fold, disulfide reductas | 96.86 | |
| 3hxs_A | 141 | Thioredoxin, TRXP; electron transport; 2.00A {Bact | 96.59 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 96.56 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 96.38 | |
| 3f9u_A | 172 | Putative exported cytochrome C biogenesis-related; | 96.34 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 96.29 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 96.28 | |
| 2qgv_A | 140 | Hydrogenase-1 operon protein HYAE; alpha-beta prot | 96.26 | |
| 2es7_A | 142 | Q8ZP25_salty, putative thiol-disulfide isomerase a | 96.24 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 96.23 | |
| 1oaz_A | 123 | Thioredoxin 1; immune system, antibody/complex, an | 96.21 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 96.18 | |
| 3tco_A | 109 | Thioredoxin (TRXA-1); disulfide oxidoreductase, ox | 96.15 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 96.14 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 96.14 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 96.12 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 96.11 | |
| 2o8v_B | 128 | Thioredoxin 1; disulfide crosslinked complex, oxid | 96.0 | |
| 2dlx_A | 153 | UBX domain-containing protein 7; UAS domain, prote | 95.91 | |
| 3die_A | 106 | Thioredoxin, TRX; electron transport, SWAP domain, | 95.91 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 95.88 | |
| 4euy_A | 105 | Uncharacterized protein; structural genomics, PSI- | 95.7 | |
| 3emx_A | 135 | Thioredoxin; structural genomics, oxidoreductase, | 95.7 | |
| 3ul3_B | 128 | Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; | 95.59 | |
| 3zzx_A | 105 | Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va | 95.55 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 95.48 | |
| 1sen_A | 164 | Thioredoxin-like protein P19; endoplasmic reticulu | 95.47 | |
| 2lst_A | 130 | Thioredoxin; structural genomics, NEW YORK structu | 94.44 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 95.4 | |
| 1x5e_A | 126 | Thioredoxin domain containing protein 1; TMX, TXND | 95.38 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 95.36 | |
| 1fb6_A | 105 | Thioredoxin M; electron transport; 2.10A {Spinacia | 95.35 | |
| 1x5d_A | 133 | Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC | 95.35 | |
| 2ppt_A | 155 | Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc | 95.33 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 95.32 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 95.26 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 95.23 | |
| 2dj1_A | 140 | Protein disulfide-isomerase A4; protein ERP-72, ER | 95.12 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 95.11 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 95.05 | |
| 2dml_A | 130 | Protein disulfide-isomerase A6; thioredoxin domain | 95.02 | |
| 3p2a_A | 148 | Thioredoxin 2, putative thioredoxin-like protein; | 94.96 | |
| 3cxg_A | 133 | Putative thioredoxin; malaria, structural GEN oxid | 94.93 | |
| 2qsi_A | 137 | Putative hydrogenase expression/formation protein; | 94.93 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 94.91 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 94.83 | |
| 3d22_A | 139 | TRXH4, thioredoxin H-type; electron transport, cyt | 94.81 | |
| 3uvt_A | 111 | Thioredoxin domain-containing protein 5; thioredox | 94.78 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 94.51 | |
| 3m9j_A | 105 | Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} | 94.47 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 94.41 | |
| 3gix_A | 149 | Thioredoxin-like protein 4B; PRE-mRNA splicing, TX | 94.4 | |
| 3hz4_A | 140 | Thioredoxin; NYSGXRC, PSI-II, reduced form, protei | 94.4 | |
| 2vim_A | 104 | Thioredoxin, TRX; thioredoxin fold, oxidoreductase | 94.39 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 94.35 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 94.27 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 94.22 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 94.2 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 94.07 | |
| 2vm1_A | 118 | Thioredoxin, thioredoxin H isoform 1.; oxidoreduct | 93.91 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 93.87 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 93.71 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 93.69 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 93.58 | |
| 2yj7_A | 106 | LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti | 92.59 | |
| 3ira_A | 173 | Conserved protein; methanosarcina mazei,structural | 93.45 | |
| 3ph9_A | 151 | Anterior gradient protein 3 homolog; thioredoxin f | 93.43 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 93.26 | |
| 3h79_A | 127 | Thioredoxin-like protein; thioredoxin fold, cataly | 93.26 | |
| 2dbc_A | 135 | PDCL2, unnamed protein product; phosducin-like pro | 93.2 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 93.03 | |
| 1zma_A | 118 | Bacterocin transport accessory protein; alpha-beta | 92.83 | |
| 1mek_A | 120 | Protein disulfide isomerase; electron transport, r | 92.77 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 92.49 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 92.41 | |
| 1qgv_A | 142 | Spliceosomal protein U5-15KD; snRNP, thioredoxin, | 91.87 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 91.8 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 91.51 | |
| 3aps_A | 122 | DNAJ homolog subfamily C member 10; thioredoxin fo | 90.86 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 90.6 | |
| 3dml_A | 116 | Putative uncharacterized protein; thioredoxin, oxi | 89.61 | |
| 3t58_A | 519 | Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. | 89.28 | |
| 3t58_A | 519 | Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. | 89.12 | |
| 2dj3_A | 133 | Protein disulfide-isomerase A4; protein ERP-72, ER | 86.62 | |
| 2av4_A | 160 | Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI | 84.38 | |
| 1v58_A | 241 | Thiol:disulfide interchange protein DSBG; reduced | 84.33 | |
| 2djk_A | 133 | PDI, protein disulfide-isomerase; thioredoxin fold | 83.57 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 83.08 | |
| 1sji_A | 350 | Calsequestrin 2, calsequestrin, cardiac muscle iso | 83.0 | |
| 1ilo_A | 77 | Conserved hypothetical protein MTH895; beta-alpha- | 82.52 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 81.87 | |
| 1z6n_A | 167 | Hypothetical protein PA1234; alpha-beta-alpha sand | 80.89 | |
| 1wmj_A | 130 | Thioredoxin H-type; structural genomics, program f | 80.66 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 80.14 |
| >3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=99.93 E-value=5.8e-26 Score=163.49 Aligned_cols=97 Identities=52% Similarity=0.859 Sum_probs=88.0
Q ss_pred chHHHHHHHHhhhcCCCCCCCCCceEEeeCcchHHhhhCCccccCCccceeEEEECCCCCEEEEEeccCCCCCCHHHHHH
Q psy13875 4 VDEGDEVWLEDVKQGDGGLGDLKYPLLADFKKEIATSYGVLIESAGIPLRGLFIIDTKGVLRQITVNDLPVGRSVEEVLR 83 (105)
Q Consensus 4 ~~~sh~~w~~~~~~~~~~~~~l~fpllsD~~~~vak~ygv~~~~~G~~~ratfiID~~G~V~~~~~~~~~~~~~~~eil~ 83 (105)
.+++|++|++.. +..+++.+++||||||++++++++||++.++.|++.|+|||||++|+|+++++++.+.+||++|+|+
T Consensus 96 s~~sh~aw~~~~-~~~~~~~~l~fpllsD~~~~vak~YGv~~~~~g~~~R~tFiID~~G~Ir~~~v~~~~~grn~dEiLr 174 (216)
T 3sbc_A 96 SEYSLLAWTNIP-RKEGGLGPINIPLLADTNHSLSRDYGVLIEEEGVALRGLFIIDPKGVIRHITINDLPVGRNVDEALR 174 (216)
T ss_dssp CHHHHHHHHTSC-GGGTCCCSCSSCEEECTTSHHHHHHTCEETTTTEECEEEEEECTTSBEEEEEEECTTBCCCHHHHHH
T ss_pred chhhHHHHHHHH-HHhCCccCcccceEeCCCCHHHHHcCCeeccCCceeeEEEEECCCCeEEEEEEcCCCCCCCHHHHHH
Confidence 468999999653 3335677899999999999999999999888899999999999999999999999999999999999
Q ss_pred HHHhhhhhhhcCCcccCC
Q psy13875 84 LVKAFQFVDKHGEGSKRV 101 (105)
Q Consensus 84 ~l~~l~~~~~~~~~~~~~ 101 (105)
.|++||..+++|++||+-
T Consensus 175 ~l~AlQ~~~~~~~~~Pa~ 192 (216)
T 3sbc_A 175 LVEAFQWTDKNGTVLPCN 192 (216)
T ss_dssp HHHHHHHHHHHCCBBCTT
T ss_pred HHHHhhhHhhcCCCcCCC
Confidence 999999999999999874
|
| >3tue_A Tryparedoxin peroxidase; thioredoxin fold, peroxiredoxin, oxidoreductase; 3.00A {Leishmania major} PDB: 1e2y_A | Back alignment and structure |
|---|
| >3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A | Back alignment and structure |
|---|
| >4eo3_A Bacterioferritin comigratory protein/NADH dehydro; thioredoxin-fold, alpha-beta-aplha sandwich fold, antioxidan oxidoreductase, FMN binding; HET: FMN; 1.65A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A | Back alignment and structure |
|---|
| >1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C | Back alignment and structure |
|---|
| >2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A | Back alignment and structure |
|---|
| >3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} | Back alignment and structure |
|---|
| >4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A | Back alignment and structure |
|---|
| >4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A | Back alignment and structure |
|---|
| >1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A | Back alignment and structure |
|---|
| >1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A | Back alignment and structure |
|---|
| >2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1qmv_A Human thioredoxin peroxidase-B; peroxiredoxin, sulphinic acid; 1.7A {Homo sapiens} SCOP: c.47.1.10 PDB: 1qq2_A 2z9s_A 2rii_A 3hy2_A* | Back alignment and structure |
|---|
| >1xiy_A Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin fold, peroxiredoxin fold, oxidoreductase; 1.80A {Plasmodium falciparum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A | Back alignment and structure |
|---|
| >3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D | Back alignment and structure |
|---|
| >2xhf_A Peroxiredoxin 5; oxidoreductase, antioxidant enzymes; 1.30A {Alvinella pompejana} | Back alignment and structure |
|---|
| >4f82_A Thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.85A {Burkholderia cenocepacia} | Back alignment and structure |
|---|
| >1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A | Back alignment and structure |
|---|
| >1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A | Back alignment and structure |
|---|
| >2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} | Back alignment and structure |
|---|
| >2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A | Back alignment and structure |
|---|
| >1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A | Back alignment and structure |
|---|
| >2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} | Back alignment and structure |
|---|
| >2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A | Back alignment and structure |
|---|
| >3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A | Back alignment and structure |
|---|
| >2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A | Back alignment and structure |
|---|
| >3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A | Back alignment and structure |
|---|
| >2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A | Back alignment and structure |
|---|
| >3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A | Back alignment and structure |
|---|
| >1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A | Back alignment and structure |
|---|
| >2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A | Back alignment and structure |
|---|
| >1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >4h86_A Peroxiredoxin type-2; oxidoreductase; 2.00A {Saccharomyces cerevisiae} PDB: 4dsq_A 4dsr_A 4dss_A | Back alignment and structure |
|---|
| >3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A | Back alignment and structure |
|---|
| >3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} | Back alignment and structure |
|---|
| >3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A | Back alignment and structure |
|---|
| >2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A | Back alignment and structure |
|---|
| >2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A | Back alignment and structure |
|---|
| >2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A | Back alignment and structure |
|---|
| >3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A | Back alignment and structure |
|---|
| >3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A | Back alignment and structure |
|---|
| >2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A | Back alignment and structure |
|---|
| >4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} | Back alignment and structure |
|---|
| >2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A | Back alignment and structure |
|---|
| >2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A | Back alignment and structure |
|---|
| >3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A | Back alignment and structure |
|---|
| >1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} | Back alignment and structure |
|---|
| >3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} | Back alignment and structure |
|---|
| >3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A | Back alignment and structure |
|---|
| >2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A | Back alignment and structure |
|---|
| >2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A | Back alignment and structure |
|---|
| >3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A | Back alignment and structure |
|---|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A | Back alignment and structure |
|---|
| >2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 | Back alignment and structure |
|---|
| >3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A | Back alignment and structure |
|---|
| >4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} | Back alignment and structure |
|---|
| >3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A | Back alignment and structure |
|---|
| >2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* | Back alignment and structure |
|---|
| >1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C | Back alignment and structure |
|---|
| >1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B | Back alignment and structure |
|---|
| >2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A | Back alignment and structure |
|---|
| >2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} | Back alignment and structure |
|---|
| >3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A | Back alignment and structure |
|---|
| >3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A | Back alignment and structure |
|---|
| >3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A | Back alignment and structure |
|---|
| >3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} | Back alignment and structure |
|---|
| >3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* | Back alignment and structure |
|---|
| >3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* | Back alignment and structure |
|---|
| >3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* | Back alignment and structure |
|---|
| >2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A | Back alignment and structure |
|---|
| >2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A | Back alignment and structure |
|---|
| >1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A | Back alignment and structure |
|---|
| >1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 105 | ||||
| d1uula_ | 194 | c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxi | 4e-26 | |
| d1zyea1 | 158 | c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) | 1e-25 | |
| d1e2ya_ | 167 | c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxi | 1e-25 | |
| d1qmva_ | 197 | c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredox | 2e-25 | |
| d1zofa1 | 170 | c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {He | 2e-24 | |
| d1we0a1 | 166 | c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase | 5e-23 | |
| d2h01a1 | 170 | c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thio | 1e-19 | |
| d2zcta1 | 237 | c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum perni | 2e-17 | |
| d2bmxa1 | 169 | c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase | 6e-17 | |
| d1xcca_ | 219 | c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoe | 5e-16 | |
| d1prxa_ | 220 | c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sa | 8e-16 | |
| d1n8ja_ | 186 | c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC | 2e-15 | |
| d2cx4a1 | 160 | c.47.1.10 (A:4-163) Bacterioferritin comigratory p | 1e-10 | |
| d1xvwa1 | 153 | c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c | 6e-10 | |
| d2a4va1 | 156 | c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's y | 4e-09 | |
| d1psqa_ | 163 | c.47.1.10 (A:) Probable thiol peroxidase PsaD {Str | 3e-08 | |
| d1xvqa_ | 166 | c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium | 1e-05 | |
| d1hd2a_ | 161 | c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapien | 3e-05 |
| >d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Length = 194 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: Glutathione peroxidase-like domain: Tryparedoxin peroxidase (thioredoxin peroxidase homologue) species: Trypanosoma cruzi [TaxId: 5693]
Score = 93.7 bits (232), Expect = 4e-26
Identities = 54/78 (69%), Positives = 59/78 (75%)
Query: 19 DGGLGDLKYPLLADFKKEIATSYGVLIESAGIPLRGLFIIDTKGVLRQITVNDLPVGRSV 78
GGLG + P+LAD K I SYGVL E G+ RGLFIID K LRQITVNDLPVGR V
Sbjct: 91 RGGLGQMNIPILADKTKCIMKSYGVLKEEDGVAYRGLFIIDPKQNLRQITVNDLPVGRDV 150
Query: 79 EEVLRLVKAFQFVDKHGE 96
+E LRLVKAFQFV+KHGE
Sbjct: 151 DEALRLVKAFQFVEKHGE 168
|
| >d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Length = 158 | Back information, alignment and structure |
|---|
| >d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Length = 167 | Back information, alignment and structure |
|---|
| >d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Length = 197 | Back information, alignment and structure |
|---|
| >d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Length = 170 | Back information, alignment and structure |
|---|
| >d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Length = 166 | Back information, alignment and structure |
|---|
| >d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} Length = 170 | Back information, alignment and structure |
|---|
| >d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Length = 237 | Back information, alignment and structure |
|---|
| >d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Length = 169 | Back information, alignment and structure |
|---|
| >d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} Length = 219 | Back information, alignment and structure |
|---|
| >d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Length = 220 | Back information, alignment and structure |
|---|
| >d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Length = 186 | Back information, alignment and structure |
|---|
| >d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 160 | Back information, alignment and structure |
|---|
| >d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 153 | Back information, alignment and structure |
|---|
| >d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 156 | Back information, alignment and structure |
|---|
| >d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} Length = 163 | Back information, alignment and structure |
|---|
| >d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} Length = 166 | Back information, alignment and structure |
|---|
| >d1hd2a_ c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 161 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 105 | |||
| d1uula_ | 194 | Tryparedoxin peroxidase (thioredoxin peroxidase ho | 99.91 | |
| d1n8ja_ | 186 | Alkyl hydroperoxide reductase AhpC {Salmonella typ | 99.91 | |
| d1qmva_ | 197 | Thioredoxin peroxidase 2 (thioredoxin peroxidase B | 99.9 | |
| d1xcca_ | 219 | 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [Tax | 99.9 | |
| d1prxa_ | 220 | 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: | 99.88 | |
| d1zofa1 | 170 | Thioredoxin reductase TsaA {Helicobacter pylori [T | 99.87 | |
| d2zcta1 | 237 | Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} | 99.86 | |
| d1we0a1 | 166 | Alkyl hydroperoxide reductase AhpC {Amphibacillus | 99.85 | |
| d1zyea1 | 158 | Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ | 99.84 | |
| d2h01a1 | 170 | Thioredoxin peroxidase 2 (thioredoxin peroxidase B | 99.84 | |
| d1e2ya_ | 167 | Tryparedoxin peroxidase (thioredoxin peroxidase ho | 99.79 | |
| d2bmxa1 | 169 | Alkyl hydroperoxide reductase AhpC {Mycobacterium | 99.78 | |
| d1xvwa1 | 153 | Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri | 99.59 | |
| d2cx4a1 | 160 | Bacterioferritin comigratory protein {Archaeon Aer | 99.51 | |
| d1psqa_ | 163 | Probable thiol peroxidase PsaD {Streptococcus pneu | 99.45 | |
| d2a4va1 | 156 | Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c | 99.44 | |
| d1hd2a_ | 161 | Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606 | 99.33 | |
| d1qxha_ | 164 | Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 | 99.29 | |
| d1xvqa_ | 166 | Thiol peroxidase Tpx {Mycobacterium tuberculosis [ | 99.29 | |
| d1q98a_ | 164 | Thiol peroxidase Tpx {Haemophilus influenzae [TaxI | 99.25 | |
| d1tp9a1 | 162 | Plant peroxiredoxin {Western balsam poplar(Populus | 99.25 | |
| d1nm3a2 | 163 | N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus | 99.21 | |
| d1st9a_ | 137 | Thiol-disulfide oxidoreductase ResA {Bacillus subt | 99.1 | |
| d2b5xa1 | 143 | thiol:disulfide oxidoreductase YkuV {Bacillus subt | 99.09 | |
| d1lu4a_ | 134 | Soluble secreted antigen MPT53 {Mycobacterium tube | 99.06 | |
| d1xiya1 | 179 | 1-Cys peroxiredoxin {Malaria parasite (Plasmodium | 98.93 | |
| d2fy6a1 | 143 | Peptide methionine sulfoxide reductase MsrA/MsrB, | 98.9 | |
| d1zzoa1 | 134 | Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI | 98.85 | |
| d1jfua_ | 176 | Membrane-anchored thioredoxin-like protein TlpA, s | 98.78 | |
| d1z5ye1 | 136 | Thioredoxin-like protein CcmG (CycY, DsbE) {Escher | 98.78 | |
| d2cvba1 | 187 | Probable thiol-disulfide isomerase/thioredoxin TTH | 98.74 | |
| d1knga_ | 144 | Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr | 98.72 | |
| d1xzoa1 | 172 | Thioredoxin-like protein Sco1 (YpmQ), soluble doma | 97.98 | |
| d2b7ka1 | 169 | Thioredoxin-like protein Sco1 (YpmQ), soluble doma | 97.69 | |
| d1wp0a1 | 160 | Thioredoxin-like protein Sco1 (YpmQ), soluble doma | 97.54 | |
| d1a8la2 | 107 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 96.43 | |
| d1o73a_ | 144 | Tryparedoxin I {Trypanosoma brucei brucei [TaxId: | 96.26 | |
| d1i5ga_ | 144 | Tryparedoxin II {Crithidia fasciculata [TaxId: 565 | 96.25 | |
| d1o8xa_ | 144 | Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 | 96.11 | |
| d1dbya_ | 107 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 95.95 | |
| d1thxa_ | 108 | Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | 95.52 | |
| d1fb6a_ | 104 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 95.5 | |
| d2fwha1 | 117 | Thiol:disulfide interchange protein DsbD, C-termin | 95.49 | |
| d2es7a1 | 119 | Hydrogenase-1 operon protein HyaE {Salmonella typh | 95.36 | |
| d2trxa_ | 108 | Thioredoxin {Escherichia coli [TaxId: 562]} | 95.29 | |
| d2hfda1 | 132 | Hydrogenase-1 operon protein HyaE {Escherichia col | 94.93 | |
| d1f9ma_ | 112 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 94.68 | |
| d1nw2a_ | 105 | Thioredoxin {Alicyclobacillus acidocaldarius, form | 94.63 | |
| d2ifqa1 | 105 | Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | 93.4 | |
| d1xfla_ | 114 | Thioredoxin {Thale cress (Arabidopsis thaliana) [T | 93.15 | |
| d2f8aa1 | 184 | Glutathione peroxidase {Human (Homo sapiens) [TaxI | 93.02 | |
| d1xwaa_ | 111 | Thioredoxin {Fruit fly (Drosophila melanogaster) [ | 92.95 | |
| d1fo5a_ | 85 | MJ0307, thioredoxin/glutaredoxin-like protein {Arc | 92.82 | |
| d1r26a_ | 113 | Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | 92.42 | |
| d1ep7a_ | 112 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 92.41 | |
| d1syra_ | 103 | Thioredoxin {Malarial parasite (Plasmodium falcipa | 91.97 | |
| d1gh2a_ | 107 | Thioredoxin-like protein, N-terminal domain {Human | 91.36 | |
| d1ti3a_ | 113 | Thioredoxin {European aspen (Populus tremula), thi | 90.43 | |
| d2dlxa1 | 147 | UBX domain-containing protein 7 {Human (Homo sapie | 88.98 | |
| d1nhoa_ | 85 | MTH807, thioredoxin/glutaredoxin-like protein {Arc | 88.89 | |
| d1hyua4 | 96 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 88.47 | |
| d2b5ea4 | 119 | Protein disulfide isomerase, PDI {Baker's yeast (S | 88.09 | |
| d1zmaa1 | 115 | Bacterocin transport accessory protein Bta {Strept | 86.61 | |
| d1a8ya1 | 124 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 84.4 | |
| d1qgva_ | 137 | spliceosomal protein U5-15Kd {Human (Homo sapiens) | 84.11 | |
| d1u07a_ | 90 | TonB {Escherichia coli [TaxId: 562]} | 81.49 | |
| d2c0ga2 | 122 | Windbeutel, N-terminal domain {Fruit fly (Drosophi | 80.68 | |
| d1meka_ | 120 | Protein disulfide isomerase, PDI {Human (Homo sapi | 80.14 |
| >d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: Glutathione peroxidase-like domain: Tryparedoxin peroxidase (thioredoxin peroxidase homologue) species: Trypanosoma cruzi [TaxId: 5693]
Probab=99.91 E-value=2.1e-24 Score=151.12 Aligned_cols=95 Identities=58% Similarity=0.886 Sum_probs=86.1
Q ss_pred hHHHHHHHHhhhcCCCCCCCCCceEEeeCcchHHhhhCCccccCCccceeEEEECCCCCEEEEEeccCCCCCCHHHHHHH
Q psy13875 5 DEGDEVWLEDVKQGDGGLGDLKYPLLADFKKEIATSYGVLIESAGIPLRGLFIIDTKGVLRQITVNDLPVGRSVEEVLRL 84 (105)
Q Consensus 5 ~~sh~~w~~~~~~~~~~~~~l~fpllsD~~~~vak~ygv~~~~~G~~~ratfiID~~G~V~~~~~~~~~~~~~~~eil~~ 84 (105)
+++|++|+++.. ..+++.+++||+|||++++|+++||++.+..|++.|+|||||++|+|+++++++...++|++|+|+.
T Consensus 78 ~~s~~~~~~~~~-~~~~~~~l~fpllsD~~~~v~~~ygv~~~~~~~~~R~tfvID~~G~I~~~~~~~~~~~r~~~E~Lr~ 156 (194)
T d1uula_ 78 EYSHLAWTSIER-KRGGLGQMNIPILADKTKCIMKSYGVLKEEDGVAYRGLFIIDPKQNLRQITVNDLPVGRDVDEALRL 156 (194)
T ss_dssp HHHHHHHHHSCG-GGTCCCSCSSCEEECTTCHHHHHHTCEETTTTEECEEEEEECTTSBEEEEEEECTTBCCCHHHHHHH
T ss_pred hhhhhhhhhhhh-hhccccCCCcceeeCCcchHHHHcCCeeccCCceEEEEEEECCCCeEEEEEEecCCCCcCHHHHHHH
Confidence 579999997643 3345668999999999999999999998877899999999999999999999999999999999999
Q ss_pred HHhhhhhhhcCCcccC
Q psy13875 85 VKAFQFVDKHGEGSKR 100 (105)
Q Consensus 85 l~~l~~~~~~~~~~~~ 100 (105)
|++||..+++|++||+
T Consensus 157 l~alQ~~~~~~~~cp~ 172 (194)
T d1uula_ 157 VKAFQFVEKHGEVCPA 172 (194)
T ss_dssp HHHHHHHHHHSCBBCT
T ss_pred HHHhhhHhhcCCCcCC
Confidence 9999999999999975
|
| >d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} | Back information, alignment and structure |
|---|
| >d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} | Back information, alignment and structure |
|---|
| >d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} | Back information, alignment and structure |
|---|
| >d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hd2a_ c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1tp9a1 c.47.1.10 (A:1-162) Plant peroxiredoxin {Western balsam poplar(Populus trichocarpa) [TaxId: 3694]} | Back information, alignment and structure |
|---|
| >d1nm3a2 c.47.1.10 (A:3-165) N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xiya1 c.47.1.10 (A:2-180) 1-Cys peroxiredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} | Back information, alignment and structure |
|---|
| >d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} | Back information, alignment and structure |
|---|
| >d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} | Back information, alignment and structure |
|---|
| >d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u07a_ d.212.1.2 (A:) TonB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|