Psyllid ID: psy13971

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MSSSRYDRAITVFSPDGHLLQVEYAQEAVRKGSTAVSFQVEVYLVSSFRKTGLRVQSTIKITLNNYLVMTKEIISLKVSPLLSQAQNSKLSMLNDHVVMAFAGKSLCLIALVALWYNEKDKTISVIYYGGKNSSALATELFLRPPRDLGIRAL
cccccccccccEEccccccHHHHHHHHHHHccccEEEEEEccEEEEEEEEccccccHHHHHHHcccHHHHHHHHHHcccccccccccccEEEEccEEEEEEEccHHHHHHHHHHHHHHHHHHEEEEEEccccHHHHHHHHHcccccccccccc
cccHHHccccccEcccccEHHHHHHHHHHcccccEEEEEEEEEEEccHHHcccccccEEEEEEEEEccccHHHHcccccHcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccHHEEEEEEEcccccHHHHHHHHcccccccccccc
msssrydraitvfspdghlLQVEYAQEAVRKGSTAVSFQVEVYLVSSFRKTGLRVQSTIKITLNNYLVMTKEIISlkvspllsqaqnsklsmLNDHVVMAFAGKSLCLIALVALWYNEKDKTISVIYYGGKNSSALATELflrpprdlgiral
msssrydraitvfspdghlLQVEYAQEAVRKGSTAVSFQVEVYLVssfrktglrvqstIKITLNNYLVMTKEIISLKVSPLLSQAQNSKLSMLNDHVVMAFAGKSLCLIALVALWYNEKDKTISVIYYGGKNSSalatelflrpprdlgiral
MSSSRYDRAITVFSPDGHLLQVEYAQEAVRKGSTAVSFQVEVYLVSSFRKTGLRVQSTIKITLNNYLVMTKEIISLKVSPLLSQAQNSKLSMLNDHVVMAFAGKSLCLIALVALWYNEKDKTISVIYYGGKNSSALATELFLRPPRDLGIRAL
********AITVFSPDGHLLQVEYAQEAVRKGSTAVSFQVEVYLVSSFRKTGLRVQSTIKITLNNYLVMTKEIISLKVSPLLSQAQNSKLSMLNDHVVMAFAGKSLCLIALVALWYNEKDKTISVIYY*************************
****RYDRAITVFSPDGHLLQVEYAQEAVRKGSTAVSFQVEVYLVSSFRKTGLRVQSTIKITLNNYLVMTKEI**************SKLSMLNDHVVMAFAGKSLCLIALVALWYNEKDKTISVIYYGGKNSSALATELFLRPPRDLGIRAL
********AITVFSPDGHLLQVEYAQEAVRKGSTAVSFQVEVYLVSSFRKTGLRVQSTIKITLNNYLVMTKEIISLKVSPLLSQAQNSKLSMLNDHVVMAFAGKSLCLIALVALWYNEKDKTISVIYYGGKNSSALATELFLRPPRDLGIRAL
****RYDRAITVFSPDGHLLQVEYAQEAVRKGSTAVSFQVEVYLVSSFRKTGLRVQSTIKITLNNYLVMTKEIISLKVSPLLSQAQNSKLSMLNDHVVMAFAGKSLCLIALVALWYNEKDKTISVIYYGGKNSSALATELFLRPPRDLGIRAL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSRYDRAITVFSPDGHLLQVEYAQEAVRKGSTAVSFQVEVYLVSSFRKTGLRVQSTIKITLNNYLVMTKEIISLKVSPLLSQAQNSKLSMLNDHVVMAFAGKSLCLIALVALWYNEKDKTISVIYYGGKNSSALATELFLRPPRDLGIRAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query153 2.2.26 [Sep-21-2011]
P22769 249 Proteasome subunit alpha yes N/A 0.496 0.305 0.504 5e-16
Q9CWH6 250 Proteasome subunit alpha yes N/A 0.496 0.304 0.485 3e-15
Q4R7D9 250 Proteasome subunit alpha N/A N/A 0.496 0.304 0.485 6e-15
Q27575 252 Proteasome subunit alpha no N/A 0.496 0.301 0.455 1e-14
Q95005 253 Proteasome subunit alpha yes N/A 0.483 0.292 0.445 2e-14
Q8TAA3 256 Proteasome subunit alpha yes N/A 0.490 0.292 0.48 3e-14
Q24178 249 Proteasome subunit alpha no N/A 0.496 0.305 0.485 4e-14
Q9PTW9 251 Proteasome subunit alpha N/A N/A 0.496 0.302 0.425 7e-14
O16811 247 Proteasome subunit alpha N/A N/A 0.490 0.303 0.495 2e-13
P34120 250 Proteasome subunit alpha yes N/A 0.503 0.308 0.423 2e-13
>sp|P22769|PSA71_DROME Proteasome subunit alpha type-7-1 OS=Drosophila melanogaster GN=Pros28.1 PE=1 SV=2 Back     alignment and function desciption
 Score = 83.6 bits (205), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 61/101 (60%), Gaps = 25/101 (24%)

Query: 3   SSRYDRAITVFSPDGHLLQVEYAQEAVRKGSTAVSFQVEVYLVSSFRKTGLRVQSTIKIT 62
           SSRYDRA+T+FSPDGHLLQVEYAQEAVRKGSTAV               G+R        
Sbjct: 2   SSRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAV---------------GVRGA------ 40

Query: 63  LNNYLVMTKEIISLKVSPLLSQAQNSKLSMLNDHVVMAFAG 103
             N +V+  E  S  V+ L    +  K+ ML++HVVMAFAG
Sbjct: 41  --NCVVLGVEKKS--VAQLQEDRKVRKICMLDNHVVMAFAG 77
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 4EC: .EC: 2EC: 5EC: .EC: 1
>sp|Q9CWH6|PSA7L_MOUSE Proteasome subunit alpha type-7-like OS=Mus musculus GN=Psma8 PE=2 SV=1 Back     alignment and function description
>sp|Q4R7D9|PSA7L_MACFA Proteasome subunit alpha type-7-like OS=Macaca fascicularis GN=PSMA7L PE=2 SV=1 Back     alignment and function description
>sp|Q27575|PSA73_DROME Proteasome subunit alpha type-7-1B OS=Drosophila melanogaster GN=Pros28.1B PE=2 SV=2 Back     alignment and function description
>sp|Q95005|PSA7_CAEEL Proteasome subunit alpha type-7 OS=Caenorhabditis elegans GN=pas-4 PE=1 SV=1 Back     alignment and function description
>sp|Q8TAA3|PSA7L_HUMAN Proteasome subunit alpha type-7-like OS=Homo sapiens GN=PSMA8 PE=1 SV=3 Back     alignment and function description
>sp|Q24178|PSA72_DROME Proteasome subunit alpha type-7-1A OS=Drosophila melanogaster GN=Pros28.1A PE=2 SV=2 Back     alignment and function description
>sp|Q9PTW9|PSA7_CARAU Proteasome subunit alpha type-7 OS=Carassius auratus GN=psma7 PE=2 SV=1 Back     alignment and function description
>sp|O16811|PSA71_DROVI Proteasome subunit alpha type-7-1 OS=Drosophila virilis GN=Pros28.1 PE=3 SV=1 Back     alignment and function description
>sp|P34120|PSA7_DICDI Proteasome subunit alpha type-7 OS=Dictyostelium discoideum GN=psmA7 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
242019386251 proteasome subunit alpha type 7-1, putat 0.509 0.310 0.533 3e-16
242019368251 proteasome subunit alpha type 7-1, putat 0.509 0.310 0.533 4e-16
342905781112 proteasome subunit alpha type 7-1 [Rhodn 0.509 0.696 0.466 2e-15
195569371251 Pros28.1A [Drosophila simulans] gi|46254 0.496 0.302 0.514 6e-15
46254536251 testes-specific alpha4-t1 proteasome sub 0.496 0.302 0.514 6e-15
195353903251 Pros28.1A [Drosophila sechellia] gi|4625 0.496 0.302 0.514 6e-15
195171089252 GL20413 [Drosophila persimilis] gi|19846 0.496 0.301 0.485 9e-15
46254562251 testes-specific alpha4-t1 proteasome sub 0.496 0.302 0.504 1e-14
390346995 262 PREDICTED: proteasome subunit alpha type 0.529 0.309 0.462 1e-14
427787541248 Putative 20s proteasome regulatory subun 0.509 0.314 0.475 1e-14
>gi|242019386|ref|XP_002430142.1| proteasome subunit alpha type 7-1, putative [Pediculus humanus corporis] gi|212515233|gb|EEB17404.1| proteasome subunit alpha type 7-1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 63/103 (61%), Gaps = 25/103 (24%)

Query: 1   MSSSRYDRAITVFSPDGHLLQVEYAQEAVRKGSTAVSFQVEVYLVSSFRKTGLRVQSTIK 60
           MSS+RYDRAITVFSPDGHLLQVEYAQEAVRKGSTAV               G+R Q    
Sbjct: 1   MSSARYDRAITVFSPDGHLLQVEYAQEAVRKGSTAV---------------GVRGQ---- 41

Query: 61  ITLNNYLVMTKEIISLKVSPLLSQAQNSKLSMLNDHVVMAFAG 103
               N +V+  E  S  V+ L       K+ +L+DHVVMAFAG
Sbjct: 42  ----NCVVLGVEKKS--VAKLQEDRTVRKICLLDDHVVMAFAG 78

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242019368|ref|XP_002430133.1| proteasome subunit alpha type 7-1, putative [Pediculus humanus corporis] gi|212515224|gb|EEB17395.1| proteasome subunit alpha type 7-1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|342905781|gb|AEL79174.1| proteasome subunit alpha type 7-1 [Rhodnius prolixus] Back     alignment and taxonomy information
>gi|195569371|ref|XP_002102683.1| Pros28.1A [Drosophila simulans] gi|46254538|gb|AAS86242.1| testes-specific alpha4-t1 proteasome subunit [Drosophila simulans] gi|46254540|gb|AAS86243.1| testes-specific alpha4-t1 proteasome subunit [Drosophila simulans] gi|46254542|gb|AAS86244.1| testes-specific alpha4-t1 proteasome subunit [Drosophila simulans] gi|46254544|gb|AAS86245.1| testes-specific alpha4-t1 proteasome subunit [Drosophila simulans] gi|46254546|gb|AAS86246.1| testes-specific alpha4-t1 proteasome subunit [Drosophila simulans] gi|194198610|gb|EDX12186.1| Pros28.1A [Drosophila simulans] Back     alignment and taxonomy information
>gi|46254536|gb|AAS86241.1| testes-specific alpha4-t1 proteasome subunit [Drosophila simulans] Back     alignment and taxonomy information
>gi|195353903|ref|XP_002043441.1| Pros28.1A [Drosophila sechellia] gi|46254570|gb|AAS86258.1| testes-specific alpha4-t1 proteasome subunit [Drosophila sechellia] gi|46254572|gb|AAS86259.1| testes-specific alpha4-t1 proteasome subunit [Drosophila sechellia] gi|194127582|gb|EDW49625.1| Pros28.1A [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195171089|ref|XP_002026343.1| GL20413 [Drosophila persimilis] gi|198461293|ref|XP_002138981.1| GA25111 [Drosophila pseudoobscura pseudoobscura] gi|194111245|gb|EDW33288.1| GL20413 [Drosophila persimilis] gi|198137295|gb|EDY69539.1| GA25111 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|46254562|gb|AAS86254.1| testes-specific alpha4-t1 proteasome subunit [Drosophila mauritiana] Back     alignment and taxonomy information
>gi|390346995|ref|XP_784666.3| PREDICTED: proteasome subunit alpha type-7-like isoform 2 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|427787541|gb|JAA59222.1| Putative 20s proteasome regulatory subunit alpha type psma7/pre6 [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
FB|FBgn0004066249 Prosalpha4 "Proteasome alpha4 0.549 0.337 0.460 7.9e-14
UNIPROTKB|F1SBA5250 PSMA8 "Proteasome subunit alph 0.640 0.392 0.407 1.2e-12
MGI|MGI:1920927250 Psma8 "proteasome (prosome, ma 0.640 0.392 0.416 1.2e-12
RGD|2323394163 LOC100363246 "proteasome alpha 0.640 0.601 0.416 1.2e-12
DICTYBASE|DDB_G0272831250 psmA7 "proteasome subunit alph 0.555 0.34 0.444 1.5e-12
UNIPROTKB|E2RF52250 PSMA8 "Proteasome subunit alph 0.640 0.392 0.407 1.5e-12
UNIPROTKB|Q8TAA3256 PSMA8 "Proteasome subunit alph 0.483 0.289 0.481 1.5e-12
FB|FBgn0017556252 Prosalpha4T2 "Proteasome alpha 0.549 0.333 0.438 2.4e-12
WB|WBGene00003925253 pas-4 [Caenorhabditis elegans 0.653 0.395 0.418 2.4e-12
UNIPROTKB|Q95005253 pas-4 "Proteasome subunit alph 0.653 0.395 0.418 2.4e-12
FB|FBgn0004066 Prosalpha4 "Proteasome alpha4 subunit" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 179 (68.1 bits), Expect = 7.9e-14, P = 7.9e-14
 Identities = 41/89 (46%), Positives = 60/89 (67%)

Query:     3 SSRYDRAITVFSPDGHLLQVEYAQEAVRKGSTAVSFQ-VEVYLVSSFRKTGLRVQSTIKI 61
             SSRYDRA+T+FSPDGHLLQVEYAQEAVRKGSTAV  +     ++   +K+  ++Q   K+
Sbjct:     2 SSRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKV 61

Query:    62 T----LNNYLVMTKEIISLKVSPLLSQAQ 86
                  L+N++VM    ++     ++++AQ
Sbjct:    62 RKICMLDNHVVMAFAGLTADARIMINRAQ 90
GO:0005839 "proteasome core complex" evidence=ISS
GO:0004175 "endopeptidase activity" evidence=ISS;NAS
GO:0006508 "proteolysis" evidence=NAS
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IEA;NAS
GO:0000502 "proteasome complex" evidence=NAS
GO:0019773 "proteasome core complex, alpha-subunit complex" evidence=IEA
GO:0004298 "threonine-type endopeptidase activity" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0006974 "response to DNA damage stimulus" evidence=IMP
UNIPROTKB|F1SBA5 PSMA8 "Proteasome subunit alpha type" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1920927 Psma8 "proteasome (prosome, macropain) subunit, alpha type, 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2323394 LOC100363246 "proteasome alpha 8 subunit-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0272831 psmA7 "proteasome subunit alpha type 7" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E2RF52 PSMA8 "Proteasome subunit alpha type" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TAA3 PSMA8 "Proteasome subunit alpha type-7-like" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0017556 Prosalpha4T2 "Proteasome alpha4 subunit, Testis-specific 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00003925 pas-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q95005 pas-4 "Proteasome subunit alpha type-7" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P22769PSA71_DROME3, ., 4, ., 2, 5, ., 10.50490.49670.3052yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.25.10.737
3rd Layer3.4.250.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
cd03755207 cd03755, proteasome_alpha_type_7, proteasome_alpha 1e-21
cd01911209 cd01911, proteasome_alpha, proteasome alpha subuni 3e-20
PRK03996 241 PRK03996, PRK03996, proteasome subunit alpha; Prov 5e-18
TIGR03633224 TIGR03633, arc_protsome_A, proteasome endopeptidas 3e-17
cd03756211 cd03756, proteasome_alpha_archeal, proteasome_alph 2e-16
pfam1058423 pfam10584, Proteasome_A_N, Proteasome subunit A N- 2e-11
smart0094823 smart00948, Proteasome_A_N, Proteasome subunit A N 5e-11
cd03753213 cd03753, proteasome_alpha_type_5, proteasome_alpha 6e-10
COG0638 236 COG0638, PRE1, 20S proteasome, alpha and beta subu 6e-10
cd03752213 cd03752, proteasome_alpha_type_4, proteasome_alpha 1e-08
cd03751212 cd03751, proteasome_alpha_type_3, proteasome_alpha 1e-08
cd03754215 cd03754, proteasome_alpha_type_6, proteasome_alpha 8e-08
cd03749211 cd03749, proteasome_alpha_type_1, proteasome_alpha 1e-07
PTZ00246 253 PTZ00246, PTZ00246, proteasome subunit alpha; Prov 9e-07
cd03750 227 cd03750, proteasome_alpha_type_2, proteasome_alpha 6e-06
>gnl|CDD|239724 cd03755, proteasome_alpha_type_7, proteasome_alpha_type_7 Back     alignment and domain information 
 Score = 85.9 bits (213), Expect = 1e-21
 Identities = 43/99 (43%), Positives = 53/99 (53%), Gaps = 27/99 (27%)

Query: 6   YDRAITVFSPDGHLLQVEYAQEAVRKGSTAVSFQVEVYLVSSFRKTGLRVQSTIKITLNN 65
           YDRAITVFSPDGHL QVEYAQEAVRKG+TAV               G+R +  + +    
Sbjct: 1   YDRAITVFSPDGHLFQVEYAQEAVRKGTTAV---------------GVRGKDCVVLG--- 42

Query: 66  YLVMTKEIISLKVSPLLSQAQNS-KLSMLNDHVVMAFAG 103
                   +  K    L   +   K+ ML+DHV +AFAG
Sbjct: 43  --------VEKKSVAKLQDPRTVRKICMLDDHVCLAFAG 73

The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each. Length = 207
>gnl|CDD|238892 cd01911, proteasome_alpha, proteasome alpha subunit Back     alignment and domain information
>gnl|CDD|235192 PRK03996, PRK03996, proteasome subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|163366 TIGR03633, arc_protsome_A, proteasome endopeptidase complex, archaeal, alpha subunit Back     alignment and domain information
>gnl|CDD|239725 cd03756, proteasome_alpha_archeal, proteasome_alpha_archeal Back     alignment and domain information
>gnl|CDD|204518 pfam10584, Proteasome_A_N, Proteasome subunit A N-terminal signature Back     alignment and domain information
>gnl|CDD|198016 smart00948, Proteasome_A_N, Proteasome subunit A N-terminal signature Add an annotation Back     alignment and domain information
>gnl|CDD|239722 cd03753, proteasome_alpha_type_5, proteasome_alpha_type_5 Back     alignment and domain information
>gnl|CDD|223711 COG0638, PRE1, 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|239721 cd03752, proteasome_alpha_type_4, proteasome_alpha_type_4 Back     alignment and domain information
>gnl|CDD|239720 cd03751, proteasome_alpha_type_3, proteasome_alpha_type_3 Back     alignment and domain information
>gnl|CDD|239723 cd03754, proteasome_alpha_type_6, proteasome_alpha_type_6 Back     alignment and domain information
>gnl|CDD|239718 cd03749, proteasome_alpha_type_1, proteasome_alpha_type_1 Back     alignment and domain information
>gnl|CDD|173491 PTZ00246, PTZ00246, proteasome subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|239719 cd03750, proteasome_alpha_type_2, proteasome_alpha_type_2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 153
KOG0863|consensus 264 100.0
KOG0183|consensus 249 100.0
KOG0178|consensus 249 99.98
KOG0184|consensus 254 99.97
KOG0176|consensus241 99.97
cd03750227 proteasome_alpha_type_2 proteasome_alpha_type_2. T 99.97
cd03752213 proteasome_alpha_type_4 proteasome_alpha_type_4. T 99.97
cd03751212 proteasome_alpha_type_3 proteasome_alpha_type_3. T 99.97
PTZ00246 253 proteasome subunit alpha; Provisional 99.97
cd03754215 proteasome_alpha_type_6 proteasome_alpha_type_6. T 99.97
cd03755207 proteasome_alpha_type_7 proteasome_alpha_type_7. T 99.97
cd03749211 proteasome_alpha_type_1 proteasome_alpha_type_1. T 99.97
PRK03996241 proteasome subunit alpha; Provisional 99.96
cd03756211 proteasome_alpha_archeal proteasome_alpha_archeal. 99.96
KOG0182|consensus 246 99.96
TIGR03633224 arc_protsome_A proteasome endopeptidase complex, a 99.96
cd03753213 proteasome_alpha_type_5 proteasome_alpha_type_5. T 99.95
cd01911209 proteasome_alpha proteasome alpha subunit. The 20S 99.95
KOG0181|consensus233 99.94
COG0638 236 PRE1 20S proteasome, alpha and beta subunits [Post 99.94
TIGR03691 228 20S_bact_alpha proteasome, alpha subunit, bacteria 99.71
cd03760197 proteasome_beta_type_4 proteasome beta type-4 subu 99.56
PF1058423 Proteasome_A_N: Proteasome subunit A N-terminal si 99.56
PF00227190 Proteasome: Proteasome subunit; InterPro: IPR00135 99.55
cd03759195 proteasome_beta_type_3 proteasome beta type-3 subu 99.51
cd03758193 proteasome_beta_type_2 proteasome beta type-2 subu 99.48
TIGR03690 219 20S_bact_beta proteasome, beta subunit, bacterial 99.47
cd03757 212 proteasome_beta_type_1 proteasome beta type-1 subu 99.43
cd03761188 proteasome_beta_type_5 proteasome beta type-5 subu 99.43
PTZ00488 247 Proteasome subunit beta type-5; Provisional 99.41
TIGR03634185 arc_protsome_B proteasome endopeptidase complex, a 99.38
cd01906182 proteasome_protease_HslV proteasome_protease_HslV. 99.35
cd01912189 proteasome_beta proteasome beta subunit. The 20S p 99.33
cd03765 236 proteasome_beta_bacterial Bacterial proteasome, be 99.32
cd03762188 proteasome_beta_type_6 proteasome beta type-6 subu 99.3
cd03764188 proteasome_beta_archeal Archeal proteasome, beta s 99.29
cd03763189 proteasome_beta_type_7 proteasome beta type-7 subu 99.24
PRK05456172 ATP-dependent protease subunit HslV; Provisional 98.91
cd01901164 Ntn_hydrolase The Ntn hydrolases (N-terminal nucle 98.86
cd01913171 protease_HslV Protease HslV and the ATPase/chapero 98.79
TIGR03692171 ATP_dep_HslV ATP-dependent protease HslVU, peptida 98.75
KOG0179|consensus 235 98.38
KOG0180|consensus204 97.89
KOG0185|consensus 256 97.58
KOG0177|consensus200 97.47
KOG0173|consensus 271 97.19
KOG0174|consensus 224 97.01
KOG0175|consensus 285 96.88
COG5405178 HslV ATP-dependent protease HslVU (ClpYQ), peptida 90.92
>KOG0863|consensus Back     alignment and domain information 
Probab=100.00  E-value=7.6e-37  Score=254.39  Aligned_cols=124  Identities=27%  Similarity=0.350  Sum_probs=116.7

Q ss_pred             CCCCCCCCcceeeCCCCcchhhHHHHHHHhcCCceEEeeeeeeeeecccccccccceeeccccCcEEEEEEEecccCCCC
Q psy13971          1 MSSSRYDRAITVFSPDGHLLQVEYAQEAVRKGSTAVSFQVEVYLVSSFRKTGLRVQSTIKITLNNYLVMTKEIISLKVSP   80 (153)
Q Consensus         1 m~~~~Yd~~~t~FsP~Grl~QvEYA~eAv~~G~t~Vgi~~~~~~~~~~~~~~~~~~~~~~~~~~~gvVla~ekk~~~~s~   80 (153)
                      ||+++||.++|+|||+|||+||||||||+++|+++||++++                       ++.||++.||  ..++
T Consensus         1 Mfrnqyd~d~t~wsPqGrl~QvEya~EavkqGsatVGLks~-----------------------thaVLvAl~r--~~se   55 (264)
T KOG0863|consen    1 MFRNQYDNDVTTWSPQGRLHQVEYAMEAVKQGSATVGLKSR-----------------------THAVLVALKR--AQSE   55 (264)
T ss_pred             CCcccccCceeEECCcceehHHHHHHHHHhcccceEeeccc-----------------------ceEEEeeecc--chhH
Confidence            99999999999999999999999999999999999999999                       9999999999  7788


Q ss_pred             cccccccCceEEecCcEEEEEeccHHHHHHHHHHHHhhhcC---------ceeeeeeeccchhhhhhhhcCCCCccceee
Q psy13971         81 LLSQAQNSKLSMLNDHVVMAFAGKSLCLIALVALWYNEKDK---------TISVIYYGGKNSSALATELFLRPPRDLGIR  151 (153)
Q Consensus        81 Ll~~~~~~KIf~I~~~i~~~~aG~~~D~~~Lv~~~r~ea~~---------~~~v~~~~~~~~~q~~t~~~~~rp~~~gi~  151 (153)
                      |.  .++.|||+||+|+++++||+++|++.|++|+|.||..         |+..+..-+.++.|..||+.|+|||||||.
T Consensus        56 Ls--s~QkKi~~iD~h~g~siAGLt~Darvl~~Ylr~ec~~~~~~~~r~~pv~rl~~~l~~k~q~~Tq~ygrRpYGVGll  133 (264)
T KOG0863|consen   56 LS--SHQKKIFKIDDHIGISIAGLTADARVLSRYLRQECLNSRFIYGRPLPVLRLVEDLGDKAQENTQRYGRRPYGVGLL  133 (264)
T ss_pred             HH--HhhheeEecccccceEEeccCcchHHHHHHHHHHHhhhhhccCCcccHHHHHHHHHHHHhhhhhhhCCccccceEE
Confidence            86  6889999999999999999999999999999999975         344567779999999999999999999986

>KOG0183|consensus Back     alignment and domain information
>KOG0178|consensus Back     alignment and domain information
>KOG0184|consensus Back     alignment and domain information
>KOG0176|consensus Back     alignment and domain information
>cd03750 proteasome_alpha_type_2 proteasome_alpha_type_2 Back     alignment and domain information
>cd03752 proteasome_alpha_type_4 proteasome_alpha_type_4 Back     alignment and domain information
>cd03751 proteasome_alpha_type_3 proteasome_alpha_type_3 Back     alignment and domain information
>PTZ00246 proteasome subunit alpha; Provisional Back     alignment and domain information
>cd03754 proteasome_alpha_type_6 proteasome_alpha_type_6 Back     alignment and domain information
>cd03755 proteasome_alpha_type_7 proteasome_alpha_type_7 Back     alignment and domain information
>cd03749 proteasome_alpha_type_1 proteasome_alpha_type_1 Back     alignment and domain information
>PRK03996 proteasome subunit alpha; Provisional Back     alignment and domain information
>cd03756 proteasome_alpha_archeal proteasome_alpha_archeal Back     alignment and domain information
>KOG0182|consensus Back     alignment and domain information
>TIGR03633 arc_protsome_A proteasome endopeptidase complex, archaeal, alpha subunit Back     alignment and domain information
>cd03753 proteasome_alpha_type_5 proteasome_alpha_type_5 Back     alignment and domain information
>cd01911 proteasome_alpha proteasome alpha subunit Back     alignment and domain information
>KOG0181|consensus Back     alignment and domain information
>COG0638 PRE1 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03691 20S_bact_alpha proteasome, alpha subunit, bacterial type Back     alignment and domain information
>cd03760 proteasome_beta_type_4 proteasome beta type-4 subunit Back     alignment and domain information
>PF10584 Proteasome_A_N: Proteasome subunit A N-terminal signature; InterPro: IPR000426 The proteasome (or macropain) (3 Back     alignment and domain information
>PF00227 Proteasome: Proteasome subunit; InterPro: IPR001353 ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins Back     alignment and domain information
>cd03759 proteasome_beta_type_3 proteasome beta type-3 subunit Back     alignment and domain information
>cd03758 proteasome_beta_type_2 proteasome beta type-2 subunit Back     alignment and domain information
>TIGR03690 20S_bact_beta proteasome, beta subunit, bacterial type Back     alignment and domain information
>cd03757 proteasome_beta_type_1 proteasome beta type-1 subunit Back     alignment and domain information
>cd03761 proteasome_beta_type_5 proteasome beta type-5 subunit Back     alignment and domain information
>PTZ00488 Proteasome subunit beta type-5; Provisional Back     alignment and domain information
>TIGR03634 arc_protsome_B proteasome endopeptidase complex, archaeal, beta subunit Back     alignment and domain information
>cd01906 proteasome_protease_HslV proteasome_protease_HslV Back     alignment and domain information
>cd01912 proteasome_beta proteasome beta subunit Back     alignment and domain information
>cd03765 proteasome_beta_bacterial Bacterial proteasome, beta subunit Back     alignment and domain information
>cd03762 proteasome_beta_type_6 proteasome beta type-6 subunit Back     alignment and domain information
>cd03764 proteasome_beta_archeal Archeal proteasome, beta subunit Back     alignment and domain information
>cd03763 proteasome_beta_type_7 proteasome beta type-7 subunit Back     alignment and domain information
>PRK05456 ATP-dependent protease subunit HslV; Provisional Back     alignment and domain information
>cd01901 Ntn_hydrolase The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>cd01913 protease_HslV Protease HslV and the ATPase/chaperone HslU are part of an ATP-dependent proteolytic system that is the prokaryotic homolog of the proteasome Back     alignment and domain information
>TIGR03692 ATP_dep_HslV ATP-dependent protease HslVU, peptidase subunit Back     alignment and domain information
>KOG0179|consensus Back     alignment and domain information
>KOG0180|consensus Back     alignment and domain information
>KOG0185|consensus Back     alignment and domain information
>KOG0177|consensus Back     alignment and domain information
>KOG0173|consensus Back     alignment and domain information
>KOG0174|consensus Back     alignment and domain information
>KOG0175|consensus Back     alignment and domain information
>COG5405 HslV ATP-dependent protease HslVU (ClpYQ), peptidase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
1iru_D 248 Crystal Structure Of The Mammalian 20s Proteasome A 2e-13
3une_C 248 Mouse Constitutive 20s Proteasome Length = 248 2e-13
3unb_C 248 Mouse Constitutive 20s Proteasome In Complex With P 2e-13
1fnt_D 254 Crystal Structure Of The 20s Proteasome From Yeast 3e-11
1g0u_C 243 A Gated Channel Into The Proteasome Core Particle L 3e-11
1ryp_D 241 Crystal Structure Of The 20s Proteasome From Yeast 4e-11
2ku1_A237 Dynamic Regulation Of Archaeal Proteasome Gate Open 5e-10
3jrm_A227 Crystal Structure Of Archaeal 20s Proteasome In Com 5e-10
1pma_A233 Proteasome From Thermoplasma Acidophilum Length = 2 5e-10
1j2p_A246 Alpha-Ring From The Proteasome From Archaeoglobus F 1e-09
3h4p_A 264 Proteasome 20s Core Particle From Methanocaldococcu 2e-09
1yar_A233 Structure Of Archeabacterial 20s Proteasome Mutant 4e-09
2ku2_A237 Dynamic Regulation Of Archaeal Proteasome Gate Open 2e-08
1yau_A233 Structure Of Archeabacterial 20s Proteasome- Pa26 C 2e-08
1j2q_A237 20s Proteasome In Complex With Calpain-inhibitor I 4e-08
3unb_D241 Mouse Constitutive 20s Proteasome In Complex With P 1e-07
1iru_E241 Crystal Structure Of The Mammalian 20s Proteasome A 7e-07
1vsy_E 250 Proteasome Activator Complex Length = 250 7e-07
4g4s_E 261 Structure Of Proteasome-Pba1-Pba2 Complex Length = 8e-07
1fnt_E 260 Crystal Structure Of The 20s Proteasome From Yeast 8e-07
2z5c_C 262 Crystal Structure Of A Novel Chaperone Complex For 9e-07
1g0u_D 241 A Gated Channel Into The Proteasome Core Particle L 9e-07
1z7q_C 258 Crystal Structure Of The 20s Proteasome From Yeast 4e-06
1g0u_B 245 A Gated Channel Into The Proteasome Core Particle L 4e-06
3unb_F 255 Mouse Constitutive 20s Proteasome In Complex With P 5e-06
1iru_G 254 Crystal Structure Of The Mammalian 20s Proteasome A 6e-06
1iru_F 263 Crystal Structure Of The Mammalian 20s Proteasome A 2e-05
3unb_E 263 Mouse Constitutive 20s Proteasome In Complex With P 2e-05
1ryp_C 244 Crystal Structure Of The 20s Proteasome From Yeast 2e-05
1ryp_E 242 Crystal Structure Of The 20s Proteasome From Yeast 3e-05
1iru_A246 Crystal Structure Of The Mammalian 20s Proteasome A 6e-05
3unb_G246 Mouse Constitutive 20s Proteasome In Complex With P 6e-05
1iru_C 261 Crystal Structure Of The Mammalian 20s Proteasome A 1e-04
3unb_B 261 Mouse Constitutive 20s Proteasome In Complex With P 1e-04
1g0u_F 248 A Gated Channel Into The Proteasome Core Particle L 1e-04
3oeu_F 242 Structure Of Yeast 20s Open-Gate Proteasome With Co 1e-04
1ryp_G 244 Crystal Structure Of The 20s Proteasome From Yeast 1e-04
1g0u_E234 A Gated Channel Into The Proteasome Core Particle L 2e-04
1fnt_F234 Crystal Structure Of The 20s Proteasome From Yeast 2e-04
4g4s_F235 Structure Of Proteasome-Pba1-Pba2 Complex Length = 2e-04
1fnt_G 287 Crystal Structure Of The 20s Proteasome From Yeast 2e-04
1z7q_G 288 Crystal Structure Of The 20s Proteasome From Yeast 2e-04
3sdi_E233 Structure Of Yeast 20s Open-Gate Proteasome With Co 3e-04
1ryp_F233 Crystal Structure Of The 20s Proteasome From Yeast 3e-04
>pdb|1IRU|D Chain D, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 248 Back     alignment and structure 
Iteration: 1

 Score = 71.2 bits (173), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 53/98 (54%), Gaps = 25/98 (25%)
Query: 6   YDRAITVFSPDGHLLQVEYAQEAVRKGSTAVSFQVEVYLVSSFRKTGLRVQSTIKITLNN 65
           YDRAITVFSPDGHL QVEYAQEAV+KGSTAV               G+R +  + + +  
Sbjct: 3   YDRAITVFSPDGHLFQVEYAQEAVKKGSTAV---------------GVRGRDIVVLGVEK 47
Query: 66  YLVMTKEIISLKVSPLLSQAQNSKLSMLNDHVVMAFAG 103
                       V+ L  +    K+  L+D+V MAFAG
Sbjct: 48  K----------SVAKLQDERTVRKICALDDNVCMAFAG 75
>pdb|3UNE|C Chain C, Mouse Constitutive 20s Proteasome Length = 248 Back     alignment and structure
>pdb|3UNB|C Chain C, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 248 Back     alignment and structure
>pdb|1FNT|D Chain D, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 254 Back     alignment and structure
>pdb|1G0U|C Chain C, A Gated Channel Into The Proteasome Core Particle Length = 243 Back     alignment and structure
>pdb|1RYP|D Chain D, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 241 Back     alignment and structure
>pdb|2KU1|A Chain A, Dynamic Regulation Of Archaeal Proteasome Gate Opening As Studied By Trosy-Nmr Length = 237 Back     alignment and structure
>pdb|3JRM|A Chain A, Crystal Structure Of Archaeal 20s Proteasome In Complex With Mutated P26 Activator Length = 227 Back     alignment and structure
>pdb|1PMA|A Chain A, Proteasome From Thermoplasma Acidophilum Length = 233 Back     alignment and structure
>pdb|1J2P|A Chain A, Alpha-Ring From The Proteasome From Archaeoglobus Fulgidus Length = 246 Back     alignment and structure
>pdb|3H4P|A Chain A, Proteasome 20s Core Particle From Methanocaldococcus Jannaschii Length = 264 Back     alignment and structure
>pdb|1YAR|A Chain A, Structure Of Archeabacterial 20s Proteasome Mutant D9s- Pa26 Complex Length = 233 Back     alignment and structure
>pdb|2KU2|A Chain A, Dynamic Regulation Of Archaeal Proteasome Gate Opening As Studied By Trosy-Nmr Length = 237 Back     alignment and structure
>pdb|1YAU|A Chain A, Structure Of Archeabacterial 20s Proteasome- Pa26 Complex Length = 233 Back     alignment and structure
>pdb|1J2Q|A Chain A, 20s Proteasome In Complex With Calpain-inhibitor I From Archaeoglobus Fulgidus Length = 237 Back     alignment and structure
>pdb|3UNB|D Chain D, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 241 Back     alignment and structure
>pdb|1IRU|E Chain E, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 241 Back     alignment and structure
>pdb|1VSY|E Chain E, Proteasome Activator Complex Length = 250 Back     alignment and structure
>pdb|4G4S|E Chain E, Structure Of Proteasome-Pba1-Pba2 Complex Length = 261 Back     alignment and structure
>pdb|1FNT|E Chain E, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 260 Back     alignment and structure
>pdb|2Z5C|C Chain C, Crystal Structure Of A Novel Chaperone Complex For Yeast 20s Proteasome Assembly Length = 262 Back     alignment and structure
>pdb|1G0U|D Chain D, A Gated Channel Into The Proteasome Core Particle Length = 241 Back     alignment and structure
>pdb|1Z7Q|C Chain C, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 258 Back     alignment and structure
>pdb|1G0U|B Chain B, A Gated Channel Into The Proteasome Core Particle Length = 245 Back     alignment and structure
>pdb|3UNB|F Chain F, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 255 Back     alignment and structure
>pdb|1IRU|G Chain G, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 254 Back     alignment and structure
>pdb|1IRU|F Chain F, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 263 Back     alignment and structure
>pdb|3UNB|E Chain E, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 263 Back     alignment and structure
>pdb|1RYP|C Chain C, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 244 Back     alignment and structure
>pdb|1RYP|E Chain E, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 242 Back     alignment and structure
>pdb|1IRU|A Chain A, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 246 Back     alignment and structure
>pdb|3UNB|G Chain G, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 246 Back     alignment and structure
>pdb|1IRU|C Chain C, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 261 Back     alignment and structure
>pdb|3UNB|B Chain B, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 261 Back     alignment and structure
>pdb|1G0U|F Chain F, A Gated Channel Into The Proteasome Core Particle Length = 248 Back     alignment and structure
>pdb|3OEU|F Chain F, Structure Of Yeast 20s Open-Gate Proteasome With Compound 24 Length = 242 Back     alignment and structure
>pdb|1RYP|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 244 Back     alignment and structure
>pdb|1G0U|E Chain E, A Gated Channel Into The Proteasome Core Particle Length = 234 Back     alignment and structure
>pdb|1FNT|F Chain F, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 234 Back     alignment and structure
>pdb|4G4S|F Chain F, Structure Of Proteasome-Pba1-Pba2 Complex Length = 235 Back     alignment and structure
>pdb|1FNT|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 287 Back     alignment and structure
>pdb|1Z7Q|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 288 Back     alignment and structure
>pdb|3SDI|E Chain E, Structure Of Yeast 20s Open-Gate Proteasome With Compound 20 Length = 233 Back     alignment and structure
>pdb|1RYP|F Chain F, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 233 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
1iru_E 241 20S proteasome; cell cycle, immune response, prote 4e-23
1iru_F 263 20S proteasome; cell cycle, immune response, prote 4e-23
1iru_B 233 20S proteasome; cell cycle, immune response, prote 7e-23
3nzj_F 288 Proteasome component C1; ubiquitin, protein degrad 1e-22
1ryp_B 250 20S proteasome; multicatalytic proteinase, protein 8e-22
1iru_D 248 20S proteasome; cell cycle, immune response, prote 3e-21
1ryp_G 244 20S proteasome; multicatalytic proteinase, protein 4e-21
1iru_A 246 20S proteasome; cell cycle, immune response, prote 4e-20
1ryp_A 243 20S proteasome; multicatalytic proteinase, protein 4e-19
1iru_G 254 20S proteasome; cell cycle, immune response, prote 1e-17
3h4p_A 264 Proteasome subunit alpha; core particle, cytoplasm 1e-17
1j2p_A 246 Alpha-ring, proteasome alpha subunit; hydrolase; 2 5e-17
1yar_A 233 Proteasome alpha subunit; proteasome 20S, PA26 pro 8e-17
1ryp_D 241 20S proteasome; multicatalytic proteinase, protein 1e-16
1ryp_F 233 20S proteasome; multicatalytic proteinase, protein 4e-16
1iru_C 261 20S proteasome; cell cycle, immune response, prote 1e-15
1ryp_E 242 20S proteasome; multicatalytic proteinase, protein 3e-15
1ryp_C 244 20S proteasome; multicatalytic proteinase, protein 7e-15
>1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D Length = 241 Back     alignment and structure
 Score = 90.3 bits (225), Expect = 4e-23
 Identities = 28/105 (26%), Positives = 47/105 (44%), Gaps = 29/105 (27%)

Query: 1   MSSSRYDRAITVFSPDGHLLQVEYAQEAVRKGSTAVSFQVEVYLVSSFRKTGLRVQSTIK 60
           ++ S YDR +  FSP+G L QVEY  EA++ GSTA+               G++      
Sbjct: 3   LTRSEYDRGVNTFSPEGRLFQVEYDIEAIKLGSTAI---------------GIQT----- 42

Query: 61  ITLNNYLVMTKEIISLK--VSPLLSQAQNSKLSMLNDHVVMAFAG 103
              +  +     +   K   SPL+  +   K+  ++ H+  A +G
Sbjct: 43  ---SEGVC----LAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSG 80
>1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E Length = 263 Back     alignment and structure
>1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Length = 233 Back     alignment and structure
>3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 3bdm_F* 1fnt_G* 2zcy_F* Length = 288 Back     alignment and structure
>1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... Length = 250 Back     alignment and structure
>1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* Length = 248 Back     alignment and structure
>1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Length = 244 Back     alignment and structure
>1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G Length = 246 Back     alignment and structure
>1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... Length = 243 Back     alignment and structure
>1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Length = 254 Back     alignment and structure
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Length = 264 Back     alignment and structure
>1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Length = 246 Back     alignment and structure
>1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Length = 233 Back     alignment and structure
>1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... Length = 241 Back     alignment and structure
>1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... Length = 233 Back     alignment and structure
>1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B Length = 261 Back     alignment and structure
>1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Length = 242 Back     alignment and structure
>1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Length = 244 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query153
1yar_A233 Proteasome alpha subunit; proteasome 20S, PA26 pro 99.98
1j2p_A 246 Alpha-ring, proteasome alpha subunit; hydrolase; 2 99.98
1ryp_A 243 20S proteasome; multicatalytic proteinase, protein 99.97
1ryp_F233 20S proteasome; multicatalytic proteinase, protein 99.97
1iru_E241 20S proteasome; cell cycle, immune response, prote 99.97
3h4p_A 264 Proteasome subunit alpha; core particle, cytoplasm 99.97
1iru_F 263 20S proteasome; cell cycle, immune response, prote 99.97
1iru_B233 20S proteasome; cell cycle, immune response, prote 99.97
1iru_A 246 20S proteasome; cell cycle, immune response, prote 99.97
1ryp_C 244 20S proteasome; multicatalytic proteinase, protein 99.97
1iru_D 248 20S proteasome; cell cycle, immune response, prote 99.97
1iru_G 254 20S proteasome; cell cycle, immune response, prote 99.97
1iru_C 261 20S proteasome; cell cycle, immune response, prote 99.97
1ryp_D 241 20S proteasome; multicatalytic proteinase, protein 99.97
1ryp_G 244 20S proteasome; multicatalytic proteinase, protein 99.97
3nzj_F 288 Proteasome component C1; ubiquitin, protein degrad 99.97
1ryp_B 250 20S proteasome; multicatalytic proteinase, protein 99.97
1ryp_E 242 20S proteasome; multicatalytic proteinase, protein 99.96
1q5q_A 259 Proteasome alpha-type subunit 1; proteasome assemb 99.83
3mi0_A 248 Proteasome subunit alpha; enzyme inhibitors, lacto 99.74
1iru_N 219 20S proteasome; cell cycle, immune response, prote 99.58
2jay_A 291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberc 99.57
1yar_H 217 Proteasome beta subunit; proteasome 20S, PA26 prot 99.56
1q5r_H 294 Proteasome beta-type subunit 1; proteasome assembl 99.55
2z3b_A180 ATP-dependent protease HSLV; N-terminal nucleophIl 99.53
1iru_M 213 20S proteasome; cell cycle, immune response, prote 99.53
1ryp_N 233 20S proteasome; multicatalytic proteinase, protein 99.51
1g0u_M 266 Proteasome component PRE4; ubiquitin, degradation, 99.5
1iru_J205 20S proteasome; cell cycle, immune response, prote 99.48
3nzj_H 261 Proteasome component PUP1; ubiquitin, protein degr 99.47
1ryp_H205 20S proteasome; multicatalytic proteinase, protein 99.47
1ryp_J204 20S proteasome; multicatalytic proteinase, protein 99.46
1m4y_A171 ATP-dependent protease HSLV; N-terminal catalytic 99.46
3nzj_K 287 Proteasome component PRE2; ubiquitin, protein degr 99.46
1j2q_H 202 Proteasome beta subunit; ubiquitin, CP, hydrolase; 99.45
1g3k_A174 ATP-dependent protease HSLV; hydrolase; 1.90A {Hae 99.45
1ryp_K198 20S proteasome; multicatalytic proteinase, protein 99.42
1ryp_M 222 20S proteasome; multicatalytic proteinase, protein 99.42
1iru_H 205 20S proteasome; cell cycle, immune response, prote 99.42
3h4p_a 219 Proteasome subunit beta; core particle, cytoplasm, 99.41
1iru_K 201 20S proteasome; cell cycle, immune response, prote 99.4
1q5q_H 235 Proteasome beta-type subunit 1; proteasome assembl 99.4
1ryp_L 212 20S proteasome; multicatalytic proteinase, protein 99.37
3unf_N 199 Proteasome subunit beta type-9; antigen presentati 99.35
1iru_L 204 20S proteasome; cell cycle, immune response, prote 99.33
1ryp_I 222 20S proteasome; multicatalytic proteinase, protein 99.29
1iru_I 234 20S proteasome; cell cycle, immune response, prote 99.25
3unf_H 234 Proteasome subunit beta type-10; antigen presentat 99.24
>1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Back     alignment and structure
Probab=99.98  E-value=4.2e-33  Score=223.99  Aligned_cols=125  Identities=30%  Similarity=0.373  Sum_probs=100.8

Q ss_pred             CCCCCCCCcceeeCCCCcchhhHHHHHHHhcCCceEEeeeeeeeeecccccccccceeeccccCcEEEEEEEecccCCCC
Q psy13971          1 MSSSRYDRAITVFSPDGHLLQVEYAQEAVRKGSTAVSFQVEVYLVSSFRKTGLRVQSTIKITLNNYLVMTKEIISLKVSP   80 (153)
Q Consensus         1 m~~~~Yd~~~t~FsP~Grl~QvEYA~eAv~~G~t~Vgi~~~~~~~~~~~~~~~~~~~~~~~~~~~gvVla~ekk~~~~s~   80 (153)
                      |++++||+++|+|||||||||||||+||+++|+|+|||+++                       ||||||+++|  .+++
T Consensus         3 m~~~~yd~~~t~fsp~Grl~QvEya~~av~~Gtt~vgi~~~-----------------------dgVvlaaD~r--~~~~   57 (233)
T 1yar_A            3 QGQMAYSRAITVFSPDGRLFQVEYAREAVKKGSTALGMKFA-----------------------NGVLLISDKK--VRSR   57 (233)
T ss_dssp             ----------CCCCTTSCCHHHHHHHHHHTTSCCEEEEEET-----------------------TEEEEEECCC--CCCT
T ss_pred             cccccCCCCCceECcCCeeHHHHhHHHHHhcCCcEEEEEEC-----------------------CEEEEEEecc--CCcc
Confidence            67789999999999999999999999999999999999999                       9999999999  7788


Q ss_pred             cccccccCceEEecCcEEEEEeccHHHHHHHHHHHHhhhcC-------ceee--eeeeccchhhhhhhhcCCCCcccee
Q psy13971         81 LLSQAQNSKLSMLNDHVVMAFAGKSLCLIALVALWYNEKDK-------TISV--IYYGGKNSSALATELFLRPPRDLGI  150 (153)
Q Consensus        81 Ll~~~~~~KIf~I~~~i~~~~aG~~~D~~~Lv~~~r~ea~~-------~~~v--~~~~~~~~~q~~t~~~~~rp~~~gi  150 (153)
                      ++.....+|||+|++||++++||..+|++.|++++|.++..       ++++  +...+++.+|..+|..+.||+++++
T Consensus        58 ~~~~~~~~Ki~~i~~~i~~~~aG~~aD~~~l~~~~~~~~~~~~~~~~~~~~v~~~a~~l~~~~~~~~~~~~~rp~~v~~  136 (233)
T 1yar_A           58 LIEQNSIEKIQLIDDYVAAVTSGLVADARVLVDFARISAQQEKVTYGSLVNIENLVKRVADQMQQYTQYGGVRPYGVSL  136 (233)
T ss_dssp             TBCSTTCCSEEEEETTEEEEEEEBHHHHHHHHHHHHHHHHHHHHHHSSCCCHHHHHHHHHHHHHHTTTBTTBCCCCEEE
T ss_pred             cccccccCeEEEecCCEEEEEeeCHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHhcCcCCcCcceEEE
Confidence            88778899999999999999999999999999999998764       2222  3333556677778877888888875
>1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Back     alignment and structure
>1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... Back     alignment and structure
>1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... Back     alignment and structure
>1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D Back     alignment and structure
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E Back     alignment and structure
>1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Back     alignment and structure
>1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G Back     alignment and structure
>1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Back     alignment and structure
>1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* Back     alignment and structure
>1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Back     alignment and structure
>1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B Back     alignment and structure
>1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... Back     alignment and structure
>1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Back     alignment and structure
>3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 4b4t_G 4g4s_G* 3bdm_F* 1fnt_G* 2zcy_F* Back     alignment and structure
>1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... Back     alignment and structure
>1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Back     alignment and structure
>1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Back     alignment and structure
>3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} SCOP: d.153.1.4 PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Back     alignment and structure
>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Back     alignment and structure
>1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Back     alignment and structure
>1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Back     alignment and structure
>2z3b_A ATP-dependent protease HSLV; N-terminal nucleophIle hydrolase; 2.50A {Bacillus subtilis} SCOP: d.153.1.4 PDB: 2z3a_A 1yyf_D* 3ty6_A Back     alignment and structure
>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Back     alignment and structure
>1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Back     alignment and structure
>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Back     alignment and structure
>1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Back     alignment and structure
>3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* 4b4t_2 Back     alignment and structure
>1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Back     alignment and structure
>1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Back     alignment and structure
>1m4y_A ATP-dependent protease HSLV; N-terminal catalytic threonine residue, hydrolase; 2.10A {Thermotoga maritima} SCOP: d.153.1.4 Back     alignment and structure
>3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* 4b4t_5 Back     alignment and structure
>1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Back     alignment and structure
>1g3k_A ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophilus influenzae} SCOP: d.153.1.4 PDB: 1g3i_G 1jjw_A 1kyi_G* 1ofh_G* 1ofi_G* 1e94_A* 1g4a_B* 1g4b_M 1hqy_A* 1ht1_C* 1ht2_A* 1ned_A Back     alignment and structure
>1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Back     alignment and structure
>1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Back     alignment and structure
>1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Back     alignment and structure
>3h4p_a Proteasome subunit beta; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Back     alignment and structure
>1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Back     alignment and structure
>1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Back     alignment and structure
>3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Back     alignment and structure
>1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Back     alignment and structure
>3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 153
d1irua_ 244 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 1e-17
d1rypf_ 233 d.153.1.4 (F:) Proteasome alpha subunit (non-catal 5e-17
d1iruc_250 d.153.1.4 (C:) Proteasome alpha subunit (non-catal 7e-17
d1rypb_250 d.153.1.4 (B:) Proteasome alpha subunit (non-catal 8e-17
d1rypc_244 d.153.1.4 (C:) Proteasome alpha subunit (non-catal 2e-16
d1irug_ 245 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 2e-16
d1rypg_ 244 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 4e-16
d1iruf_ 238 d.153.1.4 (F:) Proteasome alpha subunit (non-catal 4e-16
d1irud_ 243 d.153.1.4 (D:) Proteasome alpha subunit (non-catal 7e-16
d1irue_ 234 d.153.1.4 (E:) Proteasome alpha subunit (non-catal 1e-15
d1rype_ 242 d.153.1.4 (E:) Proteasome alpha subunit (non-catal 2e-15
d1irub_233 d.153.1.4 (B:) Proteasome alpha subunit (non-catal 2e-15
d1rypa_ 243 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 2e-15
d1j2pa_ 243 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 3e-15
d1rypd_ 241 d.153.1.4 (D:) Proteasome alpha subunit (non-catal 7e-15
d1yara1221 d.153.1.4 (A:13-233) Proteasome alpha subunit (non 2e-11
>d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 244 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ntn hydrolase-like
superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases)
family: Proteasome subunits
domain: Proteasome alpha subunit (non-catalytic)
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 74.6 bits (183), Expect = 1e-17
 Identities = 23/102 (22%), Positives = 43/102 (42%), Gaps = 24/102 (23%)

Query: 2   SSSRYDRAITVFSPDGHLLQVEYAQEAVRKGSTAVSFQVEVYLVSSFRKTGLRVQSTIKI 61
           SS+ +DR IT+FSP+G L QVEYA +A+ +G                        +++ +
Sbjct: 4   SSAGFDRHITIFSPEGRLYQVEYAFKAINQGGL----------------------TSVAV 41

Query: 62  TLNNYLVMTKEIISLKVSPLLSQAQNSKLSMLNDHVVMAFAG 103
              +  V+  +        LL  +  + L  + +++     G
Sbjct: 42  RGKDCAVIVTQ--KKVPDKLLDSSTVTHLFKITENIGCVMTG 81
>d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 250 Back     information, alignment and structure
>d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 250 Back     information, alignment and structure
>d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 245 Back     information, alignment and structure
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure
>d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 238 Back     information, alignment and structure
>d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 243 Back     information, alignment and structure
>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 234 Back     information, alignment and structure
>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 242 Back     information, alignment and structure
>d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 233 Back     information, alignment and structure
>d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 243 Back     information, alignment and structure
>d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 243 Back     information, alignment and structure
>d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 241 Back     information, alignment and structure
>d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 221 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query153
d1rypf_233 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1iruc_ 250 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1irug_ 245 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.98
d1irua_ 244 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.98
d1iruf_ 238 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.97
d1rypb_ 250 Proteasome alpha subunit (non-catalytic) {Baker's 99.97
d1rypg_ 244 Proteasome alpha subunit (non-catalytic) {Baker's 99.97
d1irud_ 243 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.97
d1j2pa_ 243 Proteasome alpha subunit (non-catalytic) {Archaeon 99.97
d1rypa_ 243 Proteasome alpha subunit (non-catalytic) {Baker's 99.97
d1rypd_ 241 Proteasome alpha subunit (non-catalytic) {Baker's 99.97
d1irue_234 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.97
d1rypc_ 244 Proteasome alpha subunit (non-catalytic) {Baker's 99.97
d1irub_233 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.97
d1yara1221 Proteasome alpha subunit (non-catalytic) {Archaeon 99.96
d1rype_ 242 Proteasome alpha subunit (non-catalytic) {Baker's 99.96
d1q5qa_ 227 Proteasome alpha subunit (non-catalytic) {Rhodococ 99.77
d1ryp2_ 233 Proteasome beta subunit (catalytic) {Baker's yeast 99.44
d1ryp1_ 222 Proteasome beta subunit (catalytic) {Baker's yeast 99.43
d1rypk_198 Proteasome beta subunit (catalytic) {Baker's yeast 99.41
d1iruj_204 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.38
d1yarh1 203 Proteasome beta subunit (catalytic) {Archaeon Ther 99.37
d1iru2_ 217 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.36
d1j2qh_202 Proteasome beta subunit (catalytic) {Archaeon Arch 99.34
d1iru1_ 213 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.33
d1ryph_205 Proteasome beta subunit (catalytic) {Baker's yeast 99.3
d1iruk_199 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.27
d1rypj_204 Proteasome beta subunit (catalytic) {Baker's yeast 99.27
d1irul_ 201 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.22
d1rypl_ 212 Proteasome beta subunit (catalytic) {Baker's yeast 99.21
d1iruh_ 202 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.18
d1q5qh_ 224 Proteasome beta subunit (catalytic) {Rhodococcus e 99.1
d1rypi_ 222 Proteasome beta subunit (catalytic) {Baker's yeast 99.09
d1irui_ 220 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.05
d2z3ba1180 HslV (ClpQ) protease {Bacillus subtilis [TaxId: 14 98.36
d1m4ya_171 HslV (ClpQ) protease {Thermotoga maritima [TaxId: 98.26
d1g3ka_173 HslV (ClpQ) protease {Haemophilus influenzae [TaxI 97.91
>d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ntn hydrolase-like
superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases)
family: Proteasome subunits
domain: Proteasome alpha subunit (non-catalytic)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=8e-34  Score=227.35  Aligned_cols=123  Identities=22%  Similarity=0.273  Sum_probs=109.0

Q ss_pred             CCCCCCCcceeeCCCCcchhhHHHHHHHhcCCceEEeeeeeeeeecccccccccceeeccccCcEEEEEEEecccCCCCc
Q psy13971          2 SSSRYDRAITVFSPDGHLLQVEYAQEAVRKGSTAVSFQVEVYLVSSFRKTGLRVQSTIKITLNNYLVMTKEIISLKVSPL   81 (153)
Q Consensus         2 ~~~~Yd~~~t~FsP~Grl~QvEYA~eAv~~G~t~Vgi~~~~~~~~~~~~~~~~~~~~~~~~~~~gvVla~ekk~~~~s~L   81 (153)
                      |+++||+++|+|||||||+|||||+||+++|+|+||++++                       ||||||++++  .++++
T Consensus         1 ~~~~yd~~~t~FspdGrl~QvEyA~kav~~g~t~igi~~~-----------------------dgvvlaad~~--~~~~l   55 (233)
T d1rypf_           1 FRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSN-----------------------THAVLVALKR--NADEL   55 (233)
T ss_dssp             CHHHHSSCTTCCCTTSCCHHHHHHHHHHHTSCCEEEEECS-----------------------SEEEEEEECC--CSSTT
T ss_pred             CCccccCCCceECCCCcChHHHHHHHHHHcCCCEEEEEEC-----------------------CeEEEEEecc--ccccC
Confidence            5689999999999999999999999999999999999999                       9999999999  77776


Q ss_pred             ccccccCceEEecCcEEEEEeccHHHHHHHHHHHHhhhcC-------c--eeeeeeeccchhhhhhhhcCCCCccceee
Q psy13971         82 LSQAQNSKLSMLNDHVVMAFAGKSLCLIALVALWYNEKDK-------T--ISVIYYGGKNSSALATELFLRPPRDLGIR  151 (153)
Q Consensus        82 l~~~~~~KIf~I~~~i~~~~aG~~~D~~~Lv~~~r~ea~~-------~--~~v~~~~~~~~~q~~t~~~~~rp~~~gi~  151 (153)
                      .  ...+|||.||+|++++++|+.+|++.|++++|.++..       .  +..+...+++..|..||..+.||+++++.
T Consensus        56 ~--~~~~KI~~I~~~i~~~~sG~~~D~~~l~~~~r~~~~~~~~~~~~~i~~~~la~~l~~~~~~~t~~~~~RP~gv~~i  132 (233)
T d1rypf_          56 S--SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVGLL  132 (233)
T ss_dssp             B--CCCCCEEEEETTEEEEEEECHHHHHHHHHHHHHHHHHHHHHHSCCCCHHHHHHHHHHHHHHHHHBTTCCCCCEEEE
T ss_pred             C--cchheEEEcCCCEEEEEeeccccHHHHHHHHHHHHHhhhhhcCCCCcHHHHHHHHHHHHHHHhcccccCCccceEE
Confidence            4  5678999999999999999999999999999998864       2  23345557778888899999999998763
>d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure