Psyllid ID: psy14038

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
TLYFILFYSILFYSVLFYSILRLSPWATYVTEPPVVGHAYEQRIWNPKPQDKHKWTSSKPKKPDNLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGYNAVQLMAIMEHAYYASFGYQVTSFFAASSR
ccEEEEEEEEEEEccccEEEEEccccEEEEEEcccccccEEccEEcccHHHHHHHHccccccccccEEEEEEccccccccccccHHHHHHHHHHHHHHccccEEEEccccccccccccccccccccccccc
cEEEEEEEEEEEEEcccccEccccHHHHEEEccccccccccEEEEcccccccEEEcccccccccccEEEEEEEcccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccEEEcEEEcccc
TLYFILFYSILFYSVLFYSILrlspwatyvteppvvghayeqriwnpkpqdkhkwtsskpkkpdnlkiyESHVgictqeqkcasyeDFVRVVIPRIVKQGYNAVQLMAIMEHAYYASFGYQVTSFFAASSR
TLYFILFYSILFYSVLFYSILRLSPWATYVTEPPVVGHAYEQRIwnpkpqdkhkwtsskpkkpdnlKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGYNAVQLMAIMEHAYYASFGYQVTSFFAASSR
TLYFILFYSILFYSVLFYSILRLSPWATYVTEPPVVGHAYEQRIWNPKPQDKHKWTSSKPKKPDNLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGYNAVQLMAIMEHAYYASFGYQVTSFFAASSR
*LYFILFYSILFYSVLFYSILRLSPWATYVTEPPVVGHAYEQRIWN*******************LKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGYNAVQLMAIMEHAYYASFGYQVTSFFA****
TLYFILFYSILFYSVLFYSILRLSPWATYVTEPPVVGHAYEQRIWNPKPQDKHKW******KPDNLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGYNAVQLMAIMEHAYYASFGYQVTSFFAASSR
TLYFILFYSILFYSVLFYSILRLSPWATYVTEPPVVGHAYEQRIWNPK************KKPDNLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGYNAVQLMAIMEHAYYASFGYQVTSFFAASSR
TLYFILFYSILFYSVLFYSILRLSPWATYVTEPPVVGHAYEQRIWNPKPQDKHKWTSSKPKKPDNLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGYNAVQLMAIMEHAYYASFGYQVTSFFAAS**
oooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TLYFILFYSILFYSVLFYSILRLSPWATYVTEPPVVGHAYEQRIWNPKPQDKHKWTSSKPKKPDNLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGYNAVQLMAIMEHAYYASFGYQVTSFFAASSR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query131 2.2.26 [Sep-21-2011]
Q96VA4 689 1,4-alpha-glucan-branchin yes N/A 0.854 0.162 0.535 1e-30
Q6CCT1 691 1,4-alpha-glucan-branchin yes N/A 0.839 0.159 0.527 2e-30
Q8NKE1 683 1,4-alpha-glucan-branchin N/A N/A 0.839 0.161 0.571 1e-29
Q6BXN1 711 1,4-alpha-glucan-branchin yes N/A 0.847 0.156 0.543 2e-29
Q9Y8H3 684 1,4-alpha-glucan-branchin yes N/A 0.854 0.163 0.508 2e-29
Q9D6Y9 702 1,4-alpha-glucan-branchin yes N/A 0.824 0.153 0.592 3e-29
Q6T308 699 1,4-alpha-glucan-branchin N/A N/A 0.824 0.154 0.575 2e-28
Q6EAS5 699 1,4-alpha-glucan-branchin yes N/A 0.824 0.154 0.566 2e-28
Q04446 702 1,4-alpha-glucan-branchin yes N/A 0.824 0.153 0.575 6e-28
P32775 704 1,4-alpha-glucan-branchin yes N/A 0.839 0.156 0.533 9e-28
>sp|Q96VA4|GLGB_ASPOR 1,4-alpha-glucan-branching enzyme OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gbeA PE=2 SV=1 Back     alignment and function desciption
 Score =  131 bits (330), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 60/112 (53%), Positives = 80/112 (71%)

Query: 20  ILRLSPWATYVTEPPVVGHAYEQRIWNPKPQDKHKWTSSKPKKPDNLKIYESHVGICTQE 79
           I R+  W   V +   V   YE   WNP  + ++K+  S+PK+P++L+IYE+HVGI + E
Sbjct: 139 IYRIPAWIKRVVQDLSVSPTYEAVFWNPPTEKQYKFQYSRPKRPESLRIYEAHVGISSPE 198

Query: 80  QKCASYEDFVRVVIPRIVKQGYNAVQLMAIMEHAYYASFGYQVTSFFAASSR 131
            K A+Y++F   ++PRI   GYNA+QLMAIMEHAYYASFGYQV +FFAASSR
Sbjct: 199 TKVATYKEFTSNMLPRIKYLGYNAIQLMAIMEHAYYASFGYQVNNFFAASSR 250

Aspergillus oryzae (strain ATCC 42149 / RIB 40) (taxid: 510516)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 8
>sp|Q6CCT1|GLGB_YARLI 1,4-alpha-glucan-branching enzyme OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GLC3 PE=3 SV=1 Back     alignment and function description
>sp|Q8NKE1|GLGB_GLOIN 1,4-alpha-glucan-branching enzyme OS=Glomus intraradices GN=GLC3 PE=2 SV=1 Back     alignment and function description
>sp|Q6BXN1|GLGB_DEBHA 1,4-alpha-glucan-branching enzyme OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GLC3 PE=3 SV=1 Back     alignment and function description
>sp|Q9Y8H3|GLGB_EMENI 1,4-alpha-glucan-branching enzyme OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=be1 PE=2 SV=3 Back     alignment and function description
>sp|Q9D6Y9|GLGB_MOUSE 1,4-alpha-glucan-branching enzyme OS=Mus musculus GN=Gbe1 PE=2 SV=1 Back     alignment and function description
>sp|Q6T308|GLGB_FELCA 1,4-alpha-glucan-branching enzyme OS=Felis catus GN=GBE1 PE=2 SV=1 Back     alignment and function description
>sp|Q6EAS5|GLGB_HORSE 1,4-alpha-glucan-branching enzyme OS=Equus caballus GN=GBE1 PE=2 SV=1 Back     alignment and function description
>sp|Q04446|GLGB_HUMAN 1,4-alpha-glucan-branching enzyme OS=Homo sapiens GN=GBE1 PE=1 SV=3 Back     alignment and function description
>sp|P32775|GLGB_YEAST 1,4-alpha-glucan-branching enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLC3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
340720425 669 PREDICTED: 1,4-alpha-glucan-branching en 0.839 0.164 0.663 1e-36
350410058 692 PREDICTED: 1,4-alpha-glucan-branching en 0.839 0.158 0.663 2e-36
380026836 694 PREDICTED: LOW QUALITY PROTEIN: 1,4-alph 0.839 0.158 0.672 2e-36
383863554 692 PREDICTED: 1,4-alpha-glucan-branching en 0.839 0.158 0.654 5e-35
321455046 696 hypothetical protein DAPPUDRAFT_302911 [ 0.824 0.155 0.657 6e-35
91076104 692 PREDICTED: similar to GA17312-PA [Tribol 0.839 0.158 0.639 7e-35
322785359 691 hypothetical protein SINV_12923 [Solenop 0.824 0.156 0.633 1e-33
332023850 697 1,4-alpha-glucan-branching enzyme [Acrom 0.824 0.154 0.633 5e-33
195066006 690 GH24987 [Drosophila grimshawi] gi|193896 0.839 0.159 0.575 7e-33
307197707 596 1,4-alpha-glucan-branching enzyme [Harpe 0.839 0.184 0.660 1e-32
>gi|340720425|ref|XP_003398639.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like [Bombus terrestris] Back     alignment and taxonomy information
 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 73/110 (66%), Positives = 89/110 (80%)

Query: 22  RLSPWATYVTEPPVVGHAYEQRIWNPKPQDKHKWTSSKPKKPDNLKIYESHVGICTQEQK 81
           RLSPWATYVT+       Y+QRIW+P  ++ +K+  SKPKKP++L+IYE HVGI TQE K
Sbjct: 146 RLSPWATYVTQNRAESVTYKQRIWHPSSENVYKFKYSKPKKPESLRIYECHVGIATQELK 205

Query: 82  CASYEDFVRVVIPRIVKQGYNAVQLMAIMEHAYYASFGYQVTSFFAASSR 131
             +Y +F   +IPRIV+QGYNA+QLMAIMEHAYYASFGYQVTSF+AASSR
Sbjct: 206 VGTYLEFAEKIIPRIVRQGYNAIQLMAIMEHAYYASFGYQVTSFYAASSR 255

Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350410058|ref|XP_003488932.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380026836|ref|XP_003697146.1| PREDICTED: LOW QUALITY PROTEIN: 1,4-alpha-glucan-branching enzyme-like [Apis florea] Back     alignment and taxonomy information
>gi|383863554|ref|XP_003707245.1| PREDICTED: 1,4-alpha-glucan-branching enzyme-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|321455046|gb|EFX66191.1| hypothetical protein DAPPUDRAFT_302911 [Daphnia pulex] Back     alignment and taxonomy information
>gi|91076104|ref|XP_968648.1| PREDICTED: similar to GA17312-PA [Tribolium castaneum] gi|270014582|gb|EFA11030.1| hypothetical protein TcasGA2_TC004619 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|322785359|gb|EFZ12033.1| hypothetical protein SINV_12923 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332023850|gb|EGI64074.1| 1,4-alpha-glucan-branching enzyme [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|195066006|ref|XP_001996762.1| GH24987 [Drosophila grimshawi] gi|193896617|gb|EDV95483.1| GH24987 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|307197707|gb|EFN78864.1| 1,4-alpha-glucan-branching enzyme [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
FB|FBgn0053138 685 AGBE "1,4-Alpha-Glucan Branchi 0.839 0.160 0.548 9.8e-30
UNIPROTKB|G4NAD9 691 MGG_03186 "1,4-alpha-glucan-br 0.839 0.159 0.527 2.7e-29
WB|WBGene00011409 681 T04A8.7 [Caenorhabditis elegan 0.824 0.158 0.567 1.5e-28
ZFIN|ZDB-GENE-110411-171 688 si:ch211-213e17.1 "si:ch211-21 0.832 0.158 0.580 1.5e-28
UNIPROTKB|F1SK65 319 F1SK65 "Uncharacterized protei 0.824 0.338 0.592 1.9e-28
UNIPROTKB|F1PX32 699 GBE1 "Uncharacterized protein" 0.824 0.154 0.601 5.6e-28
MGI|MGI:1921435 702 Gbe1 "glucan (1,4-alpha-), bra 0.824 0.153 0.592 5.7e-28
ZFIN|ZDB-GENE-110914-16 630 si:ch211-247m23.1 "si:ch211-24 0.816 0.169 0.587 1.1e-27
UNIPROTKB|E9PGM4 661 GBE1 "1,4-alpha-glucan-branchi 0.824 0.163 0.575 5.9e-27
UNIPROTKB|Q04446 702 GBE1 "1,4-alpha-glucan-branchi 0.824 0.153 0.575 6.9e-27
FB|FBgn0053138 AGBE "1,4-Alpha-Glucan Branching Enzyme" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 337 (123.7 bits), Expect = 9.8e-30, P = 9.8e-30
 Identities = 62/113 (54%), Positives = 82/113 (72%)

Query:    22 RLSPWATYVTEPPVV---GHAYEQRIWNPKPQDKHKWTSSKPKKPDNLKIYESHVGICTQ 78
             RLSPWA YV +PP     G  Y+Q +W P   ++++     P +P +L+IYE HVGI +Q
Sbjct:   135 RLSPWAKYVVQPPKSANQGVNYKQYVWEPPSYERYQRQHPGPPRPKSLRIYECHVGIASQ 194

Query:    79 EQKCASYEDFVRVVIPRIVKQGYNAVQLMAIMEHAYYASFGYQVTSFFAASSR 131
             E +  SY++F   ++PRI +QGYN +Q+MAIMEHAYYASFGYQVTSF+AASSR
Sbjct:   195 EPRVGSYDEFADRIVPRIKRQGYNCIQVMAIMEHAYYASFGYQVTSFYAASSR 247
GO:0003844 "1,4-alpha-glucan branching enzyme activity" evidence=ISS
GO:0005978 "glycogen biosynthetic process" evidence=IEA
GO:0004553 "hydrolase activity, hydrolyzing O-glycosyl compounds" evidence=IEA
GO:0043169 "cation binding" evidence=IEA
GO:0008340 "determination of adult lifespan" evidence=IMP
UNIPROTKB|G4NAD9 MGG_03186 "1,4-alpha-glucan-branching enzyme" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
WB|WBGene00011409 T04A8.7 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110411-171 si:ch211-213e17.1 "si:ch211-213e17.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1SK65 F1SK65 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PX32 GBE1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1921435 Gbe1 "glucan (1,4-alpha-), branching enzyme 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110914-16 si:ch211-247m23.1 "si:ch211-247m23.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E9PGM4 GBE1 "1,4-alpha-glucan-branching enzyme" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q04446 GBE1 "1,4-alpha-glucan-branching enzyme" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q04446GLGB_HUMAN2, ., 4, ., 1, ., 1, 80.57520.82440.1538yesN/A
Q96VA4GLGB_ASPOR2, ., 4, ., 1, ., 1, 80.53570.85490.1625yesN/A
Q6CCT1GLGB_YARLI2, ., 4, ., 1, ., 1, 80.52720.83960.1591yesN/A
Q6EAS5GLGB_HORSE2, ., 4, ., 1, ., 1, 80.56630.82440.1545yesN/A
Q9D6Y9GLGB_MOUSE2, ., 4, ., 1, ., 1, 80.59290.82440.1538yesN/A
O23647GLGB1_ARATH2, ., 4, ., 1, ., 1, 80.53270.79380.1212yesN/A
Q6CX53GLGB_KLULA2, ., 4, ., 1, ., 1, 80.5250.83960.1529yesN/A
Q757Q6GLGB_ASHGO2, ., 4, ., 1, ., 1, 80.51660.83960.1564yesN/A
Q9Y8H3GLGB_EMENI2, ., 4, ., 1, ., 1, 80.50890.85490.1637yesN/A
P32775GLGB_YEAST2, ., 4, ., 1, ., 1, 80.53330.83960.1562yesN/A
Q6BXN1GLGB_DEBHA2, ., 4, ., 1, ., 1, 80.54380.84730.1561yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
cd11321 406 cd11321, AmyAc_bac_euk_BE, Alpha amylase catalytic 2e-46
PLN02447 758 PLN02447, PLN02447, 1,4-alpha-glucan-branching enz 9e-43
PLN02960 897 PLN02960, PLN02960, alpha-amylase 9e-36
COG0296 628 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [ 8e-20
PLN03244 872 PLN03244, PLN03244, alpha-amylase; Provisional 6e-15
cd11322 402 cd11322, AmyAc_Glg_BE, Alpha amylase catalytic dom 4e-14
PRK12313 633 PRK12313, PRK12313, glycogen branching enzyme; Pro 9e-14
PRK05402 726 PRK05402, PRK05402, glycogen branching enzyme; Pro 2e-11
TIGR01515 618 TIGR01515, branching_enzym, alpha-1,4-glucan:alpha 3e-09
PRK14706 639 PRK14706, PRK14706, glycogen branching enzyme; Pro 1e-07
PRK14705 1224 PRK14705, PRK14705, glycogen branching enzyme; Pro 2e-07
COG1523 697 COG1523, PulA, Type II secretory pathway, pullulan 3e-04
cd11325 436 cd11325, AmyAc_GTHase, Alpha amylase catalytic dom 0.001
PRK12568 730 PRK12568, PRK12568, glycogen branching enzyme; Pro 0.003
>gnl|CDD|200460 cd11321, AmyAc_bac_euk_BE, Alpha amylase catalytic domain found in bacterial and eukaryotic branching enzymes Back     alignment and domain information 
 Score =  154 bits (391), Expect = 2e-46
 Identities = 52/83 (62%), Positives = 67/83 (80%)

Query: 49  PQDKHKWTSSKPKKPDNLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGYNAVQLMA 108
           P++ +++   +P KP  L+IYE+HVG+ ++E K ASY +F   V+PRI K GYNA+QLMA
Sbjct: 1   PEEPYQFKHPRPPKPRALRIYEAHVGMSSEEPKVASYREFTDNVLPRIKKLGYNAIQLMA 60

Query: 109 IMEHAYYASFGYQVTSFFAASSR 131
           IMEHAYYASFGYQVT+FFAASSR
Sbjct: 61  IMEHAYYASFGYQVTNFFAASSR 83

Branching enzymes (BEs) catalyze the formation of alpha-1,6 branch points in either glycogen or starch by cleavage of the alpha-1,4 glucosidic linkage yielding a non-reducing end oligosaccharide chain, and subsequent attachment to the alpha-1,6 position. By increasing the number of non-reducing ends, glycogen is more reactive to synthesis and digestion as well as being more soluble. This group includes bacterial and eukaryotic proteins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase. Length = 406
>gnl|CDD|215246 PLN02447, PLN02447, 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>gnl|CDD|215519 PLN02960, PLN02960, alpha-amylase Back     alignment and domain information
>gnl|CDD|223373 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|178782 PLN03244, PLN03244, alpha-amylase; Provisional Back     alignment and domain information
>gnl|CDD|200461 cd11322, AmyAc_Glg_BE, Alpha amylase catalytic domain found in the Glycogen branching enzyme (also called 1,4-alpha-glucan branching enzyme) Back     alignment and domain information
>gnl|CDD|237052 PRK12313, PRK12313, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|235445 PRK05402, PRK05402, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|188150 TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>gnl|CDD|237795 PRK14706, PRK14706, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|237794 PRK14705, PRK14705, glycogen branching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|224440 COG1523, PulA, Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|200464 cd11325, AmyAc_GTHase, Alpha amylase catalytic domain found in Glycosyltrehalose trehalohydrolase (also called Maltooligosyl trehalose Trehalohydrolase) Back     alignment and domain information
>gnl|CDD|139075 PRK12568, PRK12568, glycogen branching enzyme; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 131
COG0296 628 GlgB 1,4-alpha-glucan branching enzyme [Carbohydra 100.0
PLN02447 758 1,4-alpha-glucan-branching enzyme 99.97
PRK14706 639 glycogen branching enzyme; Provisional 99.97
PRK12568 730 glycogen branching enzyme; Provisional 99.97
PRK14705 1224 glycogen branching enzyme; Provisional 99.96
KOG0470|consensus 757 99.96
TIGR01515 613 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 99.96
PLN02960 897 alpha-amylase 99.96
PRK05402 726 glycogen branching enzyme; Provisional 99.96
PRK12313 633 glycogen branching enzyme; Provisional 99.95
TIGR02103 898 pullul_strch alpha-1,6-glucosidases, pullulanase-t 99.95
PLN02877 970 alpha-amylase/limit dextrinase 99.95
TIGR02104 605 pulA_typeI pullulanase, type I. Pullulan is an unu 99.94
COG1523 697 PulA Type II secretory pathway, pullulanase PulA a 99.94
TIGR02102 1111 pullulan_Gpos pullulanase, extracellular, Gram-pos 99.93
PRK03705 658 glycogen debranching enzyme; Provisional 99.93
TIGR02402 542 trehalose_TreZ malto-oligosyltrehalose trehalohydr 99.93
TIGR02100 688 glgX_debranch glycogen debranching enzyme GlgX. Th 99.92
PRK14510 1221 putative bifunctional 4-alpha-glucanotransferase/g 99.84
PLN03244 872 alpha-amylase; Provisional 99.56
TIGR02456 539 treS_nterm trehalose synthase. Trehalose synthase 99.37
PF00128 316 Alpha-amylase: Alpha amylase, catalytic domain; In 99.3
PRK10933 551 trehalose-6-phosphate hydrolase; Provisional 99.21
TIGR02403 543 trehalose_treC alpha,alpha-phosphotrehalase. Treha 99.21
smart00642 166 Aamy Alpha-amylase domain. 99.19
PRK10785 598 maltodextrin glucosidase; Provisional 99.07
PRK09505 683 malS alpha-amylase; Reviewed 98.64
PRK09441 479 cytoplasmic alpha-amylase; Reviewed 98.57
TIGR02401 825 trehalose_TreY malto-oligosyltrehalose synthase. T 98.51
PRK14511 879 maltooligosyl trehalose synthase; Provisional 98.38
PLN02784 894 alpha-amylase 98.32
PRK14507 1693 putative bifunctional 4-alpha-glucanotransferase/m 98.31
PLN02361 401 alpha-amylase 98.29
PLN00196 428 alpha-amylase; Provisional 98.13
COG0366 505 AmyA Glycosidases [Carbohydrate transport and meta 98.01
KOG0471|consensus 545 97.82
cd0285499 Glycogen_branching_enzyme_like_N_term Glycogen bra 97.77
cd02860100 Pullulanase_N_term Pullulanase domain N-terminus. 97.39
PRK13840 495 sucrose phosphorylase; Provisional 97.19
TIGR03852 470 sucrose_gtfA sucrose phosphorylase. In the forward 96.39
TIGR01531 1464 glyc_debranch glycogen debranching enzymye. glycog 96.12
PF14872 811 GHL5: Hypothetical glycoside hydrolase 5 96.06
cd02855106 Glycogen_branching_enzyme_N_term Glycogen branchin 95.45
TIGR02455 688 TreS_stutzeri trehalose synthase, Pseudomonas stut 94.84
cd0285385 MTHase_N_term Maltooligosyl trehalose synthase (MT 94.12
cd02852119 Isoamylase_N_term Isoamylase N-terminus domain. Is 93.83
cd02856103 Glycogen_debranching_enzyme_N_term Glycogen_debran 92.84
COG3280 889 TreY Maltooligosyl trehalose synthase [Carbohydrat 90.29
PLN02635 538 disproportionating enzyme 86.94
PF14701 423 hDGE_amylase: glucanotransferase domain of human g 85.04
PF02446 496 Glyco_hydro_77: 4-alpha-glucanotransferase; InterP 80.64
>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=3.2e-33  Score=241.46  Aligned_cols=119  Identities=24%  Similarity=0.419  Sum_probs=105.9

Q ss_pred             EeeEEEEEECCEEEEecCcceeeeeeCCC-ceeeee--ceEeCCCCCCCCCcCC-CCCCCCCCeeEEEeeccccccCCCc
Q psy14038          7 FYSILFYSVLFYSILRLSPWATYVTEPPV-VGHAYE--QRIWNPKPQDKHKWTS-SKPKKPDNLKIYESHVGICTQEQKC   82 (131)
Q Consensus         7 ~y~~l~~~~~g~~~~~~DPyA~~~~~~~~-~s~v~~--~~~~~~~~~~~~~w~~-~~~~~~~~~iIYE~Hv~~~~~~~~~   82 (131)
                      .|+|-|.+.+|....++||||++.+.++. +|+|.+  .+.|+++     .|.. .+.+..++++|||+|||+|+++ +.
T Consensus        87 ~Yky~l~~~~g~~~~~~DP~a~~~~~~p~~aS~v~~~~~y~W~d~-----~~~~~~~~~~~e~~vIYElHvGs~~~~-~~  160 (628)
T COG0296          87 RYKYELIDPSGQLRLKADPYARRQEVGPHTASQVVDLPDYEWQDE-----RWDRAWRGRFWEPIVIYELHVGSFTPD-RF  160 (628)
T ss_pred             eEEEEEeCCCCceeeccCchhhccCCCCCCcceecCCCCcccccc-----cccccccCCCCCCceEEEEEeeeccCC-CC
Confidence            59999999999999999999999999987 888887  4889887     6721 2235678999999999999985 66


Q ss_pred             cCHHHHHhhhhHHHHHcCCcEEEeccceecCCCCCcCCCCCceeeccCC
Q psy14038         83 ASYEDFVRVVIPRIVKQGYNAVQLMAIMEHAYYASFGYQVTSFFAASSR  131 (131)
Q Consensus        83 gty~~~~~~~l~ylk~LGvt~VeLmPv~e~~~~~~WGY~~~~~fap~sR  131 (131)
                      -+|.++++++|||||+|||||||||||+||+.+.|||||+++||||+||
T Consensus       161 ~~~~e~a~~llpYl~elG~T~IELMPv~e~p~~~sWGYq~~g~yAp~sr  209 (628)
T COG0296         161 LGYFELAIELLPYLKELGITHIELMPVAEHPGDRSWGYQGTGYYAPTSR  209 (628)
T ss_pred             cCHHHHHHHHhHHHHHhCCCEEEEcccccCCCCCCCCCCcceecccccc
Confidence            6888888888999999999999999999999999999999999999998

>PLN02447 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>PRK14706 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK12568 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK14705 glycogen branching enzyme; Provisional Back     alignment and domain information
>KOG0470|consensus Back     alignment and domain information
>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>PLN02960 alpha-amylase Back     alignment and domain information
>PRK05402 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK12313 glycogen branching enzyme; Provisional Back     alignment and domain information
>TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type Back     alignment and domain information
>PLN02877 alpha-amylase/limit dextrinase Back     alignment and domain information
>TIGR02104 pulA_typeI pullulanase, type I Back     alignment and domain information
>COG1523 PulA Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive Back     alignment and domain information
>PRK03705 glycogen debranching enzyme; Provisional Back     alignment and domain information
>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>TIGR02100 glgX_debranch glycogen debranching enzyme GlgX Back     alignment and domain information
>PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional Back     alignment and domain information
>PLN03244 alpha-amylase; Provisional Back     alignment and domain information
>TIGR02456 treS_nterm trehalose synthase Back     alignment and domain information
>PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK10933 trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase Back     alignment and domain information
>smart00642 Aamy Alpha-amylase domain Back     alignment and domain information
>PRK10785 maltodextrin glucosidase; Provisional Back     alignment and domain information
>PRK09505 malS alpha-amylase; Reviewed Back     alignment and domain information
>PRK09441 cytoplasmic alpha-amylase; Reviewed Back     alignment and domain information
>TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase Back     alignment and domain information
>PRK14511 maltooligosyl trehalose synthase; Provisional Back     alignment and domain information
>PLN02784 alpha-amylase Back     alignment and domain information
>PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional Back     alignment and domain information
>PLN02361 alpha-amylase Back     alignment and domain information
>PLN00196 alpha-amylase; Provisional Back     alignment and domain information
>COG0366 AmyA Glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0471|consensus Back     alignment and domain information
>cd02854 Glycogen_branching_enzyme_like_N_term Glycogen branching enzyme-like N-terminus domain Back     alignment and domain information
>cd02860 Pullulanase_N_term Pullulanase domain N-terminus Back     alignment and domain information
>PRK13840 sucrose phosphorylase; Provisional Back     alignment and domain information
>TIGR03852 sucrose_gtfA sucrose phosphorylase Back     alignment and domain information
>TIGR01531 glyc_debranch glycogen debranching enzymye Back     alignment and domain information
>PF14872 GHL5: Hypothetical glycoside hydrolase 5 Back     alignment and domain information
>cd02855 Glycogen_branching_enzyme_N_term Glycogen branching enzyme N-terminus domain Back     alignment and domain information
>TIGR02455 TreS_stutzeri trehalose synthase, Pseudomonas stutzeri type Back     alignment and domain information
>cd02853 MTHase_N_term Maltooligosyl trehalose synthase (MTSase) N-terminus domain Back     alignment and domain information
>cd02852 Isoamylase_N_term Isoamylase N-terminus domain Back     alignment and domain information
>cd02856 Glycogen_debranching_enzyme_N_term Glycogen_debranching_enzyme N-terminal domain Back     alignment and domain information
>COG3280 TreY Maltooligosyl trehalose synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02635 disproportionating enzyme Back     alignment and domain information
>PF14701 hDGE_amylase: glucanotransferase domain of human glycogen debranching enzyme Back     alignment and domain information
>PF02446 Glyco_hydro_77: 4-alpha-glucanotransferase; InterPro: IPR003385 O-Glycosyl hydrolases 3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
3aml_A 755 Structure Of The Starch Branching Enzyme I (Bei) Fr 5e-25
3amk_A 702 Structure Of The Starch Branching Enzyme I (Bei) Fr 9e-25
3k1d_A 722 Crystal Structure Of Glycogen Branching Enzyme Syno 2e-07
>pdb|3AML|A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L Length = 755 Back     alignment and structure 
Iteration: 1

 Score =  109 bits (272), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 51/111 (45%), Positives = 71/111 (63%), Gaps = 1/111 (0%)
Query: 22  RLSPWATYVT-EPPVVGHAYEQRIWNPKPQDKHKWTSSKPKKPDNLKIYESHVGICTQEQ 80
           R+  W  Y T +    G  Y+   W+P   +++ +   +P KPD  +IYE+HVG+  +E 
Sbjct: 136 RIPAWIRYATFDASKFGAPYDGVHWDPPACERYVFKHPRPPKPDAPRIYEAHVGMSGEEP 195
Query: 81  KCASYEDFVRVVIPRIVKQGYNAVQLMAIMEHAYYASFGYQVTSFFAASSR 131
           + ++Y +F   V+PRI    YN VQLMAIMEH+YYASFGY VT+FFA SSR
Sbjct: 196 EVSTYREFADNVLPRIRANNYNTVQLMAIMEHSYYASFGYHVTNFFAVSSR 246
>pdb|3AMK|A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L Length = 702 Back     alignment and structure
>pdb|3K1D|A Chain A, Crystal Structure Of Glycogen Branching Enzyme Synonym: 1,4- Glucan:1,4-Alpha-D-Glucan 6-Glucosyl-Transferase From Mycob Tuberculosis H37rv Length = 722 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
3aml_A 755 OS06G0726400 protein; starch-branching, transferas 2e-44
3k1d_A 722 1,4-alpha-glucan-branching enzyme; mycobacterium t 1e-14
1m7x_A 617 1,4-alpha-glucan branching enzyme; alpha/beta barr 3e-14
3vgf_A 558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 4e-13
3m07_A 618 Putative alpha amylase; IDP00968, csgid, structura 3e-11
2bhu_A 602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 9e-11
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Length = 755 Back     alignment and structure
 Score =  152 bits (387), Expect = 2e-44
 Identities = 51/113 (45%), Positives = 71/113 (62%), Gaps = 1/113 (0%)

Query: 20  ILRLSPWATYVTEPP-VVGHAYEQRIWNPKPQDKHKWTSSKPKKPDNLKIYESHVGICTQ 78
           + R+  W  Y T      G  Y+   W+P   +++ +   +P KPD  +IYE+HVG+  +
Sbjct: 134 VDRIPAWIRYATFDASKFGAPYDGVHWDPPACERYVFKHPRPPKPDAPRIYEAHVGMSGE 193

Query: 79  EQKCASYEDFVRVVIPRIVKQGYNAVQLMAIMEHAYYASFGYQVTSFFAASSR 131
           E + ++Y +F   V+PRI    YN VQLMAIMEH+YYASFGY VT+FFA SSR
Sbjct: 194 EPEVSTYREFADNVLPRIRANNYNTVQLMAIMEHSYYASFGYHVTNFFAVSSR 246
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Length = 722 Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Length = 617 Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Length = 558 Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Length = 618 Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Length = 602 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
3aml_A 755 OS06G0726400 protein; starch-branching, transferas 99.96
4aio_A 884 Limit dextrinase; hydrolase, pullulanase, glycosid 99.96
3k1d_A 722 1,4-alpha-glucan-branching enzyme; mycobacterium t 99.94
1m7x_A 617 1,4-alpha-glucan branching enzyme; alpha/beta barr 99.93
2wan_A 921 Pullulanase; hydrolase, glycoside hydrolase, polys 99.91
2wsk_A 657 Glycogen debranching enzyme; carbohydrate metaboli 99.91
2ya0_A 714 Putative alkaline amylopullulanase; hydrolase, gly 99.91
2vr5_A 718 Glycogen operon protein GLGX; hydrolase, glycosida 99.9
2e8y_A 718 AMYX protein, pullulanase; multiple domain, beta-a 99.9
2bhu_A 602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 99.9
3m07_A 618 Putative alpha amylase; IDP00968, csgid, structura 99.9
2fhf_A 1083 Pullulanase; multiple domain, beta-alpha-barrel, a 99.9
2ya1_A 1014 Putative alkaline amylopullulanase; hydrolase, gly 99.9
3vgf_A 558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 99.9
1bf2_A 750 Isoamylase; hydrolase, glycosidase, debranching en 99.9
3faw_A 877 Reticulocyte binding protein; TIM barrel, beta bar 99.9
1gjw_A 637 Maltodextrin glycosyltransferase; alpha-amylase, m 99.84
1wzl_A 585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 99.73
1j0h_A 588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 99.73
4aie_A 549 Glucan 1,6-alpha-glucosidase; hydrolase, glycoside 99.72
1ea9_C 583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 99.71
1ji1_A 637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 99.67
4aef_A 645 Neopullulanase (alpha-amylase II); hydrolase, ther 99.65
1lwj_A 441 4-alpha-glucanotransferase; alpha-amylase family, 99.6
2aaa_A 484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 99.57
1zja_A 557 Trehalulose synthase; sucrose isomerase, alpha-amy 99.57
2guy_A 478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 99.56
1wza_A 488 Alpha-amylase A; hydrolase, halophilic, thermophil 99.54
1m53_A 570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 99.54
2zic_A 543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 99.53
3aj7_A 589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 99.52
2z1k_A 475 (NEO)pullulanase; hydrolase, structural genomics, 99.52
3k8k_A 669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 99.51
3dhu_A 449 Alpha-amylase; structural genomics, hydrolase, gly 99.5
1uok_A 558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 99.5
2ze0_A 555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 99.47
3czg_A 644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 99.46
2dh2_A 424 4F2 cell-surface antigen heavy chain; TIM-barrel, 99.46
2wc7_A 488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 99.46
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 99.45
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 99.43
4aee_A 696 Alpha amylase, catalytic region; hydrolase, hypert 99.42
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 99.41
1g5a_A 628 Amylosucrase; glycosyltransferase, glycoside hydro 99.39
3edf_A 601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 99.38
1mxg_A 435 Alpha amylase; hyperthermostable, family 13 glycos 99.36
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 99.33
3ucq_A 655 Amylosucrase; thermostability, amylose synthesis, 99.32
1wpc_A 485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 99.31
1ud2_A 480 Amylase, alpha-amylase; calcium-free, alkaline, hy 99.31
3zss_A 695 Putative glucanohydrolase PEP1A; alpha-glucan bios 99.3
3aie_A 844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 99.28
3bh4_A 483 Alpha-amylase; calcium, carbohydrate metabolism, g 99.22
1hvx_A 515 Alpha-amylase; hydrolase, glycosyltransferase, the 99.22
1ht6_A 405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 99.22
1ua7_A 422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 99.21
3bc9_A 599 AMYB, alpha amylase, catalytic region; acarbose, t 99.18
3klk_A 1039 Glucansucrase; native form, open conformation, mul 99.16
1iv8_A 720 Maltooligosyl trehalose synthase; beta alpha barre 99.04
1g94_A 448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 98.98
1gcy_A 527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 98.96
3hje_A 704 704AA long hypothetical glycosyltransferase; treha 98.9
1jae_A 471 Alpha-amylase; glycosidase, carbohydrate metabolis 98.86
1r7a_A 504 Sucrose phosphorylase; beta-alpha-barrels, dimer, 98.83
4gqr_A 496 Pancreatic alpha-amylase; glycosyl hydrolase, diab 98.81
3ttq_A 1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 98.75
1x1n_A 524 4-alpha-glucanotransferase; disproportionating enz 90.37
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Back     alignment and structure
Probab=99.96  E-value=2.6e-29  Score=220.86  Aligned_cols=126  Identities=41%  Similarity=0.717  Sum_probs=109.3

Q ss_pred             EEeeEEEEEECCEEEEecCcceeeeeeCCC-ceeeeeceEeCCCCCCCCCcCCCCCCCCCCeeEEEeeccccccCCCccC
Q psy14038          6 LFYSILFYSVLFYSILRLSPWATYVTEPPV-VGHAYEQRIWNPKPQDKHKWTSSKPKKPDNLKIYESHVGICTQEQKCAS   84 (131)
Q Consensus         6 ~~y~~l~~~~~g~~~~~~DPyA~~~~~~~~-~s~v~~~~~~~~~~~~~~~w~~~~~~~~~~~iIYE~Hv~~~~~~~~~gt   84 (131)
                      .+|+|.|...+|++..++||||++++.++. ++...++++|+++..+.|+|++++++.+.+++|||+|||+|+.++..||
T Consensus       120 ~~Y~y~i~~~~g~~~~~~dpya~~~~~~~~~~~~~~~~~v~d~~~~~~~~w~~~~~~~~~~~~IYE~hv~~~~~~~~~Gt  199 (755)
T 3aml_A          120 SKVKFRFRHGGGAWVDRIPAWIRYATFDASKFGAPYDGVHWDPPACERYVFKHPRPPKPDAPRIYEAHVGMSGEEPEVST  199 (755)
T ss_dssp             EEEEEEEECTTCCCEEECCTTCSCEEECCSSSSCCEEEEECCCCGGGCCCCCSCCCCCCSSCEEEEEESTTCSSSSSCCC
T ss_pred             CEEEEEEECCCCcEEecCCcchheEeecccccCcccceEEECCcccccCCCCCcCCCCCCCCEEEEEeeeccccCCCCCC
Confidence            379999776678888999999999999886 3555566778763223689998877667889999999999988888999


Q ss_pred             HHHHHhhhhHHHHHcCCcEEEeccceecCCCCCcCCCCCceeeccCC
Q psy14038         85 YEDFVRVVIPRIVKQGYNAVQLMAIMEHAYYASFGYQVTSFFAASSR  131 (131)
Q Consensus        85 y~~~~~~~l~ylk~LGvt~VeLmPv~e~~~~~~WGY~~~~~fap~sR  131 (131)
                      |++++++.|+|||+||||||+||||+|++...+|||++++||+|++|
T Consensus       200 ~~~l~~~~L~yLk~LGvt~I~L~Pi~e~~~~~~~GY~~~dy~a~~~~  246 (755)
T 3aml_A          200 YREFADNVLPRIRANNYNTVQLMAIMEHSYYASFGYHVTNFFAVSSR  246 (755)
T ss_dssp             HHHHHHHTHHHHHHTTCCEEEEESCEECSCGGGTTCSCSEEEEECGG
T ss_pred             HHHHHHHHHHHHHHcCCCEEEECchhcCCCCCCCCCccCCCCccCCC
Confidence            99999977999999999999999999999889999999999999986
>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Back     alignment and structure
>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Back     alignment and structure
>2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* Back     alignment and structure
>2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Back     alignment and structure
>4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Back     alignment and structure
>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Back     alignment and structure
>3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Back     alignment and structure
>1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Back     alignment and structure
>4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Back     alignment and structure
>1x1n_A 4-alpha-glucanotransferase; disproportionating enzyme, amylomaltase, D-enzyme; 1.80A {Solanum tuberosum} SCOP: c.1.8.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 131
d1m7xa3 396 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enz 5e-13
d1eh9a3 400 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrol 2e-10
d2bhua3 420 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydro 6e-09
d1bf2a3 475 c.1.8.1 (A:163-637) Isoamylase, central domain {Ps 4e-04
d1g5aa2 554 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysacc 0.001
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Length = 396 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: 1,4-alpha-glucan branching enzyme, central domain
species: Escherichia coli [TaxId: 562]

 Score = 62.3 bits (150), Expect = 5e-13
 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 5/85 (5%)

Query: 50  QDKHKWTSSKPKKPDNLKIYESHVGICTQ---EQKCASYEDFVRVVIPRIVKQGYNAVQL 106
           Q + +  +++   P  + IYE H+G   +        SY +    ++P     G+  ++L
Sbjct: 3   QTEERKKANQFDAP--ISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLEL 60

Query: 107 MAIMEHAYYASFGYQVTSFFAASSR 131
           + I EH +  S+GYQ T  +A + R
Sbjct: 61  LPINEHPFDGSWGYQPTGLYAPTRR 85
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Length = 400 Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Length = 420 Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Length = 475 Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Length = 554 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
d2bhua3 420 Glycosyltrehalose trehalohydrolase, central domain 99.83
d1m7xa3 396 1,4-alpha-glucan branching enzyme, central domain 99.83
d1gjwa2 572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 99.83
d1eh9a3 400 Glycosyltrehalose trehalohydrolase, central domain 99.79
d2fhfa5 563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 99.78
d1bf2a3 475 Isoamylase, central domain {Pseudomonas amyloderam 99.77
d1m53a2 478 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 99.72
d1uoka2 479 Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 99.71
d1lwha2 391 4-alpha-glucanotransferase {Thermotoga maritima [T 99.68
d1wzla3 382 Maltogenic amylase, central domain {Thermoactinomy 99.68
d1wzaa2 409 Bacterial alpha-amylase {Halothermothrix orenii [T 99.67
d1j0ha3 382 Neopullulanase, central domain {Bacillus stearothe 99.66
d1ea9c3 382 Maltogenic amylase, central domain {Bacillus sp., 99.59
d1h3ga3 422 Cyclomaltodextrinase, central domain {Flavobacteri 99.55
d1qhoa4 407 Cyclodextrin glycosyltransferase {Bacillus stearot 99.54
d2guya2 381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 99.54
d2aaaa2 381 Fungal alpha-amylases {Aspergillus niger, acid amy 99.52
d3bmva4 406 Cyclodextrin glycosyltransferase {Thermoanaerobact 99.51
d1ji1a3 432 Maltogenic amylase, central domain {Thermoactinomy 99.43
d1r7aa2 434 Sucrose phosphorylase {Bifidobacterium adolescenti 99.39
d1ud2a2 390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 99.38
d1ht6a2 347 Plant alpha-amylase {Barley (Hordeum vulgare), AMY 99.32
d1g5aa2 554 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 99.29
d1ua7a2 344 Bacterial alpha-amylase {Bacillus subtilis [TaxId: 99.17
d1g94a2 354 Bacterial alpha-amylase {Pseudoalteromonas halopla 99.17
d1gcya2 357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 99.06
d1hvxa2 393 Bacterial alpha-amylase {Bacillus stearothermophil 99.02
d1e43a2 393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 99.01
d1jaea2 378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 98.99
d1mxga2 361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 98.92
d2d3na2 394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 98.91
d1hx0a2 403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 98.8
d1iv8a2 653 Maltooligosyl trehalose synthase {Archaeon Sulfolo 98.65
d1m7xa1110 1,4-alpha-glucan branching enzyme, N-terminal doma 98.07
d2fhfa1115 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 96.17
d2bhua197 Glycosyltrehalose trehalohydrolase, N-terminal dom 94.71
d1eh9a190 Glycosyltrehalose trehalohydrolase, N-terminal dom 92.94
d1x1na1 523 Amylomaltase MalQ {Potato (Solanum tuberosum) [Tax 92.13
d1tz7a1 485 Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363] 88.36
d1eswa_ 500 Amylomaltase MalQ {Thermus aquaticus [TaxId: 271]} 85.11
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: Glycosyltrehalose trehalohydrolase, central domain
species: Deinococcus radiodurans [TaxId: 1299]

Probab=99.83  E-value=1e-21  Score=156.57  Aligned_cols=67  Identities=27%  Similarity=0.458  Sum_probs=62.9

Q ss_pred             CCCCCeeEEEeeccccccCCCccCHHHHHhhhhHHHHHcCCcEEEeccceecCCCCCcCCCCCceeeccCC
Q psy14038         61 KKPDNLKIYESHVGICTQEQKCASYEDFVRVVIPRIVKQGYNAVQLMAIMEHAYYASFGYQVTSFFAASSR  131 (131)
Q Consensus        61 ~~~~~~iIYE~Hv~~~~~~~~~gty~~~~~~~l~ylk~LGvt~VeLmPv~e~~~~~~WGY~~~~~fap~sR  131 (131)
                      ++++++||||+|||+|++.   |||++++++ |+|||+||||+|+||||++++...+|||++++|+++++|
T Consensus        12 ~~~~~~viYe~~~~~f~~~---Gd~~g~~~~-ldyl~~LGv~~i~L~Pv~~~~~~~~~GY~~~d~~~vdp~   78 (420)
T d2bhua3          12 IKLADCVFYEVHVGTFTPE---GTYRAAAEK-LPYLKELGVTAIQVMPLAAFDGQRGWGYDGAAFYAPYAP   78 (420)
T ss_dssp             CCGGGCCEEEECHHHHSSS---CSHHHHHHT-HHHHHHHTCCEEEECCCEECSSSCCCSTTCCEEEEECGG
T ss_pred             CCccccEEEEEehhhcCCC---CCHHHHHHh-HHHHHHcCCCEEEeCCCCcCCCCCCCCCCcccCCCcCcc
Confidence            4678999999999999864   899999999 999999999999999999999999999999999999875
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1m7xa1 b.1.18.2 (A:117-226) 1,4-alpha-glucan branching enzyme, N-terminal domain N {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fhfa1 b.1.18.2 (A:288-402) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2bhua1 b.1.18.2 (A:14-110) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1eh9a1 b.1.18.2 (A:1-90) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d1x1na1 c.1.8.1 (A:2-524) Amylomaltase MalQ {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1tz7a1 c.1.8.1 (A:1-485) Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1eswa_ c.1.8.1 (A:) Amylomaltase MalQ {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure