Psyllid ID: psy14099


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----
MSRIVCIWMDHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLHHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLRQSLLAFCSMIGRIGQVIAPQVFLLLGFVLGDSRCLIPECEHAANTSYLTPWLNHAVPYKDGYPQNCFRYGHIGEGNGCNPTSFNKSHVIKCNAWVFQTDEVNLLNEFNLECDENRWKLTIVGSIDGLGALLGSPFCAFISDK
ccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcEEEEEcccccccHHHHHHHHHHHHHHHHHccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccEEEcccccEEEEEEcccccccHHcHHHHHHHHHHHHHcccccccccccc
ccEEEEEEEcccccccHEEHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHccccccccccHHcHEEccccccccccHHHcccccEcccccEEEcccccEEEEEccccccccccEHHHHHHHHHHcHEEEEEHccccccc
MSRIVCIWMDHVVFRQTLFLIGITGITSAYTVLYVNtvdmfptplhhvVFRQTLFLIGITGITSAYTVLYVNtvdmfptplrQSLLAFCSMIGRIGQVIAPQVFLLLGFvlgdsrclipecehaantsyltpwlnhavpykdgypqncfryghigegngcnptsfnkshvikcnaWVFQTDEVNLLNEFNLECDENRWKLTIVGSIDGlgallgspfcafisdk
MSRIVCIWMDHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLHHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLRQSLLAFCSMIGRIGQVIAPQVFLLLGFVLGDSRCLIPECEHAANTSYLTPWLNHAVPYKDGYPQNCFRYGHIGEGNGCNPTSFNKSHVIKCNAWVFQTDEVNLLNEFNLECDENRWKLTIVGSIDGLgallgspfcafisdk
MSRIVCIWMDHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLHHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLRQSLLAFCSMIGRIGQVIAPQVFLLLGFVLGDSRCLIPECEHAANTSYLTPWLNHAVPYKDGYPQNCFRYGHIGEGNGCNPTSFNKSHVIKCNAWVFQTDEVNLLNEFNLECDENRWKLTIVGSIDGLGALLGSPFCAFISDK
***IVCIWMDHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLHHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLRQSLLAFCSMIGRIGQVIAPQVFLLLGFVLGDSRCLIPECEHAANTSYLTPWLNHAVPYKDGYPQNCFRYGHIGEGNGCNPTSFNKSHVIKCNAWVFQTDEVNLLNEFNLECDENRWKLTIVGSIDGLGALLGSPFCAFI***
MSRIVCIWMDHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLHHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLRQSLLAFCSMIGRIGQVIAPQVFLLLGFVLGDSRCLIPECEHAANTSYLTPWLNHAVPYKDGYPQNCFRYGHIGEGNGCNPTSFNKSHVIKCNAWVFQTDEVNLLNEFNLECDENRWKLTIVGSIDGLGALLGSPFCAFISDK
MSRIVCIWMDHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLHHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLRQSLLAFCSMIGRIGQVIAPQVFLLLGFVLGDSRCLIPECEHAANTSYLTPWLNHAVPYKDGYPQNCFRYGHIGEGNGCNPTSFNKSHVIKCNAWVFQTDEVNLLNEFNLECDENRWKLTIVGSIDGLGALLGSPFCAFISDK
*SRIVCIWMDHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLHHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLRQSLLAFCSMIGRIGQVIAPQVFLLLGFVLGDSRCLIPECEHAANTSYLTPWLNHAVPYKDGYPQNCFRYGHIGEGNGCNPTSFNKSHVIKCNAWVFQTDEVNLLNEFNLECDENRWKLTIVGSIDGLGALLGSPFCAFISD*
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRIVCIWMDHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLHHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLRQSLLAFCSMIGRIGQVIAPQVFLLLGFVLGDSRCLIPECEHAANTSYLTPWLNHAVPYKDGYPQNCFRYGHIGEGNGCNPTSFNKSHVIKCNAWVFQTDEVNLLNEFNLECDENRWKLTIVGSIDGLGALLGSPFCAFISDK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query224 2.2.26 [Sep-21-2011]
Q9WTN6564 Solute carrier family 22 yes N/A 0.303 0.120 0.366 2e-05
A9CB25551 Solute carrier family 22 N/A N/A 0.285 0.116 0.384 4e-05
Q9Z306553 Solute carrier family 22 no N/A 0.241 0.097 0.436 8e-05
Q9R141553 Solute carrier family 22 yes N/A 0.241 0.097 0.418 0.0001
Q504N2544 Solute carrier family 22 no N/A 0.272 0.112 0.377 0.0001
Q8IZD6547 Solute carrier family 22 yes N/A 0.263 0.107 0.372 0.0002
Q6DFR1534 Solute carrier family 22 yes N/A 0.241 0.101 0.388 0.0002
Q9Z0E8 557 Solute carrier family 22 no N/A 0.473 0.190 0.293 0.0002
Q91WU2540 Solute carrier family 22 no N/A 0.245 0.101 0.418 0.0002
Q9H015551 Solute carrier family 22 no N/A 0.285 0.116 0.369 0.0003
>sp|Q9WTN6|S22AL_MOUSE Solute carrier family 22 member 21 OS=Mus musculus GN=Slc22a21 PE=2 SV=1 Back     alignment and function desciption
 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 45/71 (63%), Gaps = 3/71 (4%)

Query: 38  VDMFPTPLHHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLRQSLLAFCSMIGRIGQ 97
           V + P+ LH++    TL ++G  GITSAY+++YV T +++PT +R   +   S   R+G 
Sbjct: 420 VQLVPSDLHYL--STTLVMVGKFGITSAYSMVYVYTAELYPTVVRNMGVGVSSTASRLGS 477

Query: 98  VIAPQVFLLLG 108
           +++P  F+ LG
Sbjct: 478 ILSPY-FVYLG 487




Sodium-ion independent, medium affinity carnitine transporter. Also transports organic cations such as tetraethylammonium (TEA) without the involvement of sodium. Relative uptake activity ratio of carnitine to TEA is 746.
Mus musculus (taxid: 10090)
>sp|A9CB25|S22A4_PAPAN Solute carrier family 22 member 4 OS=Papio anubis GN=SLC22A4 PE=3 SV=1 Back     alignment and function description
>sp|Q9Z306|S22A4_MOUSE Solute carrier family 22 member 4 OS=Mus musculus GN=Slc22a4 PE=1 SV=1 Back     alignment and function description
>sp|Q9R141|S22A4_RAT Solute carrier family 22 member 4 OS=Rattus norvegicus GN=Slc22a4 PE=1 SV=1 Back     alignment and function description
>sp|Q504N2|S22AF_MOUSE Solute carrier family 22 member 15 OS=Mus musculus GN=Slc22a15 PE=2 SV=2 Back     alignment and function description
>sp|Q8IZD6|S22AF_HUMAN Solute carrier family 22 member 15 OS=Homo sapiens GN=SLC22A15 PE=2 SV=1 Back     alignment and function description
>sp|Q6DFR1|S22AF_XENTR Solute carrier family 22 member 15 OS=Xenopus tropicalis GN=slc22a15 PE=2 SV=2 Back     alignment and function description
>sp|Q9Z0E8|S22A5_MOUSE Solute carrier family 22 member 5 OS=Mus musculus GN=Slc22a5 PE=1 SV=1 Back     alignment and function description
>sp|Q91WU2|S22A7_MOUSE Solute carrier family 22 member 7 OS=Mus musculus GN=Slc22a7 PE=1 SV=1 Back     alignment and function description
>sp|Q9H015|S22A4_HUMAN Solute carrier family 22 member 4 OS=Homo sapiens GN=SLC22A4 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query224
332375110 553 unknown [Dendroctonus ponderosae] 0.5 0.202 0.383 5e-21
332021678 569 Solute carrier family 22 member 4 [Acrom 0.482 0.189 0.419 4e-20
332021677 594 Solute carrier family 22 member 4 [Acrom 0.468 0.176 0.417 6e-20
332028174 430 Solute carrier family 22 member 21 [Acro 0.486 0.253 0.414 6e-20
157120965 548 organic cation transporter [Aedes aegypt 0.491 0.200 0.359 1e-19
118792135 565 AGAP012383-PA [Anopheles gambiae str. PE 0.491 0.194 0.372 4e-19
307184022 581 Solute carrier family 22 member 21 [Camp 0.473 0.182 0.412 9e-19
193627254 538 PREDICTED: solute carrier family 22 memb 0.486 0.202 0.369 7e-18
170064791 549 organic cation transporter [Culex quinqu 0.491 0.200 0.362 9e-18
170064793 546 organic cation transporter [Culex quinqu 0.486 0.199 0.350 2e-17
>gi|332375110|gb|AEE62696.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
 Score =  107 bits (266), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%)

Query: 113 DSRCLIPECEHAANTSYLTPWLNHAVPYKDGYPQNCFRYGHIGEGNGCNPTSFNKSHVIK 172
           D RC IP+C+      YL PWLNHA+P+ + +P  C RY    + N C+   F+   + +
Sbjct: 55  DYRCKIPQCDQEGQAEYLQPWLNHAIPFINNHPDKCSRYASSDQFNNCSSAGFDIQVLER 114

Query: 173 CNAWVFQTDEVNLLNEFNLECDENRWKLTIVGSIDGLGALLGSPFCAFISDK 224
           C ++V+   E  +L E+ L+CD N WKLT+VG+++ +G   G      ISDK
Sbjct: 115 CGSFVYNGTEETILQEYGLQCDNNLWKLTMVGTVNNIGQFFGLIISGIISDK 166




Source: Dendroctonus ponderosae

Species: Dendroctonus ponderosae

Genus: Dendroctonus

Family: Curculionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332021678|gb|EGI62034.1| Solute carrier family 22 member 4 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|332021677|gb|EGI62033.1| Solute carrier family 22 member 4 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|332028174|gb|EGI68225.1| Solute carrier family 22 member 21 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|157120965|ref|XP_001659801.1| organic cation transporter [Aedes aegypti] gi|108874726|gb|EAT38951.1| AAEL009206-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|118792135|ref|XP_320175.3| AGAP012383-PA [Anopheles gambiae str. PEST] gi|116116755|gb|EAA00192.3| AGAP012383-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|307184022|gb|EFN70576.1| Solute carrier family 22 member 21 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|193627254|ref|XP_001952716.1| PREDICTED: solute carrier family 22 member 21-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|170064791|ref|XP_001867672.1| organic cation transporter [Culex quinquefasciatus] gi|167882045|gb|EDS45428.1| organic cation transporter [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|170064793|ref|XP_001867673.1| organic cation transporter [Culex quinquefasciatus] gi|167882046|gb|EDS45429.1| organic cation transporter [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query224
FB|FBgn0037140 568 CG7442 [Drosophila melanogaste 0.477 0.188 0.330 1.2e-10
FB|FBgn0037144572 CG7458 [Drosophila melanogaste 0.258 0.101 0.482 9.7e-08
FB|FBgn0037143 367 CG7448 [Drosophila melanogaste 0.415 0.253 0.316 1.9e-06
UNIPROTKB|E2R0K0 552 SLC22A1 "Uncharacterized prote 0.620 0.251 0.303 3.8e-06
MGI|MGI:1929481564 Slc22a21 "solute carrier famil 0.303 0.120 0.366 2e-05
ZFIN|ZDB-GENE-120215-78537 si:dkey-166k12.1 "si:dkey-166k 0.281 0.117 0.4 4.3e-05
ZFIN|ZDB-GENE-040724-70542 si:dkey-119m7.4 "si:dkey-119m7 0.267 0.110 0.4 4.4e-05
UNIPROTKB|F1NXX3420 SLC22A4 "Uncharacterized prote 0.375 0.2 0.355 5e-05
UNIPROTKB|C0MP43551 SLC22A4 "Ergothioneine transpo 0.241 0.098 0.454 0.0001
RGD|621149 553 Slc22a4 "solute carrier family 0.491 0.198 0.303 0.00013
FB|FBgn0037140 CG7442 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 163 (62.4 bits), Expect = 1.2e-10, P = 1.2e-10
 Identities = 39/118 (33%), Positives = 64/118 (54%)

Query:   115 RCLIPECEHAANTSYLTPWLNHAVPYKDGYP-QNCFRY--GHIGEGNG----CNPTSFNK 167
             RC + EC+    ++Y  P  N ++P K+G    +C RY    + + N     C+   F K
Sbjct:    72 RCSVEECD-LPGSNYYEPHTNWSIP-KNGKDLDSCNRYTNSELPQWNHSVDICSADHFTK 129

Query:   168 S-HVIKCNAWVFQTDEVNLLNEFNLECDENRWKLTIVGSIDGLGALLGSPFCAFISDK 224
             +      N +VF+ DEV + N+F + CD+  WKL++VG+I+ LG   G P   F++D+
Sbjct:   130 NKEACAHNEFVFRDDEVTISNDFGIFCDDE-WKLSMVGTINNLGQFFGIPIGGFVADR 186


GO:0008513 "secondary active organic cation transmembrane transporter activity" evidence=ISS
GO:0016021 "integral to membrane" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
FB|FBgn0037144 CG7458 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0037143 CG7448 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E2R0K0 SLC22A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1929481 Slc22a21 "solute carrier family 22 (organic cation transporter), member 21" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-120215-78 si:dkey-166k12.1 "si:dkey-166k12.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040724-70 si:dkey-119m7.4 "si:dkey-119m7.4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXX3 SLC22A4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|C0MP43 SLC22A4 "Ergothioneine transporter (ETT)" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|621149 Slc22a4 "solute carrier family 22 (organic cation transporter), member 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query224
TIGR00898505 TIGR00898, 2A0119, cation transport protein 2e-07
TIGR00898 505 TIGR00898, 2A0119, cation transport protein 6e-04
>gnl|CDD|233176 TIGR00898, 2A0119, cation transport protein Back     alignment and domain information
 Score = 50.4 bits (121), Expect = 2e-07
 Identities = 21/70 (30%), Positives = 39/70 (55%)

Query: 40  MFPTPLHHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLRQSLLAFCSMIGRIGQVI 99
           +   P+     R  L ++G  GITSA+ ++Y+ T +++PT +R   +  CS + R+G +I
Sbjct: 402 LLFVPVDLYFLRTALAVLGKFGITSAFQMVYLYTAELYPTVVRNLGVGVCSTMARVGSII 461

Query: 100 APQVFLLLGF 109
           +P +  L   
Sbjct: 462 SPFLVYLGEK 471


[Transport and binding proteins, Cations and iron carrying compounds]. Length = 505

>gnl|CDD|233176 TIGR00898, 2A0119, cation transport protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 224
TIGR00898 505 2A0119 cation transport protein. 99.5
KOG0253|consensus528 99.42
KOG0255|consensus 521 98.93
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 98.9
TIGR00898505 2A0119 cation transport protein. 98.7
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 98.63
KOG0255|consensus521 98.39
PRK09952438 shikimate transporter; Provisional 98.28
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 98.26
PRK10642490 proline/glycine betaine transporter; Provisional 98.22
KOG0254|consensus513 98.19
KOG0252|consensus538 98.19
KOG0569|consensus485 98.04
TIGR00880141 2_A_01_02 Multidrug resistance protein. 98.02
PRK10406432 alpha-ketoglutarate transporter; Provisional 98.01
PRK10077479 xylE D-xylose transporter XylE; Provisional 97.99
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 97.96
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 97.85
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 97.77
TIGR00895398 2A0115 benzoate transport. 97.76
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 97.75
TIGR00891405 2A0112 putative sialic acid transporter. 97.63
PRK15462 493 dipeptide/tripeptide permease D; Provisional 97.62
PRK15075434 citrate-proton symporter; Provisional 97.56
PRK12307426 putative sialic acid transporter; Provisional 97.54
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 97.54
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 97.49
TIGR00893 399 2A0114 d-galactonate transporter. 97.49
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 97.46
PRK15075 434 citrate-proton symporter; Provisional 97.46
TIGR00900365 2A0121 H+ Antiporter protein. 97.45
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 97.45
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 97.43
TIGR00895 398 2A0115 benzoate transport. 97.42
PRK10473 392 multidrug efflux system protein MdtL; Provisional 97.41
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 97.4
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 97.39
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 97.38
TIGR00891 405 2A0112 putative sialic acid transporter. 97.37
PRK10642 490 proline/glycine betaine transporter; Provisional 97.36
PRK12307 426 putative sialic acid transporter; Provisional 97.34
TIGR00900365 2A0121 H+ Antiporter protein. 97.32
PRK03699 394 putative transporter; Provisional 97.29
PRK11663 434 regulatory protein UhpC; Provisional 97.28
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 97.28
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 97.28
PRK10077 479 xylE D-xylose transporter XylE; Provisional 97.27
PRK03893 496 putative sialic acid transporter; Provisional 97.26
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 97.23
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 97.22
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 97.21
PRK15403 413 multidrug efflux system protein MdtM; Provisional 97.21
TIGR00889418 2A0110 nucleoside transporter. This family of prot 97.2
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 97.19
PRK10054 395 putative transporter; Provisional 97.16
PRK10213 394 nepI ribonucleoside transporter; Reviewed 97.14
PRK03545 390 putative arabinose transporter; Provisional 97.11
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 97.09
PRK10504 471 putative transporter; Provisional 97.08
PRK09952 438 shikimate transporter; Provisional 97.05
PLN00028 476 nitrate transmembrane transporter; Provisional 97.05
PRK03893496 putative sialic acid transporter; Provisional 97.04
PRK10406 432 alpha-ketoglutarate transporter; Provisional 97.01
TIGR00881379 2A0104 phosphoglycerate transporter family protein 97.0
PRK11646 400 multidrug resistance protein MdtH; Provisional 96.99
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 96.99
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 96.99
TIGR00901356 2A0125 AmpG-related permease. 96.96
TIGR00901356 2A0125 AmpG-related permease. 96.96
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 96.93
PRK11663434 regulatory protein UhpC; Provisional 96.91
TIGR00893399 2A0114 d-galactonate transporter. 96.9
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 96.9
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 96.89
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 96.87
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 96.85
PRK10489417 enterobactin exporter EntS; Provisional 96.85
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 96.84
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 96.83
PRK15011393 sugar efflux transporter B; Provisional 96.81
PRK05122399 major facilitator superfamily transporter; Provisi 96.79
KOG0569|consensus 485 96.78
PRK12382392 putative transporter; Provisional 96.77
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 96.77
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 96.77
PRK11010 491 ampG muropeptide transporter; Validated 96.73
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 96.73
PRK10091 382 MFS transport protein AraJ; Provisional 96.71
PRK11195 393 lysophospholipid transporter LplT; Provisional 96.65
PRK14995 495 methyl viologen resistance protein SmvA; Provision 96.6
PRK12382 392 putative transporter; Provisional 96.59
PRK03633 381 putative MFS family transporter protein; Provision 96.5
TIGR00897 402 2A0118 polyol permease family. This family of prot 96.49
PRK09705 393 cynX putative cyanate transporter; Provisional 96.43
PRK05122 399 major facilitator superfamily transporter; Provisi 96.43
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 96.42
PRK11902 402 ampG muropeptide transporter; Reviewed 96.41
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 96.41
KOG0254|consensus 513 96.41
PRK09874 408 drug efflux system protein MdtG; Provisional 96.38
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 96.38
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 96.24
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 96.23
PRK11043 401 putative transporter; Provisional 96.21
KOG2615|consensus 451 96.18
PRK10489 417 enterobactin exporter EntS; Provisional 96.17
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 96.1
PRK10207 489 dipeptide/tripeptide permease B; Provisional 96.09
PRK11652 394 emrD multidrug resistance protein D; Provisional 96.09
PRK10133 438 L-fucose transporter; Provisional 96.07
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 96.06
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 96.05
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 96.02
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 96.0
PRK10504471 putative transporter; Provisional 95.98
PRK03699394 putative transporter; Provisional 95.96
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 95.95
TIGR00892 455 2A0113 monocarboxylate transporter 1. 95.93
PRK09528420 lacY galactoside permease; Reviewed 95.83
TIGR00896355 CynX cyanate transporter. This family of proteins 95.82
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 95.78
TIGR00897402 2A0118 polyol permease family. This family of prot 95.61
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 95.56
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 95.47
PLN00028476 nitrate transmembrane transporter; Provisional 95.46
PRK09584 500 tppB putative tripeptide transporter permease; Rev 95.45
COG2270438 Permeases of the major facilitator superfamily [Ge 95.38
PTZ00207 591 hypothetical protein; Provisional 95.36
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 95.33
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 95.29
PRK11010491 ampG muropeptide transporter; Validated 95.26
PRK03545390 putative arabinose transporter; Provisional 95.25
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 95.23
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 95.09
PRK09705393 cynX putative cyanate transporter; Provisional 95.04
PRK14995495 methyl viologen resistance protein SmvA; Provision 95.02
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 95.01
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 94.99
PRK09874408 drug efflux system protein MdtG; Provisional 94.98
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 94.84
PRK11646400 multidrug resistance protein MdtH; Provisional 94.79
PRK10429473 melibiose:sodium symporter; Provisional 94.65
TIGR00892455 2A0113 monocarboxylate transporter 1. 94.5
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 94.38
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 94.36
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 94.28
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 94.2
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 94.16
TIGR01272310 gluP glucose/galactose transporter. Disruption of 94.11
PRK11043401 putative transporter; Provisional 94.11
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 93.56
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 93.54
TIGR00902382 2A0127 phenyl proprionate permease family protein. 93.38
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 93.31
TIGR00805 633 oat sodium-independent organic anion transporter. 92.96
TIGR00896355 CynX cyanate transporter. This family of proteins 92.59
PRK09669 444 putative symporter YagG; Provisional 92.47
KOG3764|consensus 464 92.32
PRK03633381 putative MFS family transporter protein; Provision 92.3
PRK09669444 putative symporter YagG; Provisional 92.23
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 92.2
KOG1330|consensus 493 92.07
PRK15011 393 sugar efflux transporter B; Provisional 92.0
PRK11462 460 putative transporter; Provisional 91.4
PRK10429 473 melibiose:sodium symporter; Provisional 91.06
PRK10054395 putative transporter; Provisional 90.8
KOG2532|consensus 466 90.62
PF13347 428 MFS_2: MFS/sugar transport protein 90.47
PF05977524 MFS_3: Transmembrane secretion effector; InterPro: 90.27
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 89.76
PRK11902402 ampG muropeptide transporter; Reviewed 89.63
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 89.37
PRK10091382 MFS transport protein AraJ; Provisional 89.01
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 88.65
PRK11652394 emrD multidrug resistance protein D; Provisional 87.99
PRK10133438 L-fucose transporter; Provisional 87.83
PRK09848448 glucuronide transporter; Provisional 87.79
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 87.73
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 87.58
PRK11462460 putative transporter; Provisional 87.35
PRK15402406 multidrug efflux system translocase MdfA; Provisio 87.23
KOG1330|consensus493 86.88
KOG2504|consensus 509 86.78
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 86.65
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 86.59
PRK09528 420 lacY galactoside permease; Reviewed 86.26
PF13347428 MFS_2: MFS/sugar transport protein 84.84
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 84.68
PRK10213394 nepI ribonucleoside transporter; Reviewed 82.06
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 82.02
PRK10473392 multidrug efflux system protein MdtL; Provisional 81.46
COG2211467 MelB Na+/melibiose symporter and related transport 81.04
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
Probab=99.50  E-value=1.3e-14  Score=131.45  Aligned_cols=110  Identities=26%  Similarity=0.495  Sum_probs=84.3

Q ss_pred             cccccccccCcccCcCCCCCcccccccccCCCC-CCCCcceeecCCCCCC---CCCCCC----CCCCCcccC-CCeeeCC
Q psy14099        110 VLGDSRCLIPECEHAANTSYLTPWLNHAVPYKD-GYPQNCFRYGHIGEGN---GCNPTS----FNKSHVIKC-NAWVFQT  180 (224)
Q Consensus       110 ~~p~~~C~~p~~~~~~n~~~~~~~~n~tiP~~~-~~~~~C~~y~~~~~~~---~~~~~~----~~~~~~~~C-~~w~yd~  180 (224)
                      .+|||||+.|+..   +.+ .+++++.++|.+. +++++|++|+.++...   .+....    .......+| ++|+|+.
T Consensus        33 ~~p~~~c~~~~~~---~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  108 (505)
T TIGR00898        33 ATPEHHCRLPDAA---NLS-SRCELNLTLPRLPDGRPESCLRFMVDQWANPSLLGCEPLKLSDLGLAATEPCLDGWEYSY  108 (505)
T ss_pred             CCCCcccCCCCcc---cCC-hHhHhceeccCCCCCCCCCCccccccchhhhcccccccchhcccCCCCCCCCCCCcEecC
Confidence            5899999998543   323 3357888888765 5789999998863221   111110    011345688 8999997


Q ss_pred             C--ccccccccccccccchhhhhHHHHHHHHhhhhccceeeeccCC
Q psy14099        181 D--EVNLLNEFNLECDENRWKLTIVGSIDGLGALLGSPFCAFISDK  224 (224)
Q Consensus       181 ~--~~tivte~~lVC~~~~~~~~~~~s~~~~G~~~G~~~~G~lsDr  224 (224)
                      +  ..++++||||+| |++++..+.++++++|.++|++++|+++||
T Consensus       109 ~~~~~~i~~e~~l~c-~~~~~~~~~~s~~~~g~~~g~~~~g~l~Dr  153 (505)
T TIGR00898       109 DTFSSTIVTEWDLVC-EDAWKVDLTQSCFFVGVLLGSFVFGYLSDR  153 (505)
T ss_pred             CcccccEEEEeccee-chHHHHHHHHHHHHHHHHHHHHhHHHhhhh
Confidence            6  589999999999 899999999999999999999999999997



>KOG0253|consensus Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query224
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 98.88
2cfq_A417 Lactose permease; transport, transport mechanism, 97.84
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 97.78
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 97.64
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 97.44
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 97.44
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 97.44
2xut_A 524 Proton/peptide symporter family protein; transport 97.11
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 97.08
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 97.03
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 96.83
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 94.69
2xut_A524 Proton/peptide symporter family protein; transport 94.22
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
Probab=98.88  E-value=2.8e-09  Score=94.10  Aligned_cols=99  Identities=16%  Similarity=0.222  Sum_probs=62.2

Q ss_pred             hhhHHHHhcccchHHHHHHHHHHHHHHHHHHHHhhcccCCCCCchhHHHHHHHHHHHHHHHHhh-hhHhhhcccccchHH
Q psy14099          3 RIVCIWMDHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLHHVVFRQTLFLIGITGITSAY-TVLYVNTVDMFPTPL   81 (224)
Q Consensus         3 ~l~~~~~~~~~gRr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~ElfPt~v   81 (224)
                      .+++..+.||.|||+.++.+..++.+.+..+.....   . . ......++..++...+++..+ .+.|+|.+|+|||++
T Consensus       329 ~~~~~~l~dr~Grr~~~~~~~~~~~~~~~~l~~~~~---~-~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~fPt~~  403 (491)
T 4gc0_A          329 TVLAIMTVDKFGRKPLQIIGALGMAIGMFSLGTAFY---T-Q-APGIVALLSMLFYVAAFAMSWGPVCWVLLSEIFPNAI  403 (491)
T ss_dssp             HHHHHHHHHHHCSHHHHHHHHHHHHHHHHHHHHHHH---T-T-CCHHHHHHHHHHHHHHHHTTTTHHHHHHHHHSSCTTT
T ss_pred             HHHHHHHHHhhcCcchhccchHHHHHHHHHHHHHHh---c-c-cchHHHHHHHHHHHHHHHhHHHHHHHHHHHHhCCHhH
Confidence            456777888988888766644333322221211111   1 1 112222333333333444444 357899999999999


Q ss_pred             HHHHHHHHHHHHhhhcccccceeeh
Q psy14099         82 RQSLLAFCSMIGRIGQVIAPQVFLL  106 (224)
Q Consensus        82 R~~g~g~~~~~~~~~~~~~~~~~~~  106 (224)
                      |++|+|+++..+++++.+++++.+.
T Consensus       404 R~~~~g~~~~~~~~~~~i~~~~~p~  428 (491)
T 4gc0_A          404 RGKALAIAVAAQWLANYFVSWTFPM  428 (491)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999988876643



>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query224
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 97.63
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 97.61
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 97.32
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=97.63  E-value=5.4e-05  Score=62.82  Aligned_cols=98  Identities=10%  Similarity=0.064  Sum_probs=59.6

Q ss_pred             hhhHHHHhcccchHHHHHHHHHHHHHHHHHHHHhhcccCCCCCchhHHHHHHHHHHHHHHHHhhhhHhhhcccccchHHH
Q psy14099          3 RIVCIWMDHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLHHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLR   82 (224)
Q Consensus         3 ~l~~~~~~~~~gRr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ElfPt~vR   82 (224)
                      .++...+.||.|||+.+..+.....+...+..  +....  .+. .....+.-++..++.+..+.....+.+|.+|.+.|
T Consensus        76 ~~~~G~l~Dr~g~r~~~~~~~~~~~~~~~~~~--~~~~~--~~~-~~~~~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~r  150 (447)
T d1pw4a_          76 KFIMGSVSDRSNPRVFLPAGLILAAAVMLFMG--FVPWA--TSS-IAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKER  150 (447)
T ss_dssp             HHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHH--HCHHH--HSS-SSHHHHHHHHHHHHHHHTHHHHHHHHHTTCTTTHH
T ss_pred             HHHHHHHHHHcCchHHHHHHHHHHHHHHhhcc--ccchh--hhh-HHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHhhcc
Confidence            34556677888888876653332222111111  11000  011 12233333444445555666788999999999999


Q ss_pred             HHHHHHHHHHHhhhcccccceee
Q psy14099         83 QSLLAFCSMIGRIGQVIAPQVFL  105 (224)
Q Consensus        83 ~~g~g~~~~~~~~~~~~~~~~~~  105 (224)
                      ++.+|+.+....+|+.++|.+..
T Consensus       151 ~~~~~~~~~~~~~g~~i~~~~~~  173 (447)
T d1pw4a_         151 GGIVSVWNCAHNVGGGIPPLLFL  173 (447)
T ss_dssp             HHHHHHHHHHHHHHHTSHHHHHH
T ss_pred             cccccccccccchhhhhhhhhhh
Confidence            99999999999999888886554



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure