Psyllid ID: psy14099
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 224 | ||||||
| 332375110 | 553 | unknown [Dendroctonus ponderosae] | 0.5 | 0.202 | 0.383 | 5e-21 | |
| 332021678 | 569 | Solute carrier family 22 member 4 [Acrom | 0.482 | 0.189 | 0.419 | 4e-20 | |
| 332021677 | 594 | Solute carrier family 22 member 4 [Acrom | 0.468 | 0.176 | 0.417 | 6e-20 | |
| 332028174 | 430 | Solute carrier family 22 member 21 [Acro | 0.486 | 0.253 | 0.414 | 6e-20 | |
| 157120965 | 548 | organic cation transporter [Aedes aegypt | 0.491 | 0.200 | 0.359 | 1e-19 | |
| 118792135 | 565 | AGAP012383-PA [Anopheles gambiae str. PE | 0.491 | 0.194 | 0.372 | 4e-19 | |
| 307184022 | 581 | Solute carrier family 22 member 21 [Camp | 0.473 | 0.182 | 0.412 | 9e-19 | |
| 193627254 | 538 | PREDICTED: solute carrier family 22 memb | 0.486 | 0.202 | 0.369 | 7e-18 | |
| 170064791 | 549 | organic cation transporter [Culex quinqu | 0.491 | 0.200 | 0.362 | 9e-18 | |
| 170064793 | 546 | organic cation transporter [Culex quinqu | 0.486 | 0.199 | 0.350 | 2e-17 |
| >gi|332375110|gb|AEE62696.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
Score = 107 bits (266), Expect = 5e-21, Method: Compositional matrix adjust.
Identities = 43/112 (38%), Positives = 65/112 (58%)
Query: 113 DSRCLIPECEHAANTSYLTPWLNHAVPYKDGYPQNCFRYGHIGEGNGCNPTSFNKSHVIK 172
D RC IP+C+ YL PWLNHA+P+ + +P C RY + N C+ F+ + +
Sbjct: 55 DYRCKIPQCDQEGQAEYLQPWLNHAIPFINNHPDKCSRYASSDQFNNCSSAGFDIQVLER 114
Query: 173 CNAWVFQTDEVNLLNEFNLECDENRWKLTIVGSIDGLGALLGSPFCAFISDK 224
C ++V+ E +L E+ L+CD N WKLT+VG+++ +G G ISDK
Sbjct: 115 CGSFVYNGTEETILQEYGLQCDNNLWKLTMVGTVNNIGQFFGLIISGIISDK 166
|
Source: Dendroctonus ponderosae Species: Dendroctonus ponderosae Genus: Dendroctonus Family: Curculionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332021678|gb|EGI62034.1| Solute carrier family 22 member 4 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|332021677|gb|EGI62033.1| Solute carrier family 22 member 4 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|332028174|gb|EGI68225.1| Solute carrier family 22 member 21 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|157120965|ref|XP_001659801.1| organic cation transporter [Aedes aegypti] gi|108874726|gb|EAT38951.1| AAEL009206-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|118792135|ref|XP_320175.3| AGAP012383-PA [Anopheles gambiae str. PEST] gi|116116755|gb|EAA00192.3| AGAP012383-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|307184022|gb|EFN70576.1| Solute carrier family 22 member 21 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|193627254|ref|XP_001952716.1| PREDICTED: solute carrier family 22 member 21-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|170064791|ref|XP_001867672.1| organic cation transporter [Culex quinquefasciatus] gi|167882045|gb|EDS45428.1| organic cation transporter [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|170064793|ref|XP_001867673.1| organic cation transporter [Culex quinquefasciatus] gi|167882046|gb|EDS45429.1| organic cation transporter [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 224 | ||||||
| FB|FBgn0037140 | 568 | CG7442 [Drosophila melanogaste | 0.477 | 0.188 | 0.330 | 1.2e-10 | |
| FB|FBgn0037144 | 572 | CG7458 [Drosophila melanogaste | 0.258 | 0.101 | 0.482 | 9.7e-08 | |
| FB|FBgn0037143 | 367 | CG7448 [Drosophila melanogaste | 0.415 | 0.253 | 0.316 | 1.9e-06 | |
| UNIPROTKB|E2R0K0 | 552 | SLC22A1 "Uncharacterized prote | 0.620 | 0.251 | 0.303 | 3.8e-06 | |
| MGI|MGI:1929481 | 564 | Slc22a21 "solute carrier famil | 0.303 | 0.120 | 0.366 | 2e-05 | |
| ZFIN|ZDB-GENE-120215-78 | 537 | si:dkey-166k12.1 "si:dkey-166k | 0.281 | 0.117 | 0.4 | 4.3e-05 | |
| ZFIN|ZDB-GENE-040724-70 | 542 | si:dkey-119m7.4 "si:dkey-119m7 | 0.267 | 0.110 | 0.4 | 4.4e-05 | |
| UNIPROTKB|F1NXX3 | 420 | SLC22A4 "Uncharacterized prote | 0.375 | 0.2 | 0.355 | 5e-05 | |
| UNIPROTKB|C0MP43 | 551 | SLC22A4 "Ergothioneine transpo | 0.241 | 0.098 | 0.454 | 0.0001 | |
| RGD|621149 | 553 | Slc22a4 "solute carrier family | 0.491 | 0.198 | 0.303 | 0.00013 |
| FB|FBgn0037140 CG7442 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 163 (62.4 bits), Expect = 1.2e-10, P = 1.2e-10
Identities = 39/118 (33%), Positives = 64/118 (54%)
Query: 115 RCLIPECEHAANTSYLTPWLNHAVPYKDGYP-QNCFRY--GHIGEGNG----CNPTSFNK 167
RC + EC+ ++Y P N ++P K+G +C RY + + N C+ F K
Sbjct: 72 RCSVEECD-LPGSNYYEPHTNWSIP-KNGKDLDSCNRYTNSELPQWNHSVDICSADHFTK 129
Query: 168 S-HVIKCNAWVFQTDEVNLLNEFNLECDENRWKLTIVGSIDGLGALLGSPFCAFISDK 224
+ N +VF+ DEV + N+F + CD+ WKL++VG+I+ LG G P F++D+
Sbjct: 130 NKEACAHNEFVFRDDEVTISNDFGIFCDDE-WKLSMVGTINNLGQFFGIPIGGFVADR 186
|
|
| FB|FBgn0037144 CG7458 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0037143 CG7448 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R0K0 SLC22A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1929481 Slc22a21 "solute carrier family 22 (organic cation transporter), member 21" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-120215-78 si:dkey-166k12.1 "si:dkey-166k12.1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040724-70 si:dkey-119m7.4 "si:dkey-119m7.4" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NXX3 SLC22A4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C0MP43 SLC22A4 "Ergothioneine transporter (ETT)" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|621149 Slc22a4 "solute carrier family 22 (organic cation transporter), member 4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 224 | |||
| TIGR00898 | 505 | TIGR00898, 2A0119, cation transport protein | 2e-07 | |
| TIGR00898 | 505 | TIGR00898, 2A0119, cation transport protein | 6e-04 |
| >gnl|CDD|233176 TIGR00898, 2A0119, cation transport protein | Back alignment and domain information |
|---|
Score = 50.4 bits (121), Expect = 2e-07
Identities = 21/70 (30%), Positives = 39/70 (55%)
Query: 40 MFPTPLHHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLRQSLLAFCSMIGRIGQVI 99
+ P+ R L ++G GITSA+ ++Y+ T +++PT +R + CS + R+G +I
Sbjct: 402 LLFVPVDLYFLRTALAVLGKFGITSAFQMVYLYTAELYPTVVRNLGVGVCSTMARVGSII 461
Query: 100 APQVFLLLGF 109
+P + L
Sbjct: 462 SPFLVYLGEK 471
|
[Transport and binding proteins, Cations and iron carrying compounds]. Length = 505 |
| >gnl|CDD|233176 TIGR00898, 2A0119, cation transport protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 224 | |||
| TIGR00898 | 505 | 2A0119 cation transport protein. | 99.5 | |
| KOG0253|consensus | 528 | 99.42 | ||
| KOG0255|consensus | 521 | 98.93 | ||
| TIGR01299 | 742 | synapt_SV2 synaptic vesicle protein SV2. This mode | 98.9 | |
| TIGR00898 | 505 | 2A0119 cation transport protein. | 98.7 | |
| TIGR00887 | 502 | 2A0109 phosphate:H+ symporter. This model represen | 98.63 | |
| KOG0255|consensus | 521 | 98.39 | ||
| PRK09952 | 438 | shikimate transporter; Provisional | 98.28 | |
| PF00083 | 451 | Sugar_tr: Sugar (and other) transporter; InterPro: | 98.26 | |
| PRK10642 | 490 | proline/glycine betaine transporter; Provisional | 98.22 | |
| KOG0254|consensus | 513 | 98.19 | ||
| KOG0252|consensus | 538 | 98.19 | ||
| KOG0569|consensus | 485 | 98.04 | ||
| TIGR00880 | 141 | 2_A_01_02 Multidrug resistance protein. | 98.02 | |
| PRK10406 | 432 | alpha-ketoglutarate transporter; Provisional | 98.01 | |
| PRK10077 | 479 | xylE D-xylose transporter XylE; Provisional | 97.99 | |
| TIGR00903 | 368 | 2A0129 major facilitator 4 family protein. This fa | 97.96 | |
| TIGR00887 | 502 | 2A0109 phosphate:H+ symporter. This model represen | 97.85 | |
| TIGR01299 | 742 | synapt_SV2 synaptic vesicle protein SV2. This mode | 97.77 | |
| TIGR00895 | 398 | 2A0115 benzoate transport. | 97.76 | |
| PRK11551 | 406 | putative 3-hydroxyphenylpropionic transporter MhpT | 97.75 | |
| TIGR00891 | 405 | 2A0112 putative sialic acid transporter. | 97.63 | |
| PRK15462 | 493 | dipeptide/tripeptide permease D; Provisional | 97.62 | |
| PRK15075 | 434 | citrate-proton symporter; Provisional | 97.56 | |
| PRK12307 | 426 | putative sialic acid transporter; Provisional | 97.54 | |
| TIGR00879 | 481 | SP MFS transporter, sugar porter (SP) family. This | 97.54 | |
| TIGR00890 | 377 | 2A0111 Oxalate/Formate Antiporter. | 97.49 | |
| TIGR00893 | 399 | 2A0114 d-galactonate transporter. | 97.49 | |
| TIGR00711 | 485 | efflux_EmrB drug resistance transporter, EmrB/QacA | 97.46 | |
| PRK15075 | 434 | citrate-proton symporter; Provisional | 97.46 | |
| TIGR00900 | 365 | 2A0121 H+ Antiporter protein. | 97.45 | |
| TIGR00879 | 481 | SP MFS transporter, sugar porter (SP) family. This | 97.45 | |
| TIGR02332 | 412 | HpaX 4-hydroxyphenylacetate permease. This protein | 97.43 | |
| TIGR00895 | 398 | 2A0115 benzoate transport. | 97.42 | |
| PRK10473 | 392 | multidrug efflux system protein MdtL; Provisional | 97.41 | |
| TIGR02332 | 412 | HpaX 4-hydroxyphenylacetate permease. This protein | 97.4 | |
| PRK11102 | 377 | bicyclomycin/multidrug efflux system; Provisional | 97.39 | |
| PRK11551 | 406 | putative 3-hydroxyphenylpropionic transporter MhpT | 97.38 | |
| TIGR00891 | 405 | 2A0112 putative sialic acid transporter. | 97.37 | |
| PRK10642 | 490 | proline/glycine betaine transporter; Provisional | 97.36 | |
| PRK12307 | 426 | putative sialic acid transporter; Provisional | 97.34 | |
| TIGR00900 | 365 | 2A0121 H+ Antiporter protein. | 97.32 | |
| PRK03699 | 394 | putative transporter; Provisional | 97.29 | |
| PRK11663 | 434 | regulatory protein UhpC; Provisional | 97.28 | |
| TIGR00710 | 385 | efflux_Bcr_CflA drug resistance transporter, Bcr/C | 97.28 | |
| TIGR00883 | 394 | 2A0106 metabolite-proton symporter. This model rep | 97.28 | |
| PRK10077 | 479 | xylE D-xylose transporter XylE; Provisional | 97.27 | |
| PRK03893 | 496 | putative sialic acid transporter; Provisional | 97.26 | |
| cd06174 | 352 | MFS The Major Facilitator Superfamily (MFS) is a l | 97.23 | |
| PRK09556 | 467 | uhpT sugar phosphate antiporter; Reviewed | 97.22 | |
| PF07690 | 352 | MFS_1: Major Facilitator Superfamily; InterPro: IP | 97.21 | |
| PRK15403 | 413 | multidrug efflux system protein MdtM; Provisional | 97.21 | |
| TIGR00889 | 418 | 2A0110 nucleoside transporter. This family of prot | 97.2 | |
| cd06174 | 352 | MFS The Major Facilitator Superfamily (MFS) is a l | 97.19 | |
| PRK10054 | 395 | putative transporter; Provisional | 97.16 | |
| PRK10213 | 394 | nepI ribonucleoside transporter; Reviewed | 97.14 | |
| PRK03545 | 390 | putative arabinose transporter; Provisional | 97.11 | |
| PRK11273 | 452 | glpT sn-glycerol-3-phosphate transporter; Provisio | 97.09 | |
| PRK10504 | 471 | putative transporter; Provisional | 97.08 | |
| PRK09952 | 438 | shikimate transporter; Provisional | 97.05 | |
| PLN00028 | 476 | nitrate transmembrane transporter; Provisional | 97.05 | |
| PRK03893 | 496 | putative sialic acid transporter; Provisional | 97.04 | |
| PRK10406 | 432 | alpha-ketoglutarate transporter; Provisional | 97.01 | |
| TIGR00881 | 379 | 2A0104 phosphoglycerate transporter family protein | 97.0 | |
| PRK11646 | 400 | multidrug resistance protein MdtH; Provisional | 96.99 | |
| TIGR00881 | 379 | 2A0104 phosphoglycerate transporter family protein | 96.99 | |
| PRK15402 | 406 | multidrug efflux system translocase MdfA; Provisio | 96.99 | |
| TIGR00901 | 356 | 2A0125 AmpG-related permease. | 96.96 | |
| TIGR00901 | 356 | 2A0125 AmpG-related permease. | 96.96 | |
| PRK08633 | 1146 | 2-acyl-glycerophospho-ethanolamine acyltransferase | 96.93 | |
| PRK11663 | 434 | regulatory protein UhpC; Provisional | 96.91 | |
| TIGR00893 | 399 | 2A0114 d-galactonate transporter. | 96.9 | |
| TIGR00894 | 465 | 2A0114euk Na(+)-dependent inorganic phosphate cotr | 96.9 | |
| TIGR00903 | 368 | 2A0129 major facilitator 4 family protein. This fa | 96.89 | |
| TIGR00712 | 438 | glpT glycerol-3-phosphate transporter. This model | 96.87 | |
| TIGR00886 | 366 | 2A0108 nitrite extrusion protein (nitrite facilita | 96.85 | |
| PRK10489 | 417 | enterobactin exporter EntS; Provisional | 96.85 | |
| TIGR00899 | 375 | 2A0120 sugar efflux transporter. This family of pr | 96.84 | |
| TIGR00711 | 485 | efflux_EmrB drug resistance transporter, EmrB/QacA | 96.83 | |
| PRK15011 | 393 | sugar efflux transporter B; Provisional | 96.81 | |
| PRK05122 | 399 | major facilitator superfamily transporter; Provisi | 96.79 | |
| KOG0569|consensus | 485 | 96.78 | ||
| PRK12382 | 392 | putative transporter; Provisional | 96.77 | |
| TIGR00885 | 410 | fucP L-fucose:H+ symporter permease. This family d | 96.77 | |
| PF07690 | 352 | MFS_1: Major Facilitator Superfamily; InterPro: IP | 96.77 | |
| PRK11010 | 491 | ampG muropeptide transporter; Validated | 96.73 | |
| TIGR00883 | 394 | 2A0106 metabolite-proton symporter. This model rep | 96.73 | |
| PRK10091 | 382 | MFS transport protein AraJ; Provisional | 96.71 | |
| PRK11195 | 393 | lysophospholipid transporter LplT; Provisional | 96.65 | |
| PRK14995 | 495 | methyl viologen resistance protein SmvA; Provision | 96.6 | |
| PRK12382 | 392 | putative transporter; Provisional | 96.59 | |
| PRK03633 | 381 | putative MFS family transporter protein; Provision | 96.5 | |
| TIGR00897 | 402 | 2A0118 polyol permease family. This family of prot | 96.49 | |
| PRK09705 | 393 | cynX putative cyanate transporter; Provisional | 96.43 | |
| PRK05122 | 399 | major facilitator superfamily transporter; Provisi | 96.43 | |
| TIGR00886 | 366 | 2A0108 nitrite extrusion protein (nitrite facilita | 96.42 | |
| PRK11902 | 402 | ampG muropeptide transporter; Reviewed | 96.41 | |
| TIGR01301 | 477 | GPH_sucrose GPH family sucrose/H+ symporter. This | 96.41 | |
| KOG0254|consensus | 513 | 96.41 | ||
| PRK09874 | 408 | drug efflux system protein MdtG; Provisional | 96.38 | |
| PRK11273 | 452 | glpT sn-glycerol-3-phosphate transporter; Provisio | 96.38 | |
| PRK09556 | 467 | uhpT sugar phosphate antiporter; Reviewed | 96.24 | |
| PRK15034 | 462 | nitrate/nitrite transport protein NarU; Provisiona | 96.23 | |
| PRK11043 | 401 | putative transporter; Provisional | 96.21 | |
| KOG2615|consensus | 451 | 96.18 | ||
| PRK10489 | 417 | enterobactin exporter EntS; Provisional | 96.17 | |
| TIGR00806 | 511 | rfc RFC reduced folate carrier. Proteins of the RF | 96.1 | |
| PRK10207 | 489 | dipeptide/tripeptide permease B; Provisional | 96.09 | |
| PRK11652 | 394 | emrD multidrug resistance protein D; Provisional | 96.09 | |
| PRK10133 | 438 | L-fucose transporter; Provisional | 96.07 | |
| PRK15034 | 462 | nitrate/nitrite transport protein NarU; Provisiona | 96.06 | |
| PRK06814 | 1140 | acylglycerophosphoethanolamine acyltransferase; Pr | 96.05 | |
| TIGR00890 | 377 | 2A0111 Oxalate/Formate Antiporter. | 96.02 | |
| TIGR00924 | 475 | yjdL_sub1_fam amino acid/peptide transporter (Pept | 96.0 | |
| PRK10504 | 471 | putative transporter; Provisional | 95.98 | |
| PRK03699 | 394 | putative transporter; Provisional | 95.96 | |
| TIGR00792 | 437 | gph sugar (Glycoside-Pentoside-Hexuronide) transpo | 95.95 | |
| TIGR00892 | 455 | 2A0113 monocarboxylate transporter 1. | 95.93 | |
| PRK09528 | 420 | lacY galactoside permease; Reviewed | 95.83 | |
| TIGR00896 | 355 | CynX cyanate transporter. This family of proteins | 95.82 | |
| PF11700 | 477 | ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 | 95.78 | |
| TIGR00897 | 402 | 2A0118 polyol permease family. This family of prot | 95.61 | |
| PRK08633 | 1146 | 2-acyl-glycerophospho-ethanolamine acyltransferase | 95.56 | |
| COG2223 | 417 | NarK Nitrate/nitrite transporter [Inorganic ion tr | 95.47 | |
| PLN00028 | 476 | nitrate transmembrane transporter; Provisional | 95.46 | |
| PRK09584 | 500 | tppB putative tripeptide transporter permease; Rev | 95.45 | |
| COG2270 | 438 | Permeases of the major facilitator superfamily [Ge | 95.38 | |
| PTZ00207 | 591 | hypothetical protein; Provisional | 95.36 | |
| PF05977 | 524 | MFS_3: Transmembrane secretion effector; InterPro: | 95.33 | |
| PF11700 | 477 | ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 | 95.29 | |
| PRK11010 | 491 | ampG muropeptide transporter; Validated | 95.26 | |
| PRK03545 | 390 | putative arabinose transporter; Provisional | 95.25 | |
| TIGR00710 | 385 | efflux_Bcr_CflA drug resistance transporter, Bcr/C | 95.23 | |
| PF00083 | 451 | Sugar_tr: Sugar (and other) transporter; InterPro: | 95.09 | |
| PRK09705 | 393 | cynX putative cyanate transporter; Provisional | 95.04 | |
| PRK14995 | 495 | methyl viologen resistance protein SmvA; Provision | 95.02 | |
| TIGR00899 | 375 | 2A0120 sugar efflux transporter. This family of pr | 95.01 | |
| TIGR00712 | 438 | glpT glycerol-3-phosphate transporter. This model | 94.99 | |
| PRK09874 | 408 | drug efflux system protein MdtG; Provisional | 94.98 | |
| PF06609 | 599 | TRI12: Fungal trichothecene efflux pump (TRI12); I | 94.84 | |
| PRK11646 | 400 | multidrug resistance protein MdtH; Provisional | 94.79 | |
| PRK10429 | 473 | melibiose:sodium symporter; Provisional | 94.65 | |
| TIGR00892 | 455 | 2A0113 monocarboxylate transporter 1. | 94.5 | |
| TIGR02718 | 390 | sider_RhtX_FptX siderophore transporter, RhtX/FptX | 94.38 | |
| TIGR00882 | 396 | 2A0105 oligosaccharide:H+ symporter. | 94.36 | |
| TIGR00885 | 410 | fucP L-fucose:H+ symporter permease. This family d | 94.28 | |
| COG2271 | 448 | UhpC Sugar phosphate permease [Carbohydrate transp | 94.2 | |
| TIGR00792 | 437 | gph sugar (Glycoside-Pentoside-Hexuronide) transpo | 94.16 | |
| TIGR01272 | 310 | gluP glucose/galactose transporter. Disruption of | 94.11 | |
| PRK11043 | 401 | putative transporter; Provisional | 94.11 | |
| COG2223 | 417 | NarK Nitrate/nitrite transporter [Inorganic ion tr | 93.56 | |
| COG2814 | 394 | AraJ Arabinose efflux permease [Carbohydrate trans | 93.54 | |
| TIGR00902 | 382 | 2A0127 phenyl proprionate permease family protein. | 93.38 | |
| PRK11102 | 377 | bicyclomycin/multidrug efflux system; Provisional | 93.31 | |
| TIGR00805 | 633 | oat sodium-independent organic anion transporter. | 92.96 | |
| TIGR00896 | 355 | CynX cyanate transporter. This family of proteins | 92.59 | |
| PRK09669 | 444 | putative symporter YagG; Provisional | 92.47 | |
| KOG3764|consensus | 464 | 92.32 | ||
| PRK03633 | 381 | putative MFS family transporter protein; Provision | 92.3 | |
| PRK09669 | 444 | putative symporter YagG; Provisional | 92.23 | |
| TIGR00894 | 465 | 2A0114euk Na(+)-dependent inorganic phosphate cotr | 92.2 | |
| KOG1330|consensus | 493 | 92.07 | ||
| PRK15011 | 393 | sugar efflux transporter B; Provisional | 92.0 | |
| PRK11462 | 460 | putative transporter; Provisional | 91.4 | |
| PRK10429 | 473 | melibiose:sodium symporter; Provisional | 91.06 | |
| PRK10054 | 395 | putative transporter; Provisional | 90.8 | |
| KOG2532|consensus | 466 | 90.62 | ||
| PF13347 | 428 | MFS_2: MFS/sugar transport protein | 90.47 | |
| PF05977 | 524 | MFS_3: Transmembrane secretion effector; InterPro: | 90.27 | |
| PF03825 | 400 | Nuc_H_symport: Nucleoside H+ symporter | 89.76 | |
| PRK11902 | 402 | ampG muropeptide transporter; Reviewed | 89.63 | |
| PRK11128 | 382 | putative 3-phenylpropionic acid transporter; Provi | 89.37 | |
| PRK10091 | 382 | MFS transport protein AraJ; Provisional | 89.01 | |
| PF05978 | 156 | UNC-93: Ion channel regulatory protein UNC-93; Int | 88.65 | |
| PRK11652 | 394 | emrD multidrug resistance protein D; Provisional | 87.99 | |
| PRK10133 | 438 | L-fucose transporter; Provisional | 87.83 | |
| PRK09848 | 448 | glucuronide transporter; Provisional | 87.79 | |
| PRK06814 | 1140 | acylglycerophosphoethanolamine acyltransferase; Pr | 87.73 | |
| COG2271 | 448 | UhpC Sugar phosphate permease [Carbohydrate transp | 87.58 | |
| PRK11462 | 460 | putative transporter; Provisional | 87.35 | |
| PRK15402 | 406 | multidrug efflux system translocase MdfA; Provisio | 87.23 | |
| KOG1330|consensus | 493 | 86.88 | ||
| KOG2504|consensus | 509 | 86.78 | ||
| TIGR00882 | 396 | 2A0105 oligosaccharide:H+ symporter. | 86.65 | |
| PF06813 | 250 | Nodulin-like: Nodulin-like; InterPro: IPR010658 Th | 86.59 | |
| PRK09528 | 420 | lacY galactoside permease; Reviewed | 86.26 | |
| PF13347 | 428 | MFS_2: MFS/sugar transport protein | 84.84 | |
| COG0738 | 422 | FucP Fucose permease [Carbohydrate transport and m | 84.68 | |
| PRK10213 | 394 | nepI ribonucleoside transporter; Reviewed | 82.06 | |
| TIGR02718 | 390 | sider_RhtX_FptX siderophore transporter, RhtX/FptX | 82.02 | |
| PRK10473 | 392 | multidrug efflux system protein MdtL; Provisional | 81.46 | |
| COG2211 | 467 | MelB Na+/melibiose symporter and related transport | 81.04 |
| >TIGR00898 2A0119 cation transport protein | Back alignment and domain information |
|---|
Probab=99.50 E-value=1.3e-14 Score=131.45 Aligned_cols=110 Identities=26% Similarity=0.495 Sum_probs=84.3
Q ss_pred cccccccccCcccCcCCCCCcccccccccCCCC-CCCCcceeecCCCCCC---CCCCCC----CCCCCcccC-CCeeeCC
Q psy14099 110 VLGDSRCLIPECEHAANTSYLTPWLNHAVPYKD-GYPQNCFRYGHIGEGN---GCNPTS----FNKSHVIKC-NAWVFQT 180 (224)
Q Consensus 110 ~~p~~~C~~p~~~~~~n~~~~~~~~n~tiP~~~-~~~~~C~~y~~~~~~~---~~~~~~----~~~~~~~~C-~~w~yd~ 180 (224)
.+|||||+.|+.. +.+ .+++++.++|.+. +++++|++|+.++... .+.... .......+| ++|+|+.
T Consensus 33 ~~p~~~c~~~~~~---~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 108 (505)
T TIGR00898 33 ATPEHHCRLPDAA---NLS-SRCELNLTLPRLPDGRPESCLRFMVDQWANPSLLGCEPLKLSDLGLAATEPCLDGWEYSY 108 (505)
T ss_pred CCCCcccCCCCcc---cCC-hHhHhceeccCCCCCCCCCCccccccchhhhcccccccchhcccCCCCCCCCCCCcEecC
Confidence 5899999998543 323 3357888888765 5789999998863221 111110 011345688 8999997
Q ss_pred C--ccccccccccccccchhhhhHHHHHHHHhhhhccceeeeccCC
Q psy14099 181 D--EVNLLNEFNLECDENRWKLTIVGSIDGLGALLGSPFCAFISDK 224 (224)
Q Consensus 181 ~--~~tivte~~lVC~~~~~~~~~~~s~~~~G~~~G~~~~G~lsDr 224 (224)
+ ..++++||||+| |++++..+.++++++|.++|++++|+++||
T Consensus 109 ~~~~~~i~~e~~l~c-~~~~~~~~~~s~~~~g~~~g~~~~g~l~Dr 153 (505)
T TIGR00898 109 DTFSSTIVTEWDLVC-EDAWKVDLTQSCFFVGVLLGSFVFGYLSDR 153 (505)
T ss_pred CcccccEEEEeccee-chHHHHHHHHHHHHHHHHHHHHhHHHhhhh
Confidence 6 589999999999 899999999999999999999999999997
|
|
| >KOG0253|consensus | Back alignment and domain information |
|---|
| >KOG0255|consensus | Back alignment and domain information |
|---|
| >TIGR01299 synapt_SV2 synaptic vesicle protein SV2 | Back alignment and domain information |
|---|
| >TIGR00898 2A0119 cation transport protein | Back alignment and domain information |
|---|
| >TIGR00887 2A0109 phosphate:H+ symporter | Back alignment and domain information |
|---|
| >KOG0255|consensus | Back alignment and domain information |
|---|
| >PRK09952 shikimate transporter; Provisional | Back alignment and domain information |
|---|
| >PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters | Back alignment and domain information |
|---|
| >PRK10642 proline/glycine betaine transporter; Provisional | Back alignment and domain information |
|---|
| >KOG0254|consensus | Back alignment and domain information |
|---|
| >KOG0252|consensus | Back alignment and domain information |
|---|
| >KOG0569|consensus | Back alignment and domain information |
|---|
| >TIGR00880 2_A_01_02 Multidrug resistance protein | Back alignment and domain information |
|---|
| >PRK10406 alpha-ketoglutarate transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10077 xylE D-xylose transporter XylE; Provisional | Back alignment and domain information |
|---|
| >TIGR00903 2A0129 major facilitator 4 family protein | Back alignment and domain information |
|---|
| >TIGR00887 2A0109 phosphate:H+ symporter | Back alignment and domain information |
|---|
| >TIGR01299 synapt_SV2 synaptic vesicle protein SV2 | Back alignment and domain information |
|---|
| >TIGR00895 2A0115 benzoate transport | Back alignment and domain information |
|---|
| >PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional | Back alignment and domain information |
|---|
| >TIGR00891 2A0112 putative sialic acid transporter | Back alignment and domain information |
|---|
| >PRK15462 dipeptide/tripeptide permease D; Provisional | Back alignment and domain information |
|---|
| >PRK15075 citrate-proton symporter; Provisional | Back alignment and domain information |
|---|
| >PRK12307 putative sialic acid transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00879 SP MFS transporter, sugar porter (SP) family | Back alignment and domain information |
|---|
| >TIGR00890 2A0111 Oxalate/Formate Antiporter | Back alignment and domain information |
|---|
| >TIGR00893 2A0114 d-galactonate transporter | Back alignment and domain information |
|---|
| >TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily | Back alignment and domain information |
|---|
| >PRK15075 citrate-proton symporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00900 2A0121 H+ Antiporter protein | Back alignment and domain information |
|---|
| >TIGR00879 SP MFS transporter, sugar porter (SP) family | Back alignment and domain information |
|---|
| >TIGR02332 HpaX 4-hydroxyphenylacetate permease | Back alignment and domain information |
|---|
| >TIGR00895 2A0115 benzoate transport | Back alignment and domain information |
|---|
| >PRK10473 multidrug efflux system protein MdtL; Provisional | Back alignment and domain information |
|---|
| >TIGR02332 HpaX 4-hydroxyphenylacetate permease | Back alignment and domain information |
|---|
| >PRK11102 bicyclomycin/multidrug efflux system; Provisional | Back alignment and domain information |
|---|
| >PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional | Back alignment and domain information |
|---|
| >TIGR00891 2A0112 putative sialic acid transporter | Back alignment and domain information |
|---|
| >PRK10642 proline/glycine betaine transporter; Provisional | Back alignment and domain information |
|---|
| >PRK12307 putative sialic acid transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00900 2A0121 H+ Antiporter protein | Back alignment and domain information |
|---|
| >PRK03699 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11663 regulatory protein UhpC; Provisional | Back alignment and domain information |
|---|
| >TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily | Back alignment and domain information |
|---|
| >TIGR00883 2A0106 metabolite-proton symporter | Back alignment and domain information |
|---|
| >PRK10077 xylE D-xylose transporter XylE; Provisional | Back alignment and domain information |
|---|
| >PRK03893 putative sialic acid transporter; Provisional | Back alignment and domain information |
|---|
| >cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters | Back alignment and domain information |
|---|
| >PRK09556 uhpT sugar phosphate antiporter; Reviewed | Back alignment and domain information |
|---|
| >PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms | Back alignment and domain information |
|---|
| >PRK15403 multidrug efflux system protein MdtM; Provisional | Back alignment and domain information |
|---|
| >TIGR00889 2A0110 nucleoside transporter | Back alignment and domain information |
|---|
| >cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters | Back alignment and domain information |
|---|
| >PRK10054 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10213 nepI ribonucleoside transporter; Reviewed | Back alignment and domain information |
|---|
| >PRK03545 putative arabinose transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10504 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK09952 shikimate transporter; Provisional | Back alignment and domain information |
|---|
| >PLN00028 nitrate transmembrane transporter; Provisional | Back alignment and domain information |
|---|
| >PRK03893 putative sialic acid transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10406 alpha-ketoglutarate transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00881 2A0104 phosphoglycerate transporter family protein | Back alignment and domain information |
|---|
| >PRK11646 multidrug resistance protein MdtH; Provisional | Back alignment and domain information |
|---|
| >TIGR00881 2A0104 phosphoglycerate transporter family protein | Back alignment and domain information |
|---|
| >PRK15402 multidrug efflux system translocase MdfA; Provisional | Back alignment and domain information |
|---|
| >TIGR00901 2A0125 AmpG-related permease | Back alignment and domain information |
|---|
| >TIGR00901 2A0125 AmpG-related permease | Back alignment and domain information |
|---|
| >PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK11663 regulatory protein UhpC; Provisional | Back alignment and domain information |
|---|
| >TIGR00893 2A0114 d-galactonate transporter | Back alignment and domain information |
|---|
| >TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter | Back alignment and domain information |
|---|
| >TIGR00903 2A0129 major facilitator 4 family protein | Back alignment and domain information |
|---|
| >TIGR00712 glpT glycerol-3-phosphate transporter | Back alignment and domain information |
|---|
| >TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) | Back alignment and domain information |
|---|
| >PRK10489 enterobactin exporter EntS; Provisional | Back alignment and domain information |
|---|
| >TIGR00899 2A0120 sugar efflux transporter | Back alignment and domain information |
|---|
| >TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily | Back alignment and domain information |
|---|
| >PRK15011 sugar efflux transporter B; Provisional | Back alignment and domain information |
|---|
| >PRK05122 major facilitator superfamily transporter; Provisional | Back alignment and domain information |
|---|
| >KOG0569|consensus | Back alignment and domain information |
|---|
| >PRK12382 putative transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00885 fucP L-fucose:H+ symporter permease | Back alignment and domain information |
|---|
| >PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms | Back alignment and domain information |
|---|
| >PRK11010 ampG muropeptide transporter; Validated | Back alignment and domain information |
|---|
| >TIGR00883 2A0106 metabolite-proton symporter | Back alignment and domain information |
|---|
| >PRK10091 MFS transport protein AraJ; Provisional | Back alignment and domain information |
|---|
| >PRK11195 lysophospholipid transporter LplT; Provisional | Back alignment and domain information |
|---|
| >PRK14995 methyl viologen resistance protein SmvA; Provisional | Back alignment and domain information |
|---|
| >PRK12382 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK03633 putative MFS family transporter protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00897 2A0118 polyol permease family | Back alignment and domain information |
|---|
| >PRK09705 cynX putative cyanate transporter; Provisional | Back alignment and domain information |
|---|
| >PRK05122 major facilitator superfamily transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) | Back alignment and domain information |
|---|
| >PRK11902 ampG muropeptide transporter; Reviewed | Back alignment and domain information |
|---|
| >TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter | Back alignment and domain information |
|---|
| >KOG0254|consensus | Back alignment and domain information |
|---|
| >PRK09874 drug efflux system protein MdtG; Provisional | Back alignment and domain information |
|---|
| >PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional | Back alignment and domain information |
|---|
| >PRK09556 uhpT sugar phosphate antiporter; Reviewed | Back alignment and domain information |
|---|
| >PRK15034 nitrate/nitrite transport protein NarU; Provisional | Back alignment and domain information |
|---|
| >PRK11043 putative transporter; Provisional | Back alignment and domain information |
|---|
| >KOG2615|consensus | Back alignment and domain information |
|---|
| >PRK10489 enterobactin exporter EntS; Provisional | Back alignment and domain information |
|---|
| >TIGR00806 rfc RFC reduced folate carrier | Back alignment and domain information |
|---|
| >PRK10207 dipeptide/tripeptide permease B; Provisional | Back alignment and domain information |
|---|
| >PRK11652 emrD multidrug resistance protein D; Provisional | Back alignment and domain information |
|---|
| >PRK10133 L-fucose transporter; Provisional | Back alignment and domain information |
|---|
| >PRK15034 nitrate/nitrite transport protein NarU; Provisional | Back alignment and domain information |
|---|
| >PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00890 2A0111 Oxalate/Formate Antiporter | Back alignment and domain information |
|---|
| >TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial | Back alignment and domain information |
|---|
| >PRK10504 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK03699 putative transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter | Back alignment and domain information |
|---|
| >TIGR00892 2A0113 monocarboxylate transporter 1 | Back alignment and domain information |
|---|
| >PRK09528 lacY galactoside permease; Reviewed | Back alignment and domain information |
|---|
| >TIGR00896 CynX cyanate transporter | Back alignment and domain information |
|---|
| >PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions | Back alignment and domain information |
|---|
| >TIGR00897 2A0118 polyol permease family | Back alignment and domain information |
|---|
| >PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN00028 nitrate transmembrane transporter; Provisional | Back alignment and domain information |
|---|
| >PRK09584 tppB putative tripeptide transporter permease; Reviewed | Back alignment and domain information |
|---|
| >COG2270 Permeases of the major facilitator superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00207 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily | Back alignment and domain information |
|---|
| >PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions | Back alignment and domain information |
|---|
| >PRK11010 ampG muropeptide transporter; Validated | Back alignment and domain information |
|---|
| >PRK03545 putative arabinose transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily | Back alignment and domain information |
|---|
| >PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters | Back alignment and domain information |
|---|
| >PRK09705 cynX putative cyanate transporter; Provisional | Back alignment and domain information |
|---|
| >PRK14995 methyl viologen resistance protein SmvA; Provisional | Back alignment and domain information |
|---|
| >TIGR00899 2A0120 sugar efflux transporter | Back alignment and domain information |
|---|
| >TIGR00712 glpT glycerol-3-phosphate transporter | Back alignment and domain information |
|---|
| >PRK09874 drug efflux system protein MdtG; Provisional | Back alignment and domain information |
|---|
| >PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins | Back alignment and domain information |
|---|
| >PRK11646 multidrug resistance protein MdtH; Provisional | Back alignment and domain information |
|---|
| >PRK10429 melibiose:sodium symporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00892 2A0113 monocarboxylate transporter 1 | Back alignment and domain information |
|---|
| >TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family | Back alignment and domain information |
|---|
| >TIGR00882 2A0105 oligosaccharide:H+ symporter | Back alignment and domain information |
|---|
| >TIGR00885 fucP L-fucose:H+ symporter permease | Back alignment and domain information |
|---|
| >COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter | Back alignment and domain information |
|---|
| >TIGR01272 gluP glucose/galactose transporter | Back alignment and domain information |
|---|
| >PRK11043 putative transporter; Provisional | Back alignment and domain information |
|---|
| >COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00902 2A0127 phenyl proprionate permease family protein | Back alignment and domain information |
|---|
| >PRK11102 bicyclomycin/multidrug efflux system; Provisional | Back alignment and domain information |
|---|
| >TIGR00805 oat sodium-independent organic anion transporter | Back alignment and domain information |
|---|
| >TIGR00896 CynX cyanate transporter | Back alignment and domain information |
|---|
| >PRK09669 putative symporter YagG; Provisional | Back alignment and domain information |
|---|
| >KOG3764|consensus | Back alignment and domain information |
|---|
| >PRK03633 putative MFS family transporter protein; Provisional | Back alignment and domain information |
|---|
| >PRK09669 putative symporter YagG; Provisional | Back alignment and domain information |
|---|
| >TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter | Back alignment and domain information |
|---|
| >KOG1330|consensus | Back alignment and domain information |
|---|
| >PRK15011 sugar efflux transporter B; Provisional | Back alignment and domain information |
|---|
| >PRK11462 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10429 melibiose:sodium symporter; Provisional | Back alignment and domain information |
|---|
| >PRK10054 putative transporter; Provisional | Back alignment and domain information |
|---|
| >KOG2532|consensus | Back alignment and domain information |
|---|
| >PF13347 MFS_2: MFS/sugar transport protein | Back alignment and domain information |
|---|
| >PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily | Back alignment and domain information |
|---|
| >PF03825 Nuc_H_symport: Nucleoside H+ symporter | Back alignment and domain information |
|---|
| >PRK11902 ampG muropeptide transporter; Reviewed | Back alignment and domain information |
|---|
| >PRK11128 putative 3-phenylpropionic acid transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10091 MFS transport protein AraJ; Provisional | Back alignment and domain information |
|---|
| >PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans | Back alignment and domain information |
|---|
| >PRK11652 emrD multidrug resistance protein D; Provisional | Back alignment and domain information |
|---|
| >PRK10133 L-fucose transporter; Provisional | Back alignment and domain information |
|---|
| >PRK09848 glucuronide transporter; Provisional | Back alignment and domain information |
|---|
| >PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11462 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK15402 multidrug efflux system translocase MdfA; Provisional | Back alignment and domain information |
|---|
| >KOG1330|consensus | Back alignment and domain information |
|---|
| >KOG2504|consensus | Back alignment and domain information |
|---|
| >TIGR00882 2A0105 oligosaccharide:H+ symporter | Back alignment and domain information |
|---|
| >PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins | Back alignment and domain information |
|---|
| >PRK09528 lacY galactoside permease; Reviewed | Back alignment and domain information |
|---|
| >PF13347 MFS_2: MFS/sugar transport protein | Back alignment and domain information |
|---|
| >COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10213 nepI ribonucleoside transporter; Reviewed | Back alignment and domain information |
|---|
| >TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family | Back alignment and domain information |
|---|
| >PRK10473 multidrug efflux system protein MdtL; Provisional | Back alignment and domain information |
|---|
| >COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 224 | |||
| 4gc0_A | 491 | D-xylose-proton symporter; MFS, transport protein; | 98.88 | |
| 2cfq_A | 417 | Lactose permease; transport, transport mechanism, | 97.84 | |
| 3o7q_A | 438 | L-fucose-proton symporter; transporter, multi-PASS | 97.78 | |
| 1pw4_A | 451 | Glycerol-3-phosphate transporter; transmembrane, i | 97.64 | |
| 1pw4_A | 451 | Glycerol-3-phosphate transporter; transmembrane, i | 97.44 | |
| 4aps_A | 491 | DI-OR tripeptide H+ symporter; transport protein, | 97.44 | |
| 4gc0_A | 491 | D-xylose-proton symporter; MFS, transport protein; | 97.44 | |
| 2xut_A | 524 | Proton/peptide symporter family protein; transport | 97.11 | |
| 2gfp_A | 375 | EMRD, multidrug resistance protein D; membrane pro | 97.08 | |
| 3o7q_A | 438 | L-fucose-proton symporter; transporter, multi-PASS | 97.03 | |
| 4aps_A | 491 | DI-OR tripeptide H+ symporter; transport protein, | 96.83 | |
| 2gfp_A | 375 | EMRD, multidrug resistance protein D; membrane pro | 94.69 | |
| 2xut_A | 524 | Proton/peptide symporter family protein; transport | 94.22 |
| >4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* | Back alignment and structure |
|---|
Probab=98.88 E-value=2.8e-09 Score=94.10 Aligned_cols=99 Identities=16% Similarity=0.222 Sum_probs=62.2
Q ss_pred hhhHHHHhcccchHHHHHHHHHHHHHHHHHHHHhhcccCCCCCchhHHHHHHHHHHHHHHHHhh-hhHhhhcccccchHH
Q psy14099 3 RIVCIWMDHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLHHVVFRQTLFLIGITGITSAY-TVLYVNTVDMFPTPL 81 (224)
Q Consensus 3 ~l~~~~~~~~~gRr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~ElfPt~v 81 (224)
.+++..+.||.|||+.++.+..++.+.+..+..... . . ......++..++...+++..+ .+.|+|.+|+|||++
T Consensus 329 ~~~~~~l~dr~Grr~~~~~~~~~~~~~~~~l~~~~~---~-~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~fPt~~ 403 (491)
T 4gc0_A 329 TVLAIMTVDKFGRKPLQIIGALGMAIGMFSLGTAFY---T-Q-APGIVALLSMLFYVAAFAMSWGPVCWVLLSEIFPNAI 403 (491)
T ss_dssp HHHHHHHHHHHCSHHHHHHHHHHHHHHHHHHHHHHH---T-T-CCHHHHHHHHHHHHHHHHTTTTHHHHHHHHHSSCTTT
T ss_pred HHHHHHHHHhhcCcchhccchHHHHHHHHHHHHHHh---c-c-cchHHHHHHHHHHHHHHHhHHHHHHHHHHHHhCCHhH
Confidence 456777888988888766644333322221211111 1 1 112222333333333444444 357899999999999
Q ss_pred HHHHHHHHHHHHhhhcccccceeeh
Q psy14099 82 RQSLLAFCSMIGRIGQVIAPQVFLL 106 (224)
Q Consensus 82 R~~g~g~~~~~~~~~~~~~~~~~~~ 106 (224)
|++|+|+++..+++++.+++++.+.
T Consensus 404 R~~~~g~~~~~~~~~~~i~~~~~p~ 428 (491)
T 4gc0_A 404 RGKALAIAVAAQWLANYFVSWTFPM 428 (491)
T ss_dssp HHHHHHHHHHHHHHHHHHHHTHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 9999999999999999988876643
|
| >2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* | Back alignment and structure |
|---|
| >3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* | Back alignment and structure |
|---|
| >1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 | Back alignment and structure |
|---|
| >1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 | Back alignment and structure |
|---|
| >4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* | Back alignment and structure |
|---|
| >2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* | Back alignment and structure |
|---|
| >4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 224 | |||
| d1pw4a_ | 447 | Glycerol-3-phosphate transporter {Escherichia coli | 97.63 | |
| d1pv7a_ | 417 | Lactose permease {Escherichia coli [TaxId: 562]} | 97.61 | |
| d1pw4a_ | 447 | Glycerol-3-phosphate transporter {Escherichia coli | 97.32 |
| >d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: MFS general substrate transporter superfamily: MFS general substrate transporter family: Glycerol-3-phosphate transporter domain: Glycerol-3-phosphate transporter species: Escherichia coli [TaxId: 562]
Probab=97.63 E-value=5.4e-05 Score=62.82 Aligned_cols=98 Identities=10% Similarity=0.064 Sum_probs=59.6
Q ss_pred hhhHHHHhcccchHHHHHHHHHHHHHHHHHHHHhhcccCCCCCchhHHHHHHHHHHHHHHHHhhhhHhhhcccccchHHH
Q psy14099 3 RIVCIWMDHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLHHVVFRQTLFLIGITGITSAYTVLYVNTVDMFPTPLR 82 (224)
Q Consensus 3 ~l~~~~~~~~~gRr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ElfPt~vR 82 (224)
.++...+.||.|||+.+..+.....+...+.. +.... .+. .....+.-++..++.+..+.....+.+|.+|.+.|
T Consensus 76 ~~~~G~l~Dr~g~r~~~~~~~~~~~~~~~~~~--~~~~~--~~~-~~~~~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~r 150 (447)
T d1pw4a_ 76 KFIMGSVSDRSNPRVFLPAGLILAAAVMLFMG--FVPWA--TSS-IAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKER 150 (447)
T ss_dssp HHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHH--HCHHH--HSS-SSHHHHHHHHHHHHHHHTHHHHHHHHHTTCTTTHH
T ss_pred HHHHHHHHHHcCchHHHHHHHHHHHHHHhhcc--ccchh--hhh-HHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHhhcc
Confidence 34556677888888876653332222111111 11000 011 12233333444445555666788999999999999
Q ss_pred HHHHHHHHHHHhhhcccccceee
Q psy14099 83 QSLLAFCSMIGRIGQVIAPQVFL 105 (224)
Q Consensus 83 ~~g~g~~~~~~~~~~~~~~~~~~ 105 (224)
++.+|+.+....+|+.++|.+..
T Consensus 151 ~~~~~~~~~~~~~g~~i~~~~~~ 173 (447)
T d1pw4a_ 151 GGIVSVWNCAHNVGGGIPPLLFL 173 (447)
T ss_dssp HHHHHHHHHHHHHHHTSHHHHHH
T ss_pred cccccccccccchhhhhhhhhhh
Confidence 99999999999999888886554
|
| >d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|