Psyllid ID: psy14118

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760------
LGEKGSGLRPRGRIGEVQDFAAIRDRCLSQGTLFEDPDFPCDDSSIFYSKMPPKSFEWMRPMYGRWVDVVIDDRLPTYYGKLVFLHSSTDNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEMYELNEAPSNLWQILLKAHERSSLMGCSIEPDPSVLEMQTPQGLVKGHAYSITRIKYVDISTPNTSGKIPLIRMRNPWGNEAEWNGAWSDKSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRLEICNLSPDSLIEDAMSRDRGKKWEMSVYEGEWVRGVTAGGSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRLEICNLSPDSLIEDAMSRDRGKKWEMSVYEGEWVRGVTAGGCRNYLETFWCNPQFKITLTEVDENDEDGKCTVIIGLMQKNRRAQKKTGAECLTIGFAVYQIEDPDNVPTPLDLNFFKYNASCARAPSFINLREVSCRFKLPPGVYCIVPSTFEPNEEGEFILRVFSEHKNNMEENDEEVGMGEIDNRIQIPDEPQPEKEKKTEAIRQFFQKLAGDDMEVDWMELKDILDYAMRNETKTTTEGGFSKDVCRNVPANTSTTDSPATGIVGNLLALICGNACRDTPLGAALETKTTTEGGFSKDVCRSMVAMLDVDRSGKLGFEEFQQLWKDIRNWKSVFKMYDQENSGYLSPFELRQALTSAGYHLNNHILNILAHRYSGRDARISFDDFMMCAVRLKTMIDLFKARDPSSTNKATFTLEEWVENTLYS
ccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccEEEEcEEccEEEEEEcccccccccccEEEEEcccccccHHHHHHHHHcccccccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHcccccEEEEccccccccccccccccccccEEEEEEEEEEEcccccccccEEEEEEEccccccccccccccccccccccccHHHHHHccccccccccEEEEEcccEEEcEEEEEEEccccccccccccccccccEEEEEEEEEEEcccccccccccccccHHHHHHcccccccccccccccccHHcccEEEEEEEccccccccccccccccccEEEEEEEcEEEEcccccccccccccccccccEEEEEEEcccccccccEEEEEEEEEcccHHHHcccccccEEEEEEEEEcccccccccccccccccccccccccccccccEEEEEEEcccccEEEccccccccccccEEEEEEEccccccEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEcHHHHHHHHHcc
cccccccccccccccHHHHHHHHHHHccccHHcccccccccccEEEEcccccccEEEEEEEEccEEEEEEEEccEEEEccEEcccEcccccEcHHHHHHHHHHHHccccHHHccccHHHHHHHHHccEEEEEEHHHccccHHHHHHHHHHHccEEEEEccccHHHHHHHHHHHHHcccEEEEEccEEEEEccccccccEEEEEEEccccccEEEcccccccccccccccccHHHHcccccccccEEEEEHHHHHHHccEEEEEccHHHccccccccccccccccEEEEccccccccccccccccccccccHHHHcccccccccEEEEEHHHHHHHccEEEEEccHHHccHHHccccccccccEcccccEEEcccccccccccccccHHHccccEEEcccccccccccccEEEHHHHHHHHHHHHHcccccEEEEEEEEEccccccccccccHHHHHHccccccccccEcccEEccEEEccccEEEEEEEEccccccEEEEEEEEEcccccEEccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHcHcHcccccccHHHHHHHHHHHcccccccEcHHHHHHHHHHHHHHHHHHHHHcccccccEccccHHHHHHHccccccHHHHHHHHHHHccccccEcHHHHHHHHHHHHHHHHHHHHHccccccEEEEcHHHHHHHHHcc
lgekgsglrprgrigevqDFAAIRDRclsqgtlfedpdfpcddssifyskmppksfewmrpmygrwvdvviddrlptyyGKLVFLHSSTDNEFWSALLEKAYAKLHGSyealkggstceamEDFTGGVSEMYELNEAPSNLWQILLKAHersslmgcsiepdpsvlemqtpqglvkghaYSITRIKyvdistpntsgkiplirmrnpwgneaewngawsdksqewrfipdhekrelgltfdddgeFWMSYKDFLKYFSRLeicnlspdsliedamsrdrgkkwEMSVYEGEWvrgvtaggsqewrfipdhekrelgltfdddgeFWMSYKDFLKYFSRLeicnlspdsliedamsrdrgkkwEMSVYEGEWvrgvtaggcrnyletfwcnpqfkitltevdendedgkCTVIIGLMQKNrraqkktgaecLTIGFAVyqiedpdnvptpldlnffkynascarapsfinlrevscrfklppgvycivpstfepneeGEFILRVFSEHKnnmeendeevgmgeidnriqipdepqpekeKKTEAIRQFFQKLAGDDMEVDWMELKDILDYAMRnetkttteggfskdvcrnvpantsttdspatgiVGNLLALICGnacrdtplgaaletkttteggfskDVCRSMVAMldvdrsgklgFEEFQQLWKDIRNWKSVFKMYdqensgylspFELRQALTSAGYHLNNHILNILAHrysgrdarisfDDFMMCAVRLKTMIDLfkardpsstnkatfTLEEWVENTLYS
lgekgsglrprgrigevqdfaAIRDRCLSQGTLFEDPDFPCDDSSIFYSKMPPKSFEWMRPMYGRWVDVVIDDRLPTYYGKLVFLHSSTDNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEMYELNEAPSNLWQILLKAHERSSLMGCSIEPDPSVLEMQTPQGLVKGHAYSITRIkyvdistpntsgkiplirMRNPWGNEAEWNGAWSDKSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRLEICNLSPDSLIEDAMSRDRGKKWEMSVYEGEwvrgvtaggsqewrfipdheKRELGLTFDDDGEFWMSYKDFLKYFSRLEICNLSPDSLIEDAMSRDRGKKWEMSVYEGEWVRGVTAGGCRNYLETFWCNPQFKITLtevdendedGKCTVIIGlmqknrraqkktgAECLTIGFAVYQIEDPDNVPTPLDLNFFKYNASCARAPSFINLREVSCRFKLPPGVYCIVPSTFEPNEEGEFILRVFSEHKNNMEEndeevgmgeidnriqipdepqpekekKTEAIRQFFQklagddmevDWMELKDILDYAMRNETkttteggfskdvcRNVPAntsttdspatgIVGNLLALICGNACRDTPLGAAletkttteggfskdvCRSMVAMLDVDRSGKLGFEEFQQLWKDIRNWKSVFKMYDQENSGYLSPFELRQALTSAGYHLNNHILNILAHRYSGRDARISFDDFMMCAVRLKTMIDLfkardpsstnkatftleewventlys
LGEKGSGLRPRGRIGEVQDFAAIRDRCLSQGTLFEDPDFPCDDSSIFYSKMPPKSFEWMRPMYGRWVDVVIDDRLPTYYGKLVFLHSSTDNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEMYELNEAPSNLWQILLKAHERSSLMGCSIEPDPSVLEMQTPQGLVKGHAYSITRIKYVDISTPNTSGKIPLIRMRNPWGNEAEWNGAWSDKSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRLEICNLSPDSLIEDAMSRDRGKKWEMSVYEGEWVRGVTAGGSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRLEICNLSPDSLIEDAMSRDRGKKWEMSVYEGEWVRGVTAGGCRNYLETFWCNPQFKITLTEVDENDEDGKCTVIIGLMQKNRRAQKKTGAECLTIGFAVYQIEDPDNVPTPLDLNFFKYNASCARAPSFINLREVSCRFKLPPGVYCIVPSTFEPNEEGEFILRVFSEHKNNMEENDEEVGMGEIDNRIQIPDEPQPEKEKKTEAIRQFFQKLAGDDMEVDWMELKDILDYAMRNETKTTTEGGFSKDVCRNVPANTSTTDSPATGIVGNLLALICGNACRDTPLGAALETKTTTEGGFSKDVCRSMVAMLDVDRSGKLGFEEFQQLWKDIRNWKSVFKMYDQENSGYLSPFELRQALTSAGYHLNNHILNILAHRYSGRDARISFDDFMMCAVRLKTMIDLFKARDPSSTNKATFTLEEWVENTLYS
**************GEVQDFAAIRDRCLSQGTLFEDPDFPCDDSSIFYSKMPPKSFEWMRPMYGRWVDVVIDDRLPTYYGKLVFLHSSTDNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEMYELNEAPSNLWQILLKAHERSSLMGCSI**********TPQGLVKGHAYSITRIKYVDISTPNTSGKIPLIRMRNPWGNEAEWNGAWSDKSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRLEICNLSPDSLIEDAM***RGKKWEMSVYEGEWVRGVTAGGSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRLEICNLSPDSLIEDAM*RDRGKKWEMSVYEGEWVRGVTAGGCRNYLETFWCNPQFKITLTEVDENDEDGKCTVIIGLMQKNRRAQKKTGAECLTIGFAVYQIEDPDNVPTPLDLNFFKYNASCARAPSFINLREVSCRFKLPPGVYCIVPSTFEPNEEGEFILRVF******************************************FFQKLAGDDMEVDWMELKDILDYAMRN************DVCR************ATGIVGNLLALICGNACRDTPLGAALETKTTTEGGFSKDVCRSMVAMLDVDRSGKLGFEEFQQLWKDIRNWKSVFKMYDQENSGYLSPFELRQALTSAGYHLNNHILNILAHRYSGRDARISFDDFMMCAVRLKTMIDLFKAR********TFTLEEWV******
***KGSGLRPRGRIGEVQDFAAIRDRCLSQGTLFEDPDFPCDDSSIFYSKMPPKSFEWMRPMYGRWVDVVIDDRLPTYYGKLVFLHSSTDNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEMYELNEAPSNLWQILLKAHERSSLMGCSIEPDPSVLEMQTPQGLVKGHAYSITRIKYVDISTPNTSGKIPLIRMRNPWGNEAEWNGAWSDKSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRLEICNLSPDSLIEDAMSRDRGKKWEMSVYEGEWVRGVTAGGSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRLEICNLSPDSLI**********KWEMSVYEGEWVRGVTAGGCRNYLETFWCNPQFKITLTEVDENDEDGKCTVIIGLMQ***********ECLTIGFAVYQIEDPDNVPTPLDLNFFKYNASCARAPSFINLREVSCRFKLPPGVYCIVPSTFEPNEEGEFILRVFSEHKNNMEENDEEVGMGEIDNRIQIPDEP*****KKTEAIRQFFQKLAGDDMEVDWMELKDILDYA****************VCRNVPANTSTTDSPATGIVGNLLALICGNACRDTPLGAALETKTTTEGGFSKDVCRSMVAMLDVDRSGKLGFEEFQQLWKDIRNWKSVFKMYDQENSGYLSPFELRQALTSAGYHLNNHILNILAHRYSGRDARISFDDFMMCAVRLKTMIDLFKARDPSSTNKATFTLEEWVENTLYS
*********PRGRIGEVQDFAAIRDRCLSQGTLFEDPDFPCDDSSIFYSKMPPKSFEWMRPMYGRWVDVVIDDRLPTYYGKLVFLHSSTDNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEMYELNEAPSNLWQILLKAHERSSLMGCSIEPDPSVLEMQTPQGLVKGHAYSITRIKYVDISTPNTSGKIPLIRMRNPWGNEAEWNGAWSDKSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRLEICNLSPDSLIEDAMSRDRGKKWEMSVYEGEWVRGVTAGGSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRLEICNLSPDSLIEDAMSRDRGKKWEMSVYEGEWVRGVTAGGCRNYLETFWCNPQFKITLTEVDENDEDGKCTVIIGLMQKNRRAQKKTGAECLTIGFAVYQIEDPDNVPTPLDLNFFKYNASCARAPSFINLREVSCRFKLPPGVYCIVPSTFEPNEEGEFILRVFSEHKNNMEENDEEVGMGEIDNRIQIPDEP********EAIRQFFQKLAGDDMEVDWMELKDILDYAMRNETKTTTEGGFSKDVCRNVPANTSTTDSPATGIVGNLLALICGNACRDTPLGAALETKTTTEGGFSKDVCRSMVAMLDVDRSGKLGFEEFQQLWKDIRNWKSVFKMYDQENSGYLSPFELRQALTSAGYHLNNHILNILAHRYSGRDARISFDDFMMCAVRLKTMIDLFKARDPSSTNKATFTLEEWVENTLYS
****GSGLRPRGRIGEVQDFAAIRDRCLSQGTLFEDPDFPCDDSSIFYSKMPPKSFEWMRPMYGRWVDVVIDDRLPTYYGKLVFLHSSTDNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEMYELNEAPSNLWQILLKAHERSSLMGCSIEPDPSVLEMQTPQGLVKGHAYSITRIKYVDISTPNTSGKIPLIRMRNPWGNEAEWNGAWSDKSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRLEICNLSPDSLIEDAMSRDRGKKWEMSVYEGEWVRGVTAGGSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRLEICNLSPDSLIEDAMSRDRGKKWEMSVYEGEWVRGVTAGGCRNYLETFWCNPQFKITLTEVDENDEDGKCTVIIGLMQKNRRAQKKTGAECLTIGFAVYQIEDPDNVPTPLDLNFFKYNASCARAPSFINLREVSCRFKLPPGVYCIVPSTFEPNEEGEFILRVFSEHKNNMEENDEEVGMGEI************EKEKKTEAIRQFFQKLAGDDMEVDWMELKDILDYAMRNETKTTTEGGFSKDVCRNVPANTSTTDSPATGIVGNLLALICGNACRDTPLGAALETKTTTEGGFSKDVCRSMVAMLDVDRSGKLGFEEFQQLWKDIRNWKSVFKMYDQENSGYLSPFELRQALTSAGYHLNNHILNILAHRYSGRDARISFDDFMMCAVRLKTMIDLFKARDPSSTNKATFTLEEWVENTLYS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LGEKGSGLRPRGRIGEVQDFAAIRDRCLSQGTLFEDPDFPCDDSSIFYSKMPPKSFEWMRPMYGRWVDVVIDDRLPTYYGKLVFLHSSTDNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEMYELNEAPSNLWQILLKAHERSSLMGCSIEPDPSVLEMQTPQGLVKGHAYSITRIKYVDISTPNTSGKIPLIRMRNPWGNEAEWNGAWSDKSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRLEICNLSPDSLIEDAMSRDRGKKWEMSVYEGEWVRGVTAGGSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRLEICNLSPDSLIEDAMSRDRGKKWEMSVYEGEWVRGVTAGGCRNYLETFWCNPQFKITLTEVDENDEDGKCTVIIGLMQKNRRAQKKTGAECLTIGFAVYQIEDPDNVPTPLDLNFFKYNASCARAPSFINLREVSCRFKLPPGVYCIVPSTFEPNEEGEFILRVFSEHKNNMEENDEEVGMGEIDNRIQIPDEPQPEKEKKTEAIRQFFQKLAGDDMEVDWMELKDILDYAMRNETKTTTEGGFSKDVCRNVPANTSTTDSPATGIVGNLLALICGNACRDTPLGAALETKTTTEGGFSKDVCRSMVAMLDVDRSGKLGFEEFQQLWKDIRNWKSVFKMYDQENSGYLSPFELRQALTSAGYHLNNHILNILAHRYSGRDARISFDDFMMCAVRLKTMIDLFKARDPSSTNKATFTLEEWVENTLYS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query766 2.2.26 [Sep-21-2011]
Q11002828 Calpain-A OS=Drosophila m yes N/A 0.616 0.570 0.552 1e-154
Q9VT65925 Calpain-B OS=Drosophila m no N/A 0.548 0.454 0.513 1e-136
P20807821 Calpain-3 OS=Homo sapiens yes N/A 0.887 0.828 0.375 1e-128
Q64691821 Calpain-3 OS=Mus musculus yes N/A 0.878 0.819 0.373 1e-128
P16259821 Calpain-3 OS=Rattus norve yes N/A 0.878 0.819 0.369 1e-127
P51186822 Calpain-3 OS=Bos taurus G yes N/A 0.892 0.832 0.369 1e-125
Q9TTH8822 Calpain-3 OS=Ovis aries G N/A N/A 0.851 0.793 0.337 1e-104
Q92177810 Calpain-3 OS=Gallus gallu yes N/A 0.588 0.556 0.388 1e-88
P43368821 Calpain-3 OS=Sus scrofa G yes N/A 0.570 0.532 0.386 2e-88
O35920690 Calpain-9 OS=Rattus norve no N/A 0.528 0.586 0.362 1e-85
>sp|Q11002|CANA_DROME Calpain-A OS=Drosophila melanogaster GN=CalpA PE=1 SV=2 Back     alignment and function desciption
 Score =  545 bits (1403), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 278/503 (55%), Positives = 348/503 (69%), Gaps = 31/503 (6%)

Query: 289 EGEWVRGVTAGGSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRLEICNLSPDS 348
           E EW  G  +  S EWR+IP+ +K E+GLTFD DGEFWMS++DFL +F R+EICNLSPDS
Sbjct: 332 EAEW-NGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDS 390

Query: 349 LIEDAMSRDRGKKWEMSVYEGEWVRGVTAGGCRNYLETFWCNPQFKITLTEVDENDEDGK 408
           L ED  +  + +KWEMS+YEGEW  GVTAGGCRN+L+TFW NPQ+ ITL + DE DE+G+
Sbjct: 391 LTEDQQNSGK-RKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQ 449

Query: 409 CTVIIGLMQKNRRAQKKTGAECLTIGFAVYQIEDPDNVPTPLDLNFFKYNASCARAPSFI 468
           CTVI+ LMQKNRR+++  G ECLTIGFA+Y + D +    P  LNFF+Y +S  R+P FI
Sbjct: 450 CTVIVALMQKNRRSKRNMGMECLTIGFAIYSLNDRELENRPQGLNFFRYKSSVGRSPHFI 509

Query: 469 NLREVSCRFKLPPGVYCIVPSTFEPNEEGEFILRVFSEHKNNMEENDEEVGMGEIDNRIQ 528
           N REV  RFKLPPG Y IVPSTF+PNEEGEFI+RVFSE +NNMEEND+ VG G   + I 
Sbjct: 510 NTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETQNNMEENDDHVGYGGKADTI- 568

Query: 529 IPDEPQPEK-EKKTEAIRQFFQKLAGDDMEVDWMELKDILDYAMRNET-KTTTEGGFSKD 586
            P  P P+  + + E +R+ F  +AG DMEVDWMELK ILD++MR++  K      FS +
Sbjct: 569 TPGFPTPKPIDPQKEGLRRLFDSIAGKDMEVDWMELKRILDHSMRDDLPKPVVFNRFSNN 628

Query: 587 VCRNVPANTSTTDSPATGIVGNLLALICGNACRDTP----LGAALETKTTTEG------- 635
           +     A     D    G  G LL+LICG   + TP    LG   ++     G       
Sbjct: 629 MAFETQAAGPGDD--GAGACG-LLSLICGPFLKGTPFEEQLGMNDQSNKRLIGDNPADGG 685

Query: 636 ------------GFSKDVCRSMVAMLDVDRSGKLGFEEFQQLWKDIRNWKSVFKMYDQEN 683
                       GFSKDVCRSMVAMLD D+SGKLGFEEF+ L  +I  WK++FK+YD EN
Sbjct: 686 PVTANAIVDETHGFSKDVCRSMVAMLDADKSGKLGFEEFETLLSEIAKWKAIFKVYDVEN 745

Query: 684 SGYLSPFELRQALTSAGYHLNNHILNILAHRYSGRDARISFDDFMMCAVRLKTMIDLFKA 743
           +G +S F+LR+AL SAGYHLNN +LN+L HRY  RD +I+FDDF+MCAV++KT ID+FK 
Sbjct: 746 TGRVSGFQLREALNSAGYHLNNRVLNVLGHRYGSRDGKIAFDDFIMCAVKIKTYIDIFKE 805

Query: 744 RDPSSTNKATFTLEEWVENTLYS 766
           RD      ATFTLEEW+E T+YS
Sbjct: 806 RDTEKNETATFTLEEWIERTIYS 828
Calcium-regulated non-lysosomal thiol-protease. Involved in the organization of the actin-related cytoskeleton during embryogenesis.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 4EC: .EC: 2EC: 2EC: .EC: -
>sp|Q9VT65|CANB_DROME Calpain-B OS=Drosophila melanogaster GN=CalpB PE=1 SV=2 Back     alignment and function description
>sp|P20807|CAN3_HUMAN Calpain-3 OS=Homo sapiens GN=CAPN3 PE=1 SV=2 Back     alignment and function description
>sp|Q64691|CAN3_MOUSE Calpain-3 OS=Mus musculus GN=Capn3 PE=2 SV=2 Back     alignment and function description
>sp|P16259|CAN3_RAT Calpain-3 OS=Rattus norvegicus GN=Capn3 PE=2 SV=1 Back     alignment and function description
>sp|P51186|CAN3_BOVIN Calpain-3 OS=Bos taurus GN=CAPN3 PE=2 SV=2 Back     alignment and function description
>sp|Q9TTH8|CAN3_SHEEP Calpain-3 OS=Ovis aries GN=CAPN3 PE=2 SV=1 Back     alignment and function description
>sp|Q92177|CAN3_CHICK Calpain-3 OS=Gallus gallus GN=CAPN3 PE=2 SV=1 Back     alignment and function description
>sp|P43368|CAN3_PIG Calpain-3 OS=Sus scrofa GN=CAPN3 PE=2 SV=2 Back     alignment and function description
>sp|O35920|CAN9_RAT Calpain-9 OS=Rattus norvegicus GN=Capn9 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query766
350413596802 PREDICTED: calpain-A-like isoform 4 [Bom 0.597 0.571 0.650 0.0
322792300801 hypothetical protein SINV_03488 [Solenop 0.601 0.575 0.650 0.0
307213062746 Calpain-A [Harpegnathos saltator] 0.599 0.615 0.642 1e-180
193690578770 PREDICTED: calpain-A-like isoform 1 [Acy 0.591 0.588 0.632 1e-175
328710544740 PREDICTED: calpain-A-like isoform 2 [Acy 0.591 0.612 0.632 1e-174
328710546806 PREDICTED: calpain-A-like isoform 3 [Acy 0.591 0.562 0.632 1e-174
332025916706 Calpain-A [Acromyrmex echinatior] 0.561 0.609 0.637 1e-167
156549579733 PREDICTED: calpain-B-like [Nasonia vitri 0.537 0.562 0.623 1e-166
380027962721 PREDICTED: calpain-A-like [Apis florea] 0.539 0.572 0.608 1e-165
383859913719 PREDICTED: calpain-B-like isoform 1 [Meg 0.539 0.574 0.610 1e-165
>gi|350413596|ref|XP_003490046.1| PREDICTED: calpain-A-like isoform 4 [Bombus impatiens] Back     alignment and taxonomy information
 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/478 (65%), Positives = 379/478 (79%), Gaps = 20/478 (4%)

Query: 289 EGEWVRGVTAGGSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRLEICNLSPDS 348
           E EW  G  +  S EWRFIPDHEK ELGLTFD DGEFWMS++DF +YF++LEICNL+PDS
Sbjct: 345 EAEW-NGPWSDQSPEWRFIPDHEKEELGLTFDMDGEFWMSFQDFTRYFTQLEICNLNPDS 403

Query: 349 LIEDAMSRDRGKKWEMSVYEGEWVRGVTAGGCRNYLETFWCNPQFKITLTEVDENDEDGK 408
           L ED ++  + KKWEMSV+EGEWVRGVTAGGCRN+LETFW NPQ++ITL   DE+D+  K
Sbjct: 404 LTEDDLNAGK-KKWEMSVFEGEWVRGVTAGGCRNFLETFWHNPQYRITLEYPDEDDD--K 460

Query: 409 CTVIIGLMQKNRRAQKKTGAECLTIGFAVYQIEDPDNVPTPLDLNFFKYNASCARAPSFI 468
           CTVI+ LMQKNRRAQ++ GAECLTIGFA+Y +E P+ +P PLD+NFFKYNAS AR+P+FI
Sbjct: 461 CTVIVALMQKNRRAQRRMGAECLTIGFAIYHLEYPERLPKPLDINFFKYNASVARSPAFI 520

Query: 469 NLREVSCRFKLPPGVYCIVPSTFEPNEEGEFILRVFSEHKNNMEENDEEVGMGEIDNRIQ 528
           NLREV+CRFKLPPG YCIVPSTF+PNEEGEF+LR+FSE+KNNMEEND+EVG+GEID+R++
Sbjct: 521 NLREVTCRFKLPPGAYCIVPSTFDPNEEGEFLLRIFSENKNNMEENDDEVGVGEIDDRVR 580

Query: 529 IPDEPQPEKEKKTEAIRQFFQKLAGDDMEVDWMELKDILDYAMRNETKTTTEGGFSKDVC 588
             +EP P++    + +R+FF+KLAGDDMEVDWMELK+ILD+AMR E   +          
Sbjct: 581 --EEPDPDR--NADKVREFFKKLAGDDMEVDWMELKEILDFAMRKELPQS---------A 627

Query: 589 RNVPANTSTTDSPATGIVGNLLALICGNACRDTPLGAALETKTTTEGGFSKDVCRSMVAM 648
           R   A+   T       +  L++L+CG  C +      +ET    + GFSKDVCRSMVAM
Sbjct: 628 RRSEAHAPETVQGNGSFIDTLISLLCGIVCNNEQYSKTVET---NDKGFSKDVCRSMVAM 684

Query: 649 LDVDRSGKLGFEEFQQLWKDIRNWKSVFKMYDQENSGYLSPFELRQALTSAGYHLNNHIL 708
           LDVD SGKLGFEEF+ LW DIR W++VFK+YD++ SGYLS FELRQAL SAGY LNNHIL
Sbjct: 685 LDVDHSGKLGFEEFRTLWNDIRKWRAVFKLYDKDESGYLSAFELRQALNSAGYRLNNHIL 744

Query: 709 NILAHRYSGRDARISFDDFMMCAVRLKTMIDLFKARDPSSTNKATFTLEEWVENTLYS 766
           NIL HRY  +D  I+FDD++MCAVRLKTMID+F+ RDP  TN ATFT+EEW+E TLYS
Sbjct: 745 NILVHRYGTKDGMITFDDYIMCAVRLKTMIDIFRERDPDLTNTATFTMEEWIEKTLYS 802

Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|322792300|gb|EFZ16284.1| hypothetical protein SINV_03488 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307213062|gb|EFN88593.1| Calpain-A [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|193690578|ref|XP_001947102.1| PREDICTED: calpain-A-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328710544|ref|XP_003244294.1| PREDICTED: calpain-A-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328710546|ref|XP_003244295.1| PREDICTED: calpain-A-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|332025916|gb|EGI66072.1| Calpain-A [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|156549579|ref|XP_001602959.1| PREDICTED: calpain-B-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380027962|ref|XP_003697681.1| PREDICTED: calpain-A-like [Apis florea] Back     alignment and taxonomy information
>gi|383859913|ref|XP_003705436.1| PREDICTED: calpain-B-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query766
FB|FBgn0012051828 CalpA "Calpain-A" [Drosophila 0.340 0.315 0.683 1.1e-167
FB|FBgn0025866925 CalpB "Calpain-B" [Drosophila 0.368 0.304 0.62 2.6e-143
UNIPROTKB|Q9GLG7815 CAPN3 "Calpain-3" [Macaca fasc 0.315 0.296 0.466 1.9e-140
UNIPROTKB|F8W8F5815 CAPN3 "Calpain-3" [Homo sapien 0.315 0.296 0.462 8.2e-140
UNIPROTKB|F1NJ45812 CAPN3 "Calpain-3" [Gallus gall 0.283 0.267 0.5 5e-136
UNIPROTKB|E9PT78785 Capn3 "Calpain-3" [Rattus norv 0.368 0.359 0.440 2.7e-135
UNIPROTKB|F6TMZ0818 CAPN3 "Uncharacterized protein 0.305 0.286 0.470 4.4e-135
UNIPROTKB|F1NGY3727 CAPN3 "Calpain-3" [Gallus gall 0.390 0.411 0.444 5.7e-135
UNIPROTKB|G1KRC7804 CAPN3 "Uncharacterized protein 0.318 0.303 0.466 3.5e-131
UNIPROTKB|F6RX57821 CAPN3 "Uncharacterized protein 0.582 0.543 0.391 3.4e-126
FB|FBgn0012051 CalpA "Calpain-A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 998 (356.4 bits), Expect = 1.1e-167, Sum P(4) = 1.1e-167
 Identities = 179/262 (68%), Positives = 214/262 (81%)

Query:    63 YGRWVDVVIDDRLPTYYGKLVFLHSSTDNEFWSALLEKAYAKLHGSYEALKGGSTCEAME 122
             YG+WVDV+IDDRLPTY G+L+++HS+  NEFWSALLEKAYAKLHGSYEALKGGSTCEAME
Sbjct:   184 YGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAME 243

Query:   123 DFTGGVSEMYELNEAPSNLWQILLKAHERSSLMGCSIEPDPSVLEMQTPQGLVKGHAYSI 182
             DFTGGVSE Y+L EAP NL+ IL KA ER+S+MGCSIEPDP+V E +TPQGL++GHAYSI
Sbjct:   244 DFTGGVSEWYDLKEAPGNLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGLIRGHAYSI 303

Query:   183 TRIKYVDISTPNTSGKIPLIRMRNPWGNEAEWNGAWSDKSQEWRFIPDHEKRELGLTFDD 242
             T++  +DI TPN  GKIP+IRMRNPWGNEAEWNG WSD S EWR+IP+ +K E+GLTFD 
Sbjct:   304 TKVCLIDIVTPNRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDR 363

Query:   243 DGEFWMSYKDFLKYFSRLEICNLSPDSLIEDAMSRDRGKKWEMSVYEGEWVRGVTAGGSQ 302
             DGEFWMS++DFL +F R+EICNLSPDSL ED  +  + +KWEMS+YEGEW  GVTAGG +
Sbjct:   364 DGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGK-RKWEMSMYEGEWTPGVTAGGCR 422

Query:   303 EWRFIPDHEKRELGLTFDDDGE 324
              +     H  + +    D D E
Sbjct:   423 NFLDTFWHNPQYIITLVDPDEE 444
GO:0015629 "actin cytoskeleton" evidence=IDA
GO:0005622 "intracellular" evidence=IDA
GO:0043025 "neuronal cell body" evidence=IDA
GO:0004198 "calcium-dependent cysteine-type endopeptidase activity" evidence=NAS;IDA
GO:0005509 "calcium ion binding" evidence=IEA;NAS
GO:0016540 "protein autoprocessing" evidence=IDA;TAS
GO:0006508 "proteolysis" evidence=IDA
GO:0005737 "cytoplasm" evidence=NAS
GO:0030036 "actin cytoskeleton organization" evidence=NAS
GO:0006911 "phagocytosis, engulfment" evidence=IMP
GO:0009953 "dorsal/ventral pattern formation" evidence=IDA
GO:0021919 "BMP signaling pathway involved in spinal cord dorsal/ventral patterning" evidence=IDA
GO:0042335 "cuticle development" evidence=IDA
GO:0008340 "determination of adult lifespan" evidence=IMP
FB|FBgn0025866 CalpB "Calpain-B" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q9GLG7 CAPN3 "Calpain-3" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|F8W8F5 CAPN3 "Calpain-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJ45 CAPN3 "Calpain-3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E9PT78 Capn3 "Calpain-3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F6TMZ0 CAPN3 "Uncharacterized protein" [Monodelphis domestica (taxid:13616)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGY3 CAPN3 "Calpain-3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G1KRC7 CAPN3 "Uncharacterized protein" [Anolis carolinensis (taxid:28377)] Back     alignment and assigned GO terms
UNIPROTKB|F6RX57 CAPN3 "Uncharacterized protein" [Equus caballus (taxid:9796)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P20807CAN3_HUMAN3, ., 4, ., 2, 2, ., 5, 40.37540.88770.8282yesN/A
P16259CAN3_RAT3, ., 4, ., 2, 2, ., 5, 40.36950.87850.8197yesN/A
Q11002CANA_DROME3, ., 4, ., 2, 2, ., -0.55260.61610.5700yesN/A
Q64691CAN3_MOUSE3, ., 4, ., 2, 2, ., 5, 40.37340.87850.8197yesN/A
P51186CAN3_BOVIN3, ., 4, ., 2, 2, ., 5, 40.36910.89290.8321yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.220.766

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query766
smart00230318 smart00230, CysPc, Calpain-like thiol protease fam 1e-103
pfam00648302 pfam00648, Peptidase_C2, Calpain family cysteine p 1e-101
cd00044315 cd00044, CysPc, Calpains, domains IIa, IIb; calciu 1e-82
pfam01067142 pfam01067, Calpain_III, Calpain large subunit, dom 1e-72
cd00214150 cd00214, Calpain_III, Calpain, subdomain III 1e-70
smart00720143 smart00720, calpain_III, calpain_III domain 7e-64
smart00230318 smart00230, CysPc, Calpain-like thiol protease fam 4e-18
pfam00648302 pfam00648, Peptidase_C2, Calpain family cysteine p 6e-17
cd00044315 cd00044, CysPc, Calpains, domains IIa, IIb; calciu 3e-10
smart00230318 smart00230, CysPc, Calpain-like thiol protease fam 1e-08
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 8e-06
cd00044315 cd00044, CysPc, Calpains, domains IIa, IIb; calciu 1e-05
pfam1383353 pfam13833, EF_hand_6, EF-hand domain pair 4e-05
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 7e-05
pfam01067142 pfam01067, Calpain_III, Calpain large subunit, dom 2e-04
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 5e-04
pfam1340530 pfam13405, EF_hand_4, EF-hand domain 5e-04
cd00214150 cd00214, Calpain_III, Calpain, subdomain III 6e-04
PTZ00184149 PTZ00184, PTZ00184, calmodulin; Provisional 8e-04
pfam00648302 pfam00648, Peptidase_C2, Calpain family cysteine p 0.001
smart00720143 smart00720, calpain_III, calpain_III domain 0.003
>gnl|CDD|128526 smart00230, CysPc, Calpain-like thiol protease family Back     alignment and domain information 
 Score =  319 bits (820), Expect = e-103
 Identities = 134/215 (62%), Positives = 163/215 (75%), Gaps = 11/215 (5%)

Query: 63  YGRWVDVVIDDRLPTYYGKLVFLHSSTDNEFWSALLEKAYAKLHGSYEALKGGSTCEAME 122
           +G+WVDVVIDDRLPTY G+LVF+HS++ NEFWSALLEKAYAKL+G YEALKGGST EA+E
Sbjct: 110 FGKWVDVVIDDRLPTYNGELVFMHSNSRNEFWSALLEKAYAKLNGCYEALKGGSTTEALE 169

Query: 123 DFTGGVSEMYELNEA---PSNLWQILLKAHERSSLMGCSIEPDPSV-LEMQTPQGLVKGH 178
           D TGGV+E  +L EA   P NL++ L KA ER SLMGCSI    +V  E Q   GLVKGH
Sbjct: 170 DLTGGVAESIDLKEASKDPDNLFEDLFKAFERGSLMGCSIGAGTAVEEEEQKDCGLVKGH 229

Query: 179 AYSITRIKYVDISTPNTSGKIPLIRMRNPWGNEAEWNGAWSDKSQEWRFIPDHEKRELGL 238
           AYS+T ++ V         +  L+R+RNPWG + EWNG WSD S EWR +   EK+ LGL
Sbjct: 230 AYSVTDVREVQG------RRQELLRLRNPWG-QVEWNGPWSDDSPEWRSVSASEKKNLGL 282

Query: 239 TFDDDGEFWMSYKDFLKYFSRLEICNLSPDSLIED 273
           TFDDDGEFWMS++DFL++F ++EICNL+PDSL E 
Sbjct: 283 TFDDDGEFWMSFEDFLRHFDKVEICNLNPDSLEER 317

Calpain-like thiol protease family (peptidase family C2). Calcium activated neutral protease (large subunit). Length = 318
>gnl|CDD|216041 pfam00648, Peptidase_C2, Calpain family cysteine protease Back     alignment and domain information
>gnl|CDD|238004 cd00044, CysPc, Calpains, domains IIa, IIb; calcium-dependent cytoplasmic cysteine proteinases, papain-like Back     alignment and domain information
>gnl|CDD|216279 pfam01067, Calpain_III, Calpain large subunit, domain III Back     alignment and domain information
>gnl|CDD|238132 cd00214, Calpain_III, Calpain, subdomain III Back     alignment and domain information
>gnl|CDD|214786 smart00720, calpain_III, calpain_III domain Back     alignment and domain information
>gnl|CDD|128526 smart00230, CysPc, Calpain-like thiol protease family Back     alignment and domain information
>gnl|CDD|216041 pfam00648, Peptidase_C2, Calpain family cysteine protease Back     alignment and domain information
>gnl|CDD|238004 cd00044, CysPc, Calpains, domains IIa, IIb; calcium-dependent cytoplasmic cysteine proteinases, papain-like Back     alignment and domain information
>gnl|CDD|128526 smart00230, CysPc, Calpain-like thiol protease family Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|238004 cd00044, CysPc, Calpains, domains IIa, IIb; calcium-dependent cytoplasmic cysteine proteinases, papain-like Back     alignment and domain information
>gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|216279 pfam01067, Calpain_III, Calpain large subunit, domain III Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|205583 pfam13405, EF_hand_4, EF-hand domain Back     alignment and domain information
>gnl|CDD|238132 cd00214, Calpain_III, Calpain, subdomain III Back     alignment and domain information
>gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional Back     alignment and domain information
>gnl|CDD|216041 pfam00648, Peptidase_C2, Calpain family cysteine protease Back     alignment and domain information
>gnl|CDD|214786 smart00720, calpain_III, calpain_III domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 766
KOG0045|consensus612 100.0
smart00230318 CysPc Calpain-like thiol protease family. Calpain- 100.0
cd00044315 CysPc Calpains, domains IIa, IIb; calcium-dependen 100.0
PF00648298 Peptidase_C2: Calpain family cysteine protease Thi 100.0
cd00214150 Calpain_III Calpain, subdomain III. Calpains are c 100.0
smart00720143 calpain_III calpain_III. 99.97
PF01067147 Calpain_III: Calpain large subunit, domain III; In 99.96
KOG0037|consensus221 99.93
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.8
KOG0027|consensus151 99.76
KOG0028|consensus172 99.65
PTZ00184149 calmodulin; Provisional 99.63
PTZ00183158 centrin; Provisional 99.62
KOG0030|consensus152 99.52
KOG0031|consensus171 99.51
KOG0036|consensus 463 99.43
KOG0034|consensus187 99.34
KOG0044|consensus193 99.33
KOG0027|consensus151 99.26
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.25
PTZ00183158 centrin; Provisional 99.23
PTZ00184149 calmodulin; Provisional 99.2
KOG0044|consensus193 99.13
KOG4223|consensus325 99.06
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.98
KOG0028|consensus172 98.98
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.84
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.83
PLN02964 644 phosphatidylserine decarboxylase 98.75
KOG4223|consensus325 98.73
KOG0034|consensus187 98.72
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.7
KOG0038|consensus189 98.68
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.68
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.66
KOG0031|consensus171 98.64
KOG0037|consensus221 98.63
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.61
KOG2643|consensus489 98.6
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.54
cd0005267 EH Eps15 homology domain; found in proteins implic 98.53
PLN02964 644 phosphatidylserine decarboxylase 98.53
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.51
KOG0036|consensus 463 98.5
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.48
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.46
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.44
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.39
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.31
KOG0377|consensus631 98.3
KOG2643|consensus 489 98.28
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.28
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.27
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.25
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.18
KOG4251|consensus362 98.18
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.18
KOG0030|consensus152 98.16
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.14
KOG0041|consensus244 98.13
KOG0751|consensus 694 98.12
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.07
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.05
cd0005267 EH Eps15 homology domain; found in proteins implic 98.04
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.02
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.02
PF1465866 EF-hand_9: EF-hand domain 97.98
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.92
cd0503088 calgranulins Calgranulins: S-100 domain found in p 97.87
cd0021388 S-100 S-100: S-100 domain, which represents the la 97.85
KOG2562|consensus 493 97.79
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.76
KOG0041|consensus244 97.69
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.68
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 97.65
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.56
KOG0751|consensus 694 97.56
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.48
KOG2562|consensus493 97.46
KOG0040|consensus2399 97.44
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 97.4
KOG4666|consensus412 97.34
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 97.32
KOG4251|consensus362 97.32
KOG0040|consensus2399 97.18
KOG1029|consensus 1118 97.17
PF1465866 EF-hand_9: EF-hand domain 97.09
PRK12309391 transaldolase/EF-hand domain-containing protein; P 97.07
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 96.96
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 96.86
smart00230318 CysPc Calpain-like thiol protease family. Calpain- 96.86
KOG0377|consensus631 96.84
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 96.83
KOG0038|consensus189 96.65
KOG0045|consensus612 96.65
PRK12309391 transaldolase/EF-hand domain-containing protein; P 96.55
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 96.35
PF00648298 Peptidase_C2: Calpain family cysteine protease Thi 96.27
KOG0046|consensus 627 96.13
KOG0169|consensus 746 96.1
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 95.79
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 95.75
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 95.53
KOG0046|consensus 627 95.45
KOG4065|consensus144 95.29
KOG4666|consensus412 95.1
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 93.85
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 93.4
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 92.84
cd00044315 CysPc Calpains, domains IIa, IIb; calcium-dependen 92.7
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 92.56
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 92.56
KOG0169|consensus 746 91.9
KOG4065|consensus144 91.74
KOG1707|consensus 625 90.33
PF05042174 Caleosin: Caleosin related protein; InterPro: IPR0 88.51
PF05042174 Caleosin: Caleosin related protein; InterPro: IPR0 87.13
PLN02952 599 phosphoinositide phospholipase C 86.89
KOG1955|consensus 737 85.48
KOG3555|consensus434 84.2
cd02619223 Peptidase_C1 C1 Peptidase family (MEROPS database 83.9
KOG2243|consensus 5019 83.73
KOG0042|consensus680 83.12
>KOG0045|consensus Back     alignment and domain information 
Probab=100.00  E-value=7.2e-79  Score=692.05  Aligned_cols=522  Identities=45%  Similarity=0.750  Sum_probs=436.0

Q ss_pred             CCCHHHHHHHHHHcCCceeCCCCCCCCCCcccCCC-CC---CceEeeCCC------------------------------
Q psy14118         17 VQDFAAIRDRCLSQGTLFEDPDFPCDDSSIFYSKM-PP---KSFEWMRPM------------------------------   62 (766)
Q Consensus        17 ~~~~~~i~~~c~~~~~~f~D~~Fp~~~~sl~~~~~-~~---~~~~w~Rp~------------------------------   62 (766)
                      .++|+++++.|++++.+|+|+.|||..+||++... +.   ..++|+||.                              
T Consensus        10 ~~~~~~~~~~cl~~~~~F~D~~FP~~~~Sl~~~~~~p~~~~~~i~W~RP~ei~~~p~~i~~~~~~~di~Qg~lgdCw~la   89 (612)
T KOG0045|consen   10 MKDFERLRRDCLPAKSLFVDALFPAADSSLFYKLSTPLAQFSDIVWKRPQEICANPRLIVDGPSRFDVKQGLLGDCWFLA   89 (612)
T ss_pred             hhhHHHHHHHHhhcCCcccccCCCCCCccccccccCCCcccccceecCcccccCCCCeecCCCCcceeEEeeecchHHHH
Confidence            45899999999999999999999999999998654 44   589999999                              


Q ss_pred             ------------------------------------CCeEEEEEeceeeeccCCcEEEEecCCCCchhHHHHHHHhhhhc
Q psy14118         63 ------------------------------------YGRWVDVVIDDRLPTYYGKLVFLHSSTDNEFWSALLEKAYAKLH  106 (766)
Q Consensus        63 ------------------------------------~G~W~~V~VDD~lP~~~g~~~~~~s~~~~e~W~~LlEKAyAKl~  106 (766)
                                                          +|+|+.|+|||+|||.+|.++|+++..++|||+|||||||||++
T Consensus        90 A~a~la~~~~ll~~vip~~~~~~~~yaGif~f~~w~~G~W~~VvIDD~LP~~~~~~~~~~s~~~~efW~aLlEKAyaKl~  169 (612)
T KOG0045|consen   90 ACAALALRPELLDKVIPQDQSFQENYAGIFHFRFWQNGEWVEVVIDDRLPTSNGGLLFSHSSGKNEFWAALLEKAYAKLL  169 (612)
T ss_pred             HHHHhhcCHHHHHhccCCCcccccccceEEEEEEEeCCeEEEEEeeeecceEcCCEEEEeecCCceeHHHHHHHHHHHHh
Confidence                                                99999999999999999999999999889999999999999999


Q ss_pred             CCcccccCCChhhhhhhccCCeeEEEEcCCCch----HHHHHHHHHhhcCCceeeecCC-CCccc--ccccCCCCCCCce
Q psy14118        107 GSYEALKGGSTCEAMEDFTGGVSEMYELNEAPS----NLWQILLKAHERSSLMGCSIEP-DPSVL--EMQTPQGLVKGHA  179 (766)
Q Consensus       107 GsY~~l~gg~~~~al~dlTG~~~~~~~l~~~~~----~lw~~l~~~~~~g~l~~~~~~~-~~~~~--~~~~~~GL~~~ha  179 (766)
                      |||++|.||.+.+||++|||++++.+.+.+.+.    +++..+....++|.+++|++.. +....  +....+||+++||
T Consensus       170 GsY~~l~gg~~~~a~~~lTG~~~e~~~l~~~~~~~~~~l~~~~~~~~~~~~~l~c~~~~~~~~~~~~~~~~~~gL~~~Ha  249 (612)
T KOG0045|consen  170 GSYEALHGGSTIDALVDLTGGVTEPFDLNKTPKSFKNNLVWALLKSAHRGSLLLCSIESKDPTEEEEEAKLRNGLVKGHA  249 (612)
T ss_pred             CcccCCCCCchhhHHHhccCCccceeEcccCcchhHHHHHHHHHHhhhccCceeeeccccccchhHHHHHhhcCcccccc
Confidence            999999999999999999999999999988554    7788888899999999998865 33333  5678899999999


Q ss_pred             eEEeeEEEecccCCCCCCceeEEEEeCCCCCCCcccccCCCCCccCCCCCHHHHHHhCCccCCCCeEEEeHhHHHhhcCe
Q psy14118        180 YSITRIKYVDISTPNTSGKIPLIRMRNPWGNEAEWNGAWSDKSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSR  259 (766)
Q Consensus       180 Ysv~~v~~~~~~~~~~~~~~~ll~lrNPWg~~~eW~G~wsd~s~~W~~~~~~~~~~l~~~~~~dG~Fwm~~~df~~~F~~  259 (766)
                      |+|++++++    +..++.++||||||||| ..+|+|.|||.+++|..+....++.++....+||+|||+++||+++|+.
T Consensus       250 Ysit~~~~~----~~~~~~~~lirlrNPwg-~~~W~G~wsd~~~~W~~v~~~~~~~~~~~~~~dGeFWms~~dF~~~F~~  324 (612)
T KOG0045|consen  250 YAITDVREV----QGRGGKHRLIRLRNPWG-ESEWNGPWSDGSEEWHLVDKSKLSELGRQPLDDGEFWMSFDDFLREFDS  324 (612)
T ss_pred             EEEEEEEEe----ecccccceeEEecCCcC-CceeccccccCCcchhhhCHHHHhhcccccccCCCeeeeHHHHHhhCCe
Confidence            999999997    34556799999999999 9999999999999999998888888888878999999999999999999


Q ss_pred             EEEEecCCCcccccccccccCccccceeccccccccccCCCCCcccccCchhhhhcCccccCCCceeeecccccccccce
Q psy14118        260 LEICNLSPDSLIEDAMSRDRGKKWEMSVYEGEWVRGVTAGGSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRL  339 (766)
Q Consensus       260 ~~vc~~~p~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~W~ll~rh~~~~lg~~~~~~g~~~~~~~d~~~~~~~i  339 (766)
                      ++||++.+++...+.                                                                 
T Consensus       325 ~~vC~~~~~~~~~~~-----------------------------------------------------------------  339 (612)
T KOG0045|consen  325 LTVCRLRPDWLESRN-----------------------------------------------------------------  339 (612)
T ss_pred             EeecCCCcchhhhhh-----------------------------------------------------------------
Confidence            999999999765432                                                                 


Q ss_pred             EEeecCCCchhhhhccccCCCceeEEEEeeee--eeCCcCCCCccCccccccCCeEEEEEecccCCCCCCceEEEEEEEe
Q psy14118        340 EICNLSPDSLIEDAMSRDRGKKWEMSVYEGEW--VRGVTAGGCRNYLETFWCNPQFKITLTEVDENDEDGKCTVIIGLMQ  417 (766)
Q Consensus       340 ~~~~l~~~~~~~~~~~~~~~~~w~~~~~~G~W--~~g~tAGG~~~~~~tf~~NPQy~l~v~~~~~~~~~~~~~v~i~L~Q  417 (766)
                                         ...|....++|+|  ..+.+||||.++.+||++||||.|.+..+++    +.|.+++.|+|
T Consensus       340 -------------------~~~~~~~~~~~~w~~~~~~t~ggc~~~~~tF~~npq~~~~~~~~~~----~~~~~v~~~~q  396 (612)
T KOG0045|consen  340 -------------------QLQWVKLSLDGEWELARGVTAGGCRNSVDTFDRNPQYILAVRKPTK----SLCAVVLALFQ  396 (612)
T ss_pred             -------------------eeeeeeeecCCccceeecccCCCCccCcccccCCceEEEEecCCCc----cceEEEEEeec
Confidence                               1357788899999  8889999999999999999999999988652    46999999999


Q ss_pred             ccchhhhccCCceeeeeEEEEEecCCCCCCCCCCcccccccCCCcCCccccccceeeeeeeecCCceEEEcCCCCCCCcc
Q psy14118        418 KNRRAQKKTGAECLTIGFAVYQIEDPDNVPTPLDLNFFKYNASCARAPSFINLREVSCRFKLPPGVYCIVPSTFEPNEEG  497 (766)
Q Consensus       418 ~~~r~~~~~~~~~~~Igf~v~~v~~~~~~~~~l~~~~~~~~~~~~~s~~y~~~rev~~~~~L~pG~Y~IVPsT~~p~~~g  497 (766)
                      ++++..++.+.+...|||+||+++.+       ...++..+.+++.+..|++.|+|+.++.+|||.|++|||||+|++++
T Consensus       397 ~~~~~~~~~~~~~~~ig~~i~~v~~~-------~~~~~~~~~~~~~~~~~i~~r~v~~~~~~P~~~y~~~pst~~~~~~~  469 (612)
T KOG0045|consen  397 KTRRGERSFGANILDIGFHIYEVPLE-------GKYFVLDNAPIASSSSFINNREVSVRFRLPPGTYVIVPSTFEPGEEG  469 (612)
T ss_pred             ccccccccccceeeecceEEEEecCC-------CCceEecccchhcccccccceeEEEEecCCCcceeecccCCCCCCCc
Confidence            99999888888899999999999853       24556667789999999999999999999999999999999999999


Q ss_pred             CceeEEeecCCCCcccCccccccCcccCccCCCCCCCCcchhhHHHHHHHHHHHcCCCcccCHHHHHHHHHHHhhccccc
Q psy14118        498 EFILRVFSEHKNNMEENDEEVGMGEIDNRIQIPDEPQPEKEKKTEAIRQFFQKLAGDDMEVDWMELKDILDYAMRNETKT  577 (766)
Q Consensus       498 ~F~LrV~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~F~~~d~~~g~i~~~el~~~l~~~~~~~~~~  577 (766)
                      +|+|||||...+..++ +..+                                        ...+++...+..       
T Consensus       470 ~f~lrvfs~~~~~~~~-~~~i----------------------------------------~~~~~~~~~~~~-------  501 (612)
T KOG0045|consen  470 EFLLRVFSNVKVKSEE-DMEI----------------------------------------SLDETKRSTNII-------  501 (612)
T ss_pred             cEEEEEeecccccCcc-ceEE----------------------------------------eecccccceeee-------
Confidence            9999999999887664 1111                                        100000000000       


Q ss_pred             cccCCcccceeeccCCCCCCCCCCCCcchhhhHHHHhccccCCCCccccccccccCCCCCCHHHHHHHHHhhcCCCCccc
Q psy14118        578 TTEGGFSKDVCRNVPANTSTTDSPATGIVGNLLALICGNACRDTPLGAALETKTTTEGGFSKDVCRSMVAMLDVDRSGKL  657 (766)
Q Consensus       578 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~s~~~i~~l~~~~D~d~~G~I  657 (766)
                                                                             ...+++...+..+...++.+.++++
T Consensus       502 -------------------------------------------------------~~~~~~~~~~~~~~~~~~~~~~~k~  526 (612)
T KOG0045|consen  502 -------------------------------------------------------VMKGFSLGECGDKWKLSSTLVNTKV  526 (612)
T ss_pred             -------------------------------------------------------eecceehhhhchhhhcccccccccc
Confidence                                                                   0124556677788888999999999


Q ss_pred             cHHHHHHHHHHHHHHHHHhhhhcCCCCcccCHHHHHHHHHHhCCCCCHHHHHHHHHHccCCCCcccHHHHHHHHHHHHHH
Q psy14118        658 GFEEFQQLWKDIRNWKSVFKMYDQENSGYLSPFELRQALTSAGYHLNNHILNILAHRYSGRDARISFDDFMMCAVRLKTM  737 (766)
Q Consensus       658 ~~~EF~~~~~~~~~l~~~F~~~D~d~~G~Is~~El~~~L~~~g~~ls~~~~~~l~~~~dd~dG~Is~~EF~~~l~~l~~~  737 (766)
                      +..+|..++..+...   +   |.++.+.+.. |+..++...+.......+..+...+.+.+..+++.-+..+......+
T Consensus       527 s~~~~~~~~~~~~~~---~---~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  599 (612)
T KOG0045|consen  527 SRSSEFILTVEVVSP---L---DIEGESTLVV-DIPIAIESKGSGDVAPLLNVIRLRIADPEIAYSFDSTSCCATEGPLV  599 (612)
T ss_pred             chhhceeeeeccccc---E---EEeccccccc-cccceeeccCCcccccceeeeeeeccChhheeeccccccccccCcch
Confidence            999999888877555   2   8889999998 98888777665555444444444444555667777777777777777


Q ss_pred             HHHHhccCCCC
Q psy14118        738 IDLFKARDPSS  748 (766)
Q Consensus       738 ~~~F~~~D~d~  748 (766)
                      ..+|..++.+.
T Consensus       600 ~~~~~~~~~~~  610 (612)
T KOG0045|consen  600 LDELFDLSSKK  610 (612)
T ss_pred             hhhhhcCCCCC
Confidence            77776665543

>smart00230 CysPc Calpain-like thiol protease family Back     alignment and domain information
>cd00044 CysPc Calpains, domains IIa, IIb; calcium-dependent cytoplasmic cysteine proteinases, papain-like Back     alignment and domain information
>PF00648 Peptidase_C2: Calpain family cysteine protease This is family C2 in the peptidase classification Back     alignment and domain information
>cd00214 Calpain_III Calpain, subdomain III Back     alignment and domain information
>smart00720 calpain_III calpain_III Back     alignment and domain information
>PF01067 Calpain_III: Calpain large subunit, domain III; InterPro: IPR022682 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>KOG0751|consensus Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>KOG0751|consensus Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>smart00230 CysPc Calpain-like thiol protease family Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>KOG0045|consensus Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>PF00648 Peptidase_C2: Calpain family cysteine protease This is family C2 in the peptidase classification Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>cd00044 CysPc Calpains, domains IIa, IIb; calcium-dependent cytoplasmic cysteine proteinases, papain-like Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin Back     alignment and domain information
>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>KOG1955|consensus Back     alignment and domain information
>KOG3555|consensus Back     alignment and domain information
>cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>KOG2243|consensus Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query766
1qxp_A 900 Crystal Structure Of A Mu-Like Calpain Length = 900 3e-77
1qxp_A900 Crystal Structure Of A Mu-Like Calpain Length = 900 1e-29
1kfx_L699 Crystal Structure Of Human M-Calpain Form I Length 2e-72
1ziv_A339 Catalytic Domain Of Human Calpain-9 Length = 339 3e-68
1ziv_A339 Catalytic Domain Of Human Calpain-9 Length = 339 5e-11
3df0_A714 Calcium-Dependent Complex Between M-Calpain And Cal 3e-67
1df0_A700 Crystal Structure Of M-Calpain Length = 700 4e-67
1u5i_A700 Crystal Structure Analysis Of Rat M-Calpain Mutant 4e-67
2p0r_A333 Structure Of Human Calpain 9 In Complex With Leupep 2e-66
2p0r_A333 Structure Of Human Calpain 9 In Complex With Leupep 3e-09
2ary_A351 Catalytic Domain Of Human Calpain-1 Length = 351 6e-66
2ary_A351 Catalytic Domain Of Human Calpain-1 Length = 351 3e-09
1zcm_A321 Human Calpain Protease Core Inhibited By Zllych2f L 4e-64
1zcm_A321 Human Calpain Protease Core Inhibited By Zllych2f L 7e-07
1kxr_A339 Crystal Structure Of Calcium-Bound Protease Core Of 7e-64
1kxr_A339 Crystal Structure Of Calcium-Bound Protease Core Of 4e-08
1tl9_A339 High Resolution Crystal Structure Of Calpain I Prot 9e-64
1tl9_A339 High Resolution Crystal Structure Of Calpain I Prot 4e-08
2nqa_A326 Catalytic Domain Of Human Calpain 8 Length = 326 1e-62
2nqa_A326 Catalytic Domain Of Human Calpain 8 Length = 326 1e-07
1mdw_A328 Crystal Structure Of Calcium-bound Protease Core Of 9e-58
1mdw_A328 Crystal Structure Of Calcium-bound Protease Core Of 5e-07
1kfx_S184 Crystal Structure Of Human M-Calpain Form I Length 1e-30
1alw_A173 Inhibitor And Calcium Bound Domain Vi Of Porcine Ca 4e-30
1df0_B184 Crystal Structure Of M-Calpain Length = 184 4e-30
1aj5_A173 Calpain Domain Vi Apo Length = 173 5e-30
1dvi_A184 Calpain Domain Vi With Calcium Bound Length = 184 7e-29
1np8_A159 18-K C-Terminally Trunucated Small Subunit Of Calpa 2e-25
1f4o_A165 Crystal Structure Of Grancalcin With Bound Calcium 1e-24
1k95_A165 Crystal Structure Of Des(1-52)grancalcin With Bound 2e-24
1gjy_A167 The X-Ray Structure Of The Sorcin Calcium Binding D 3e-24
1juo_A198 Crystal Structure Of Calcium-Free Human Sorcin: A M 2e-23
2jc2_A198 The Crystal Structure Of The Natural F112l Human So 5e-23
3aak_A172 Crystal Structure Of Zn2+-Bound Form Of Des3-20alg- 5e-18
2zn9_A172 Crystal Structure Of Ca2+-bound Form Of Des3-20alg- 3e-17
2zne_A169 Crystal Structure Of Zn2+-Bound Form Of Des3-23alg- 3e-17
2zn8_A190 Crystal Structure Of Zn2+-Bound Form Of Alg-2 Lengt 3e-17
2zrs_A168 Crystal Structure Of Ca2+-Bound Form Of Des3-23alg- 4e-17
1hqv_A191 Structure Of Apoptosis-Linked Protein Alg-2 Length 1e-16
3aaj_A167 Crystal Structure Of Ca2+-Bound Form Of Des3-23alg- 6e-16
2i7a_A174 Domain Iv Of Human Calpain 13 Length = 174 1e-10
1y1x_A191 Structural Analysis Of A Homolog Of Programmed Cell 1e-08
2l1w_A149 The Solution Structure Of Soybean Calmodulin Isofor 5e-05
3sib_A220 Crystal Structure Of Ure3-Binding Protein, Wild-Typ 1e-04
1tcf_A159 Crystal Structure Of Calcium-Saturated Rabbit Skele 2e-04
1a2x_A159 Complex Of Troponin C With A 47 Residue (1-47) Frag 4e-04
5tnc_A162 Refined Crystal Structure Of Troponin C From Turkey 4e-04
2w49_0159 Isometrically Contracting Insect Asynchronous Fligh 6e-04
1ytz_C162 Crystal Structure Of Skeletal Muscle Troponin In Th 6e-04
1tnw_A162 Nmr Solution Structure Of Calcium Saturated Skeleta 7e-04
4tnc_A162 Refined Structure Of Chicken Skeletal Muscle Tropon 8e-04
1rfj_A149 Crystal Structure Of Potato Calmodulin Pcm6 Length 8e-04
>pdb|1QXP|A Chain A, Crystal Structure Of A Mu-Like Calpain Length = 900 Back     alignment and structure 
Iteration: 1

 Score =  286 bits (732), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 174/479 (36%), Positives = 259/479 (54%), Gaps = 78/479 (16%)
Query: 289 EGEWVRGVTAGGSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRLEICNLSPDS 348
           E EW +G  +  S EW  +  +E+ +L +  +D GEFWMS++DF++ F++LEICNL+PD+
Sbjct: 290 EVEW-KGPWSDNSYEWNKVDPYEREQLRVKMED-GEFWMSFRDFIREFTKLEICNLTPDA 347
Query: 349 LIEDAMSRDRGKKWEMSVYEGEWVRGVTAGGCRNYLETFWCNPQFKITLTEVDENDE--- 405
           L    +     + W  + YEG W RG TAGGCRNY  TFW NPQFKI L EVD+ D+   
Sbjct: 348 LKSRTL-----RNWNTTFYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLEEVDDADDYDS 402
Query: 406 -DGKCTVIIGLMQKNRRAQKKTGAECLTIGFAVYQI-EDPDNVPTPLDLNFFKYNASCAR 463
            +  C+ ++ LMQK+RR +++ G +  TIGFAVYQ+  +    P  L  +FF  NAS A+
Sbjct: 403 RESGCSFLLALMQKHRRRERRFGRDMETIGFAVYQVPRELAGQPVHLKRDFFLANASRAQ 462
Query: 464 APSFINLREVSCRFKLPPGVYCIVPSTFEPNEEGEFILRVFSEHKNNMEENDEEVGMGEI 523
           +  FINLREVS R +LPPG Y +VPSTFEPN+EG+F+LR FSE K          G  E+
Sbjct: 463 SEHFINLREVSNRIRLPPGEYIVVPSTFEPNKEGDFLLRFFSEKK---------AGTQEL 513
Query: 524 DNRIQ--IPDEPQPEKEKKTEAIRQFFQKLAGDDMEVDWMELKDILDYAMRNETKTTTEG 581
           D++IQ  +PDE    +E+  +  +  F KLAGDDME+   EL+ IL+  + ++ K     
Sbjct: 514 DDQIQANLPDEKVLSEEEIDDNFKTLFSKLAGDDMEISVKELQTILNRII-SKHKDLRTN 572
Query: 582 GFSKDVCRNVPANTSTTDSPATGIVGNLLALICGNACRDTPLGAALETKTTTEGGFSKDV 641
           GFS + CR++    +  D    G +G +   I  N  R                      
Sbjct: 573 GFSLESCRSM---VNLMDRDGNGKLGLVEFNILWNRIR---------------------- 607
Query: 642 CRSMVAMLDVDRSGKLGFEEFQQLWKDIRNWKSVFKMYDQENSGYLSPFELRQALTSAGY 701
                                        N+ ++F+ +D + SG +S +E+R A+ +AG+
Sbjct: 608 -----------------------------NYLTIFRKFDLDKSGSMSAYEMRMAIEAAGF 638
Query: 702 HLNNHILNILAHRYSGRDARISFDDFMMCAVRLKTMIDLFKARDPSSTNKATFTLEEWV 760
            L   +  ++  R++  +  I FD+F+ C VRL+ +  +FK  DP +T      L  W+
Sbjct: 639 KLPCQLHQVIVARFADDELIIDFDNFVRCLVRLEILFKIFKQLDPENTGTIQLDLISWL 697
>pdb|1QXP|A Chain A, Crystal Structure Of A Mu-Like Calpain Length = 900 Back     alignment and structure
>pdb|1KFX|L Chain L, Crystal Structure Of Human M-Calpain Form I Length = 699 Back     alignment and structure
>pdb|1ZIV|A Chain A, Catalytic Domain Of Human Calpain-9 Length = 339 Back     alignment and structure
>pdb|1ZIV|A Chain A, Catalytic Domain Of Human Calpain-9 Length = 339 Back     alignment and structure
>pdb|3DF0|A Chain A, Calcium-Dependent Complex Between M-Calpain And Calpastatin Length = 714 Back     alignment and structure
>pdb|1DF0|A Chain A, Crystal Structure Of M-Calpain Length = 700 Back     alignment and structure
>pdb|1U5I|A Chain A, Crystal Structure Analysis Of Rat M-Calpain Mutant Lys10 Thr Length = 700 Back     alignment and structure
>pdb|2P0R|A Chain A, Structure Of Human Calpain 9 In Complex With Leupeptin Length = 333 Back     alignment and structure
>pdb|2P0R|A Chain A, Structure Of Human Calpain 9 In Complex With Leupeptin Length = 333 Back     alignment and structure
>pdb|2ARY|A Chain A, Catalytic Domain Of Human Calpain-1 Length = 351 Back     alignment and structure
>pdb|2ARY|A Chain A, Catalytic Domain Of Human Calpain-1 Length = 351 Back     alignment and structure
>pdb|1ZCM|A Chain A, Human Calpain Protease Core Inhibited By Zllych2f Length = 321 Back     alignment and structure
>pdb|1ZCM|A Chain A, Human Calpain Protease Core Inhibited By Zllych2f Length = 321 Back     alignment and structure
>pdb|1KXR|A Chain A, Crystal Structure Of Calcium-Bound Protease Core Of Calpain I Length = 339 Back     alignment and structure
>pdb|1KXR|A Chain A, Crystal Structure Of Calcium-Bound Protease Core Of Calpain I Length = 339 Back     alignment and structure
>pdb|1TL9|A Chain A, High Resolution Crystal Structure Of Calpain I Protease Core In Complex With Leupeptin Length = 339 Back     alignment and structure
>pdb|1TL9|A Chain A, High Resolution Crystal Structure Of Calpain I Protease Core In Complex With Leupeptin Length = 339 Back     alignment and structure
>pdb|2NQA|A Chain A, Catalytic Domain Of Human Calpain 8 Length = 326 Back     alignment and structure
>pdb|2NQA|A Chain A, Catalytic Domain Of Human Calpain 8 Length = 326 Back     alignment and structure
>pdb|1MDW|A Chain A, Crystal Structure Of Calcium-bound Protease Core Of Calpain Ii Reveals The Basis For Intrinsic Inactivation Length = 328 Back     alignment and structure
>pdb|1MDW|A Chain A, Crystal Structure Of Calcium-bound Protease Core Of Calpain Ii Reveals The Basis For Intrinsic Inactivation Length = 328 Back     alignment and structure
>pdb|1KFX|S Chain S, Crystal Structure Of Human M-Calpain Form I Length = 184 Back     alignment and structure
>pdb|1ALW|A Chain A, Inhibitor And Calcium Bound Domain Vi Of Porcine Calpain Length = 173 Back     alignment and structure
>pdb|1DF0|B Chain B, Crystal Structure Of M-Calpain Length = 184 Back     alignment and structure
>pdb|1AJ5|A Chain A, Calpain Domain Vi Apo Length = 173 Back     alignment and structure
>pdb|1DVI|A Chain A, Calpain Domain Vi With Calcium Bound Length = 184 Back     alignment and structure
>pdb|1NP8|A Chain A, 18-K C-Terminally Trunucated Small Subunit Of Calpain Length = 159 Back     alignment and structure
>pdb|1F4O|A Chain A, Crystal Structure Of Grancalcin With Bound Calcium Length = 165 Back     alignment and structure
>pdb|1K95|A Chain A, Crystal Structure Of Des(1-52)grancalcin With Bound Calcium Length = 165 Back     alignment and structure
>pdb|1GJY|A Chain A, The X-Ray Structure Of The Sorcin Calcium Binding Domain (Scbd) Provides Insight Into The Phosphorylation And Calcium Dependent Processess Length = 167 Back     alignment and structure
>pdb|1JUO|A Chain A, Crystal Structure Of Calcium-Free Human Sorcin: A Member Of The Penta-Ef-Hand Protein Family Length = 198 Back     alignment and structure
>pdb|2JC2|A Chain A, The Crystal Structure Of The Natural F112l Human Sorcin Mutant Length = 198 Back     alignment and structure
>pdb|3AAK|A Chain A, Crystal Structure Of Zn2+-Bound Form Of Des3-20alg-2f122a Length = 172 Back     alignment and structure
>pdb|2ZN9|A Chain A, Crystal Structure Of Ca2+-bound Form Of Des3-20alg-2 Length = 172 Back     alignment and structure
>pdb|2ZNE|A Chain A, Crystal Structure Of Zn2+-Bound Form Of Des3-23alg-2 Complexed With Alix Abs Peptide Length = 169 Back     alignment and structure
>pdb|2ZN8|A Chain A, Crystal Structure Of Zn2+-Bound Form Of Alg-2 Length = 190 Back     alignment and structure
>pdb|2ZRS|A Chain A, Crystal Structure Of Ca2+-Bound Form Of Des3-23alg-2 Length = 168 Back     alignment and structure
>pdb|1HQV|A Chain A, Structure Of Apoptosis-Linked Protein Alg-2 Length = 191 Back     alignment and structure
>pdb|3AAJ|A Chain A, Crystal Structure Of Ca2+-Bound Form Of Des3-23alg-2deltagf122 Length = 167 Back     alignment and structure
>pdb|2I7A|A Chain A, Domain Iv Of Human Calpain 13 Length = 174 Back     alignment and structure
>pdb|1Y1X|A Chain A, Structural Analysis Of A Homolog Of Programmed Cell Death 6 Protein From Leishmania Major Friedlin Length = 191 Back     alignment and structure
>pdb|2L1W|A Chain A, The Solution Structure Of Soybean Calmodulin Isoform 4 Complexed With The Vacuolar Calcium Atpase Bca1 Peptide Length = 149 Back     alignment and structure
>pdb|3SIB|A Chain A, Crystal Structure Of Ure3-Binding Protein, Wild-Type Length = 220 Back     alignment and structure
>pdb|1TCF|A Chain A, Crystal Structure Of Calcium-Saturated Rabbit Skeletal Troponin C Length = 159 Back     alignment and structure
>pdb|1A2X|A Chain A, Complex Of Troponin C With A 47 Residue (1-47) Fragment Of Troponin I Length = 159 Back     alignment and structure
>pdb|5TNC|A Chain A, Refined Crystal Structure Of Troponin C From Turkey Skeletal Muscle At 2.0 Angstroms Resolution Length = 162 Back     alignment and structure
>pdb|2W49|0 Chain 0, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 159 Back     alignment and structure
>pdb|1YTZ|C Chain C, Crystal Structure Of Skeletal Muscle Troponin In The Ca2+- Activated State Length = 162 Back     alignment and structure
>pdb|1TNW|A Chain A, Nmr Solution Structure Of Calcium Saturated Skeletal Muscle Troponin C Length = 162 Back     alignment and structure
>pdb|4TNC|A Chain A, Refined Structure Of Chicken Skeletal Muscle Troponin C In The Two-Calcium State At 2-Angstroms Resolution Length = 162 Back     alignment and structure
>pdb|1RFJ|A Chain A, Crystal Structure Of Potato Calmodulin Pcm6 Length = 149 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query766
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 1e-122
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 6e-82
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 9e-09
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 1e-108
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 2e-84
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 2e-52
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 7e-07
2nqa_A326 Calpain 8; calpain, calcium-dependent cytoplasmic 5e-79
2nqa_A326 Calpain 8; calpain, calcium-dependent cytoplasmic 3e-14
2nqa_A326 Calpain 8; calpain, calcium-dependent cytoplasmic 5e-10
1ziv_A339 Calpain 9; cysteine protease, papain, calcium-depe 1e-76
1ziv_A339 Calpain 9; cysteine protease, papain, calcium-depe 8e-15
1ziv_A339 Calpain 9; cysteine protease, papain, calcium-depe 3e-11
2r9f_A339 Calpain-1 catalytic subunit; protease, peptidase, 2e-71
2r9f_A339 Calpain-1 catalytic subunit; protease, peptidase, 3e-11
2r9f_A339 Calpain-1 catalytic subunit; protease, peptidase, 5e-09
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 6e-53
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 1e-49
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 2e-49
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 7e-49
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 4e-04
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 7e-49
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 8e-46
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 4e-06
2qfe_A148 Calpain-7; C2-like domain, hydrolase, nuclear prot 3e-45
2qfe_A148 Calpain-7; C2-like domain, hydrolase, nuclear prot 5e-05
1y1x_A191 Leishmania major homolog of programmed cell death 8e-43
1y1x_A191 Leishmania major homolog of programmed cell death 8e-06
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 4e-41
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 6e-17
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 1e-12
1ij5_A 323 Plasmodial specific LAV1-2 protein; fourty kDa cal 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-06
3lij_A494 Calcium/calmodulin dependent protein kinase with A 8e-10
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 2e-09
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 2e-09
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 2e-09
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 7e-09
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 1e-07
2hps_A186 Coelenterazine-binding protein with bound coelent; 7e-09
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 1e-08
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 1e-08
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 3e-08
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 3e-08
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 4e-08
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 4e-08
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 4e-08
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 4e-08
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 5e-08
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 6e-08
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 6e-08
3fwb_A161 Cell division control protein 31; gene gating, com 7e-08
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 7e-08
1exr_A148 Calmodulin; high resolution, disorder, metal trans 8e-08
2jnf_A158 Troponin C; stretch activated muscle contraction, 8e-08
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 9e-08
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 1e-07
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 7e-04
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 1e-07
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 1e-07
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 2e-07
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 2e-07
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 3e-07
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 3e-07
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 4e-07
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 5e-07
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 6e-07
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 7e-07
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 8e-07
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 8e-07
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 9e-07
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 9e-06
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 1e-06
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 1e-06
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 1e-06
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 1e-06
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 1e-06
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 2e-06
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 2e-06
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 2e-06
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 2e-06
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 3e-06
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 3e-06
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 4e-06
3akb_A166 Putative calcium binding protein; EF-hand, metal b 5e-06
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 5e-06
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 5e-06
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 1e-05
3li6_A66 Calcium-binding protein; calcium signaling protein 2e-05
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 2e-05
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 3e-05
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 3e-05
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 4e-05
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 5e-05
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 5e-05
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 7e-05
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 8e-05
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 8e-05
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 1e-04
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 1e-04
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 1e-04
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 2e-04
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 2e-04
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 2e-04
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 2e-04
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 3e-04
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 4e-04
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 4e-04
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 7e-04
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 7e-04
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 9e-04
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 9e-04
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 Back     alignment and structure
 Score =  382 bits (981), Expect = e-122
 Identities = 167/488 (34%), Positives = 245/488 (50%), Gaps = 78/488 (15%)

Query: 283 WEMSVYEGEWVRGVTAGGSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRLEIC 342
           W    + G+W           W  +    +  L     +DGEFWMS+ DFL+++SRLEIC
Sbjct: 288 WGQVEWTGKWNDNCP-----SWNTVDPEVRANL-TERQEDGEFWMSFSDFLRHYSRLEIC 341

Query: 343 NLSPDSLIEDAMSRDRGKKWEMSVYEGEWVRGVTAGGCRNYLETFWCNPQFKITLTEVDE 402
           NL+PD+     ++ D  KKW+++  +G W RG TAGGCRNY  TFW NPQ+ I L E DE
Sbjct: 342 NLTPDT-----LTCDSYKKWKLTKMDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDE 396

Query: 403 NDEDG--KCTVIIGLMQKNRRAQKKTGAECLTIGFAVYQI--EDPDNVPTPLDLNFFKYN 458
           +DEDG   CT ++GL+QK+RR Q+K G +  TIGF +Y++  E        L  NFF   
Sbjct: 397 DDEDGERGCTFLVGLIQKHRRRQRKMGEDMHTIGFGIYEVPEELTGQTNIHLSKNFFLTT 456

Query: 459 ASCARAPSFINLREVSCRFKLPPGVYCIVPSTFEPNEEGEFILRVFSEHKNNMEENDEEV 518
            +  R+ +FINLREV  RFKLPPG Y +VPSTFEP++ G+F +RVFSE K + +  D+E+
Sbjct: 457 RARERSDTFINLREVLNRFKLPPGEYVLVPSTFEPHKNGDFCIRVFSEKKADYQTVDDEI 516

Query: 519 GMGEIDNRIQIPDEPQPEKEKKTEAIRQFFQKLAGDDMEVDWMELKDILDYAMRNETKTT 578
                +      D             R+ F +LAG+D E+   E    L   +R      
Sbjct: 517 EANIEEIEANEEDIGDG--------FRRLFAQLAGEDAEISAFE----LQTILRRVLAKR 564

Query: 579 TEGGFSKDVCRNVPANTSTTDSPATGIVGNLLALICGNACRDTPLGAALETKTTTEGGFS 638
            +                                                       GFS
Sbjct: 565 EDIKSD---------------------------------------------------GFS 573

Query: 639 KDVCRSMVAMLDVDRSGKLGFEEFQQLWKDIRNWKSVFKMYDQENSGYLSPFELRQALTS 698
            + C+ MV MLD D SGKLG +EF  LW  I+ ++ +++  D + SG ++ +E+R+AL  
Sbjct: 574 IETCKIMVDMLDEDGSGKLGLKEFYILWTKIQKYQKIYREIDVDRSGTMNSYEMRKALEE 633

Query: 699 AGYHLNNHILNILAHRYSGRDARISFDDFMMCAVRLKTMIDLFKARDPSSTNKATFTLEE 758
           AG+ L   +  ++  R++  +  I FD+F+ C VRL+ +  +FK  DP +T      L  
Sbjct: 634 AGFKLPCQLHQVIVARFADDELIIDFDNFVRCLVRLEILFKIFKQLDPENTGTIQLDLIS 693

Query: 759 WVENTLYS 766
           W+  ++  
Sbjct: 694 WLSFSVLG 701
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Back     alignment and structure
>2nqa_A Calpain 8; calpain, calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC; HET: AR7; 2.20A {Homo sapiens} Length = 326 Back     alignment and structure
>2nqa_A Calpain 8; calpain, calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC; HET: AR7; 2.20A {Homo sapiens} Length = 326 Back     alignment and structure
>2nqa_A Calpain 8; calpain, calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC; HET: AR7; 2.20A {Homo sapiens} Length = 326 Back     alignment and structure
>1ziv_A Calpain 9; cysteine protease, papain, calcium-dependent, thiol protease, structural genomics consortium, SGC, hydrolase; 2.31A {Homo sapiens} SCOP: d.3.1.3 PDB: 2p0r_A* Length = 339 Back     alignment and structure
>1ziv_A Calpain 9; cysteine protease, papain, calcium-dependent, thiol protease, structural genomics consortium, SGC, hydrolase; 2.31A {Homo sapiens} SCOP: d.3.1.3 PDB: 2p0r_A* Length = 339 Back     alignment and structure
>1ziv_A Calpain 9; cysteine protease, papain, calcium-dependent, thiol protease, structural genomics consortium, SGC, hydrolase; 2.31A {Homo sapiens} SCOP: d.3.1.3 PDB: 2p0r_A* Length = 339 Back     alignment and structure
>2r9f_A Calpain-1 catalytic subunit; protease, peptidase, inhibitor, alpha-ketoamide, hydrolase, thiol protease; HET: K2Z; 1.60A {Rattus norvegicus} SCOP: d.3.1.3 PDB: 1tlo_A* 2g8e_A* 1tl9_A* 2nqg_A* 2nqi_A* 2r9c_A* 2g8j_A* 1kxr_A 2ary_A 1zcm_A* 1mdw_A Length = 339 Back     alignment and structure
>2r9f_A Calpain-1 catalytic subunit; protease, peptidase, inhibitor, alpha-ketoamide, hydrolase, thiol protease; HET: K2Z; 1.60A {Rattus norvegicus} SCOP: d.3.1.3 PDB: 1tlo_A* 2g8e_A* 1tl9_A* 2nqg_A* 2nqi_A* 2r9c_A* 2g8j_A* 1kxr_A 2ary_A 1zcm_A* 1mdw_A Length = 339 Back     alignment and structure
>2r9f_A Calpain-1 catalytic subunit; protease, peptidase, inhibitor, alpha-ketoamide, hydrolase, thiol protease; HET: K2Z; 1.60A {Rattus norvegicus} SCOP: d.3.1.3 PDB: 1tlo_A* 2g8e_A* 1tl9_A* 2nqg_A* 2nqi_A* 2r9c_A* 2g8j_A* 1kxr_A 2ary_A 1zcm_A* 1mdw_A Length = 339 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>2qfe_A Calpain-7; C2-like domain, hydrolase, nuclear protein, protease, thiol protease; 1.45A {Homo sapiens} Length = 148 Back     alignment and structure
>2qfe_A Calpain-7; C2-like domain, hydrolase, nuclear protein, protease, thiol protease; 1.45A {Homo sapiens} Length = 148 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Length = 174 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query766
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 100.0
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 100.0
1ziv_A339 Calpain 9; cysteine protease, papain, calcium-depe 100.0
2r9f_A339 Calpain-1 catalytic subunit; protease, peptidase, 100.0
2nqa_A326 Calpain 8; calpain, calcium-dependent cytoplasmic 100.0
2qfe_A148 Calpain-7; C2-like domain, hydrolase, nuclear prot 99.96
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.91
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.91
1y1x_A191 Leishmania major homolog of programmed cell death 99.91
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.91
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.9
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.9
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.9
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.9
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.89
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.82
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.81
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.8
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.8
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.8
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.8
3fwb_A161 Cell division control protein 31; gene gating, com 99.77
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.77
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.77
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.76
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.76
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.75
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.75
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.74
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.74
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.74
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.74
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.74
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.74
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.74
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.73
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.73
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.73
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.73
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.73
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.72
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.71
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.71
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.71
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.7
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.7
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.7
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.7
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.7
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.7
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.69
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.69
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.68
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.68
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.68
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.68
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.67
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.67
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.67
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.67
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.66
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.66
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.66
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.66
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.66
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.65
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.65
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.65
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.65
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.65
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.64
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.64
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.64
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.64
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.63
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.63
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.63
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.63
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.62
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.61
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.61
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.61
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.61
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.61
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.61
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.6
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.6
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.6
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.59
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.59
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.59
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.58
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.57
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.56
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.56
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.55
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.54
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.54
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.54
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.54
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.53
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.52
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.51
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.51
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.49
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.49
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.48
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.48
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.47
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.47
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.47
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.45
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.44
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.44
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.42
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 99.42
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.42
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.41
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.41
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.4
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.39
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.38
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.37
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.37
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 99.37
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.36
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.36
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.36
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.35
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.35
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.35
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 99.35
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.34
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.34
3fwb_A161 Cell division control protein 31; gene gating, com 99.34
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.34
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.33
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.33
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.32
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.31
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.31
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.31
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.31
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.29
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.29
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.29
1y1x_A191 Leishmania major homolog of programmed cell death 99.29
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.29
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.28
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.28
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.27
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.27
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.27
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.26
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.26
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.25
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.25
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.25
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.25
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.24
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 99.24
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.23
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.23
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.22
3a4u_B143 Multiple coagulation factor deficiency protein 2; 99.21
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.21
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.2
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.2
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.2
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.19
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.19
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 99.18
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.16
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.16
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.16
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.15
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.15
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.14
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.14
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.13
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.13
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.12
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.11
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.11
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.1
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 99.1
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.09
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.08
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.08
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 99.07
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.04
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.04
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.03
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.03
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.99
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.97
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.97
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 98.97
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.96
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.96
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.95
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.95
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.93
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.92
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.92
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.9
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.9
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.9
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.9
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.89
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.89
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.88
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.88
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.87
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 98.87
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.87
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.85
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 98.85
2lv7_A100 Calcium-binding protein 7; metal binding protein; 98.85
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.84
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.83
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.82
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.81
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.8
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.8
3li6_A66 Calcium-binding protein; calcium signaling protein 98.8
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.79
1c07_A95 Protein (epidermal growth factor receptor pathway 98.78
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.78
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.77
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.76
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.75
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.75
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.74
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.74
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.74
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.74
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.73
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.72
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.72
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.71
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.71
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.71
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.71
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.69
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.68
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.68
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.67
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.65
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 98.64
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.64
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.63
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.63
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.62
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.62
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.61
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.61
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.58
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.57
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.56
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.55
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.55
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.54
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.54
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.52
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.52
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.52
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.51
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 98.51
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.5
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.49
1c07_A95 Protein (epidermal growth factor receptor pathway 98.47
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.46
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.46
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.45
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.44
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.44
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.42
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.42
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.41
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.4
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.4
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.4
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.4
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.39
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.39
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.38
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.38
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.37
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.35
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.35
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.35
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.33
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.33
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.32
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.31
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.31
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.28
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.28
3li6_A66 Calcium-binding protein; calcium signaling protein 98.27
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.24
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.22
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.21
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 98.2
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.19
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.18
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.17
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.16
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.13
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.03
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 97.82
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 97.65
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 97.64
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 97.53
2nqa_A326 Calpain 8; calpain, calcium-dependent cytoplasmic 97.23
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 97.19
2r9f_A339 Calpain-1 catalytic subunit; protease, peptidase, 97.18
1ziv_A339 Calpain 9; cysteine protease, papain, calcium-depe 97.02
1nub_A229 Basement membrane protein BM-40; extracellular mod 96.64
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 96.49
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 96.45
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 96.31
1nub_A229 Basement membrane protein BM-40; extracellular mod 95.02
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 92.97
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 91.8
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 85.15
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 84.98
2l5y_A150 Stromal interaction molecule 2; EF-hand, SAM domai 83.01
2jrf_A184 Tubulin polymerization-promoting protein family me 82.86
1wlm_A151 Protein CGI-38; structural genomics, NPPSFA, natio 81.3
3tdu_A200 DCN1-like protein 1; E2:E3, ligase-protein binding 80.13
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
Probab=100.00  E-value=5.5e-114  Score=1024.92  Aligned_cols=596  Identities=45%  Similarity=0.874  Sum_probs=530.7

Q ss_pred             CCCHHHHHHHHHHcCCceeCCCCCCCCCCcccCCCCC-----CceEeeCCC-----------------------------
Q psy14118         17 VQDFAAIRDRCLSQGTLFEDPDFPCDDSSIFYSKMPP-----KSFEWMRPM-----------------------------   62 (766)
Q Consensus        17 ~~~~~~i~~~c~~~~~~f~D~~Fp~~~~sl~~~~~~~-----~~~~w~Rp~-----------------------------   62 (766)
                      .|+|++|++.|+++|.+|+||+|||+.+||+++...+     ..++|+||.                             
T Consensus        29 ~~~~~~l~~~c~~~~~~f~D~~Fp~~~~sl~~~~~~~~~~~~~~~~W~Rp~e~~~~p~~~~~~~~~~di~QG~lgDCw~l  108 (714)
T 3bow_A           29 NQDYETLRNECLEAGALFQDPSFPALPSSLGFKELGPYSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDSWLL  108 (714)
T ss_dssp             GCCHHHHHHHHHHHTCCCCCTTSCSSGGGTCSSTTSTTCGGGTTCEEECHHHHCSSCBSCSSCSCGGGCBCCSSSCHHHH
T ss_pred             CCCHHHHHHHHHHcCCeeeCcCCCCCccccccCCCCccccccCCceEEChHHHhcCCeeeeCCCCccccccCCcCChHHH
Confidence            4899999999999999999999999999999765433     349999988                             


Q ss_pred             -------------------------------------CCeEEEEEeceeeeccCCcEEEEecCCCCchhHHHHHHHhhhh
Q psy14118         63 -------------------------------------YGRWVDVVIDDRLPTYYGKLVFLHSSTDNEFWSALLEKAYAKL  105 (766)
Q Consensus        63 -------------------------------------~G~W~~V~VDD~lP~~~g~~~~~~s~~~~e~W~~LlEKAyAKl  105 (766)
                                                           +|+|+.|+|||+|||.+|+++|++|.+++|+||+||||||||+
T Consensus       109 aala~la~~~~ll~~v~~~~~~~~~~~~G~y~~~~~~~G~w~~VvvDD~lP~~~g~~~f~~s~~~~e~W~~LlEKAyAK~  188 (714)
T 3bow_A          109 AAIASLTLNEEILARVVPLDQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSALLEKAYAKI  188 (714)
T ss_dssp             HHHHHHTTSHHHHHHHSCTTCCSSSSCSSEEEEEEEETTEEEEEEEESCEEEETTEESSCBCSSTTBCHHHHHHHHHHHH
T ss_pred             HHHHHHHhChHHHHhhcCcCcCcccCCceEEEEEEeeCCEEEEEEEeccceeeCCceEEeecCCCCcchHHHHHHHHHHH
Confidence                                                 8999999999999999999999999999999999999999999


Q ss_pred             cCCcccccCCChhhhhhhccCCeeEEEEcCCCchHHHHHHHHHhhcCCceeeecCCCC-cccccccCCCCCCCceeEEee
Q psy14118        106 HGSYEALKGGSTCEAMEDFTGGVSEMYELNEAPSNLWQILLKAHERSSLMGCSIEPDP-SVLEMQTPQGLVKGHAYSITR  184 (766)
Q Consensus       106 ~GsY~~l~gg~~~~al~dlTG~~~~~~~l~~~~~~lw~~l~~~~~~g~l~~~~~~~~~-~~~~~~~~~GL~~~haYsv~~  184 (766)
                      ||||++|.||++.+||++|||||++.+.+++.++.+|+.|.+++++|++|+|++..++ ...+.....||+.+|||+|++
T Consensus       189 ~G~Y~~l~gg~~~~al~~lTG~~~~~~~l~~~~~~l~~~l~~~~~~g~l~~~~~~~~~~~~~~~~~~~GL~~~HaYsvl~  268 (714)
T 3bow_A          189 NGCYEALSGGATTEGFEDFTGGIAEWYELRKPPPNLFKIIQKALEKGSLLGCSIDITSAADSEAVTYQKLVKGHAYSVTG  268 (714)
T ss_dssp             TSSSGGGSSBCHHHHHHHHHCCEEEEEETTSCCTTHHHHHHHHHHTTCEEEEECCSTTSCTTCCBCTTSCBTTSCEEEEE
T ss_pred             hCCcccccCCCHHHHHHHhhCCCeEEEEcCCCcHHHHHHHHHHHhCCCeEEEEcccCCcccccchhcCCCcCCceEEEee
Confidence            9999999999999999999999999999998889999999999999999999974222 223456789999999999999


Q ss_pred             EEEecccCCCCCCceeEEEEeCCCCCCCcccccCCCCCccCCCCCHHHHHHhCCccCCCCeEEEeHhHHHhhcCeEEEEe
Q psy14118        185 IKYVDISTPNTSGKIPLIRMRNPWGNEAEWNGAWSDKSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRLEICN  264 (766)
Q Consensus       185 v~~~~~~~~~~~~~~~ll~lrNPWg~~~eW~G~wsd~s~~W~~~~~~~~~~l~~~~~~dG~Fwm~~~df~~~F~~~~vc~  264 (766)
                      +.++.    ..+++++||||||||| ..||+|+|||+|++|+.++++++++|+... +||+|||+|+||+++|+.|+||+
T Consensus       269 ~~~v~----~~~~~~~lv~lrNPWg-~~ew~G~wsd~s~~W~~~~~~~~~~l~~~~-~dg~FWm~~~df~~~F~~~~ic~  342 (714)
T 3bow_A          269 AEEVE----SSGSLQKLIRIRNPWG-QVEWTGKWNDNCPSWNTVDPEVRANLTERQ-EDGEFWMSFSDFLRHYSRLEICN  342 (714)
T ss_dssp             EEEEE----ETTEEEEEEEEECTTS-CCCCCSTTSTTCGGGGGSCHHHHHHHCCCC-CSSEEEEEHHHHHHHCCEEEEEE
T ss_pred             eEEee----cCCCceEEEEEECCCC-CcccCCCCCCCCccccccCHHHHHHhCCCC-CCCeEEEEhHHHHhhCCeEEEEE
Confidence            99962    2356799999999999 999999999999999999889999998875 99999999999999999999999


Q ss_pred             cCCCcccccccccccCccccceeccccccccccCCCCCcccccCchhhhhcCccccCCCceeeecccccccccceEEeec
Q psy14118        265 LSPDSLIEDAMSRDRGKKWEMSVYEGEWVRGVTAGGSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRLEICNL  344 (766)
Q Consensus       265 ~~p~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~W~ll~rh~~~~lg~~~~~~g~~~~~~~d~~~~~~~i~~~~l  344 (766)
                      +.|+++...                                                                       
T Consensus       343 ~~~~~~~~~-----------------------------------------------------------------------  351 (714)
T 3bow_A          343 LTPDTLTCD-----------------------------------------------------------------------  351 (714)
T ss_dssp             SSSSCTTCS-----------------------------------------------------------------------
T ss_pred             ecccccccc-----------------------------------------------------------------------
Confidence            998864321                                                                       


Q ss_pred             CCCchhhhhccccCCCceeEEEEeeeeeeCCcCCCCccCccccccCCeEEEEEecccCCC--CCCceEEEEEEEeccchh
Q psy14118        345 SPDSLIEDAMSRDRGKKWEMSVYEGEWVRGVTAGGCRNYLETFWCNPQFKITLTEVDEND--EDGKCTVIIGLMQKNRRA  422 (766)
Q Consensus       345 ~~~~~~~~~~~~~~~~~w~~~~~~G~W~~g~tAGG~~~~~~tf~~NPQy~l~v~~~~~~~--~~~~~~v~i~L~Q~~~r~  422 (766)
                                   ....|+...++|+|++|.|||||+++++||++||||.|+|.+++++.  ...+|+|+|+|+|+++|.
T Consensus       352 -------------~~~~w~~~~~~g~W~~g~taGG~~~~~~tf~~NPqf~l~v~~~~~~~~~~~~~~~v~v~L~Q~~~r~  418 (714)
T 3bow_A          352 -------------SYKKWKLTKMDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDDEDGERGCTFLVGLIQKHRRR  418 (714)
T ss_dssp             -------------SCCEEEEEEEEEEECTTTTCCCCTTCHHHHTTSCCEEEEECGGGCBCGGGCCBEEEEEEEEEESCGG
T ss_pred             -------------cCcceEEEEEeceeccCCCCCCCCCccccccCCceEEEEEccCCccccccCCccEEEEEeeeecccc
Confidence                         13579999999999999999999999899999999999999876422  234699999999999998


Q ss_pred             hhccCCceeeeeEEEEEecCC--CCCCCCCCcccccccCCCcCCccccccceeeeeeeecCCceEEEcCCCCCCCccCce
Q psy14118        423 QKKTGAECLTIGFAVYQIEDP--DNVPTPLDLNFFKYNASCARAPSFINLREVSCRFKLPPGVYCIVPSTFEPNEEGEFI  500 (766)
Q Consensus       423 ~~~~~~~~~~Igf~v~~v~~~--~~~~~~l~~~~~~~~~~~~~s~~y~~~rev~~~~~L~pG~Y~IVPsT~~p~~~g~F~  500 (766)
                      .+..+....+|||+||+++.+  +....++++.||..+.+++.++.|.+.|||+.++.|+||+|+||||||+|+++|+|.
T Consensus       419 ~~~~g~~~~~Igf~v~~~~~~~~~~~~~~l~~~ff~~~~~~~~s~~f~~~Rev~~~~~L~pG~Y~IVPstf~p~~e~~F~  498 (714)
T 3bow_A          419 QRKMGEDMHTIGFGIYEVPEELTGQTNIHLSKNFFLTTRARERSDTFINLREVLNRFKLPPGEYVLVPSTFEPHKNGDFC  498 (714)
T ss_dssp             GGGGTCCCCCEEEEEEECCGGGSSCTTCCCCHHHHHHCCCSEECSCEESSSEEEEEEEECSEEEEEEEEESSTTCCEEEE
T ss_pred             ccccCCCcceEEEEEEEecccccCccccccchhhccccCCccccCCcccccceEEEEEeCCCCeEEEEecCCCCCcccee
Confidence            877788899999999999631  112357788899888888889999999999999999999999999999999999999


Q ss_pred             eEEeecCCCCcccCccccccCcccCccCCCCCCCCcchhh-HHHHHHHHHHHcCCCcccCHHHHHHHHHHHhhccccccc
Q psy14118        501 LRVFSEHKNNMEENDEEVGMGEIDNRIQIPDEPQPEKEKK-TEAIRQFFQKLAGDDMEVDWMELKDILDYAMRNETKTTT  579 (766)
Q Consensus       501 LrV~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~r~~F~~~d~~~g~i~~~el~~~l~~~~~~~~~~~~  579 (766)
                      |||||+.+..+.++++...+....         .+-++++ .+.++++|+++|+++|.|+.+||+.+|+.++...+    
T Consensus       499 Lrv~s~~~~~~~el~~~~~~~~~~---------~~ls~~e~~~~l~~~F~~~Dd~dG~Is~~El~~~L~~l~~~~~----  565 (714)
T 3bow_A          499 IRVFSEKKADYQTVDDEIEANIEE---------IEANEEDIGDGFRRLFAQLAGEDAEISAFELQTILRRVLAKRE----  565 (714)
T ss_dssp             EEEEEEESSCC--CCCSCEECCCC---------CCCSGGGCCHHHHHHHHHHHGGGTSBCHHHHHHHHHHHHTTCT----
T ss_pred             EEEeccCCcceeeccccccccccc---------CCCChhhHHHHHHHHHHHHcCCCCcCCHHHHHHHHHHHhhhcc----
Confidence            999999999999998876532111         1123444 88999999999988999999999999998642210    


Q ss_pred             cCCcccceeeccCCCCCCCCCCCCcchhhhHHHHhccccCCCCccccccccccCCCCCCHHHHHHHHHhhcCCCCccccH
Q psy14118        580 EGGFSKDVCRNVPANTSTTDSPATGIVGNLLALICGNACRDTPLGAALETKTTTEGGFSKDVCRSMVAMLDVDRSGKLGF  659 (766)
Q Consensus       580 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~s~~~i~~l~~~~D~d~~G~I~~  659 (766)
                                                                         ...+..++.++++.||+.+|.|++|.|+|
T Consensus       566 ---------------------------------------------------~~~g~~~s~~~~~~l~~~~D~d~~G~I~f  594 (714)
T 3bow_A          566 ---------------------------------------------------DIKSDGFSIETCKIMVDMLDEDGSGKLGL  594 (714)
T ss_dssp             ---------------------------------------------------TSCCSCCCHHHHHHHHHHHCCSSCSSBCH
T ss_pred             ---------------------------------------------------cccCCCCCHHHHHHHHHHhCCCCCCcCcH
Confidence                                                               11246789999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHhhhhcCCCCcccCHHHHHHHHHHhCCCCCHHHHHHHHHHccCCCCcccHHHHHHHHHHHHHHHH
Q psy14118        660 EEFQQLWKDIRNWKSVFKMYDQENSGYLSPFELRQALTSAGYHLNNHILNILAHRYSGRDARISFDDFMMCAVRLKTMID  739 (766)
Q Consensus       660 ~EF~~~~~~~~~l~~~F~~~D~d~~G~Is~~El~~~L~~~g~~ls~~~~~~l~~~~dd~dG~Is~~EF~~~l~~l~~~~~  739 (766)
                      +||+.++..++.++.+|+.+|+|++|+|+.+||+.+|..+|..+++++++.+++.+||+||.|+|+||+.++.+++.+.+
T Consensus       595 ~EF~~l~~~~~~l~~~F~~~D~d~dG~Is~~El~~~L~~~G~~ls~~~~~~l~~~~Dd~dG~Isf~EF~~~l~~~~~l~~  674 (714)
T 3bow_A          595 KEFYILWTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKLPCQLHQVIVARFADDELIIDFDNFVRCLVRLEILFK  674 (714)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHCTTCCSSEEHHHHHHHHHHTTEECCHHHHHHHHHHHSCTTCEECHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHhCCCCCCeECHHHHHHHHHHcCCCCCHHHHHHHHHHhCCCCCeEcHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhccCCCCCceEEeCHHHHHHHHhcC
Q psy14118        740 LFKARDPSSTNKATFTLEEWVENTLYS  766 (766)
Q Consensus       740 ~F~~~D~d~~G~I~lt~~ef~~~~~~~  766 (766)
                      +|+.+|++++|+|+++..+|+.++||+
T Consensus       675 ~F~~~D~d~dG~Is~~el~~l~~~~~~  701 (714)
T 3bow_A          675 IFKQLDPENTGTIQLDLISWLSFSVLG  701 (714)
T ss_dssp             HHSSSCSSCCSEEEEEHHHHHHHHHHC
T ss_pred             HHHHhCCCCCCcEEHHHHHHHHHHHHH
Confidence            999999999999999999999999986
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1ziv_A Calpain 9; cysteine protease, papain, calcium-dependent, thiol protease, structural genomics consortium, SGC, hydrolase; 2.31A {Homo sapiens} SCOP: d.3.1.3 PDB: 2p0r_A* Back     alignment and structure
>2r9f_A Calpain-1 catalytic subunit; protease, peptidase, inhibitor, alpha-ketoamide, hydrolase, thiol protease; HET: K2Z; 1.60A {Rattus norvegicus} SCOP: d.3.1.3 PDB: 1tlo_A* 2g8e_A* 1tl9_A* 2nqg_A* 2nqi_A* 2r9c_A* 2g8j_A* 1kxr_A 2ary_A 1zcm_A* 1mdw_A Back     alignment and structure
>2nqa_A Calpain 8; calpain, calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC; HET: AR7; 2.20A {Homo sapiens} Back     alignment and structure
>2qfe_A Calpain-7; C2-like domain, hydrolase, nuclear protein, protease, thiol protease; 1.45A {Homo sapiens} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>2nqa_A Calpain 8; calpain, calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC; HET: AR7; 2.20A {Homo sapiens} Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>2r9f_A Calpain-1 catalytic subunit; protease, peptidase, inhibitor, alpha-ketoamide, hydrolase, thiol protease; HET: K2Z; 1.60A {Rattus norvegicus} SCOP: d.3.1.3 PDB: 1tlo_A* 2g8e_A* 1tl9_A* 2nqg_A* 2nqi_A* 2r9c_A* 2g8j_A* 1kxr_A 2ary_A 1zcm_A* 1mdw_A Back     alignment and structure
>1ziv_A Calpain 9; cysteine protease, papain, calcium-dependent, thiol protease, structural genomics consortium, SGC, hydrolase; 2.31A {Homo sapiens} SCOP: d.3.1.3 PDB: 2p0r_A* Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 Back     alignment and structure
>3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 766
d1ziva1310 d.3.1.3 (A:28-337) Calpain large subunit, catalyti 8e-72
d1ziva1310 d.3.1.3 (A:28-337) Calpain large subunit, catalyti 2e-14
d1ziva1310 d.3.1.3 (A:28-337) Calpain large subunit, catalyti 1e-10
d1mdwa_323 d.3.1.3 (A:) Calpain large subunit, catalytic doma 2e-69
d1mdwa_323 d.3.1.3 (A:) Calpain large subunit, catalytic doma 6e-12
d1mdwa_323 d.3.1.3 (A:) Calpain large subunit, catalytic doma 2e-10
d2r9fa1322 d.3.1.3 (A:33-354) Calpain large subunit, catalyti 4e-69
d2r9fa1322 d.3.1.3 (A:33-354) Calpain large subunit, catalyti 1e-12
d2r9fa1322 d.3.1.3 (A:33-354) Calpain large subunit, catalyti 3e-10
d1qxpa3159 b.14.1.1 (A:356-514) Calpain large subunit, middle 3e-65
d1qxpa3159 b.14.1.1 (A:356-514) Calpain large subunit, middle 4e-04
d1df0a2159 b.14.1.1 (A:356-514) Calpain large subunit, middle 2e-62
d1df0a2159 b.14.1.1 (A:356-514) Calpain large subunit, middle 0.001
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 5e-35
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 3e-33
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 6e-31
d1juoa_172 a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 2e-27
d1alva_173 a.39.1.8 (A:) Calpain small (regulatory) subunit ( 3e-24
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 4e-14
d1hqva_181 a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous 4e-10
d1y1xa_182 a.39.1.8 (A:) Programmed cell death 6 protein-like 3e-08
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 3e-07
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 3e-07
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 2e-06
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 3e-06
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 3e-06
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 6e-06
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 6e-06
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 7e-06
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 7e-06
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 8e-06
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 0.002
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-05
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 1e-05
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 2e-05
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 2e-05
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 5e-05
d1qx2a_76 a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax 9e-05
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 2e-04
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 3e-04
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 3e-04
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 5e-04
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 5e-04
d1wlza183 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H 6e-04
d2zkmx1170 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human 6e-04
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 7e-04
d1a4pa_92 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 8e-04
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 9e-04
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 0.001
d1m45a_146 a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye 0.002
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 0.002
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 0.003
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 0.003
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 0.004
>d1ziva1 d.3.1.3 (A:28-337) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens), calpain 9 [TaxId: 9606]} Length = 310 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Calpain large subunit, catalytic domain (domain II)
domain: Calpain large subunit, catalytic domain (domain II)
species: Human (Homo sapiens), calpain 9 [TaxId: 9606]

 Score =  235 bits (599), Expect = 8e-72
 Identities = 121/212 (57%), Positives = 153/212 (72%), Gaps = 6/212 (2%)

Query: 56  FEWMRPMYGRWVDVVIDDRLPTYYGKLVFLHSSTDNEFWSALLEKAYAKLHGSYEALKGG 115
           F +    +  W+DVVIDDRLPT+  +LVFLHS+  NEFWSALLEKAYAKL+GSYEALKGG
Sbjct: 104 FHFQFWQHSEWLDVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGG 163

Query: 116 STCEAMEDFTGGVSEMYELNEAPSNLWQILLKAHERSSLMGCSIEP-DPSVLEMQTPQGL 174
           S  EAMEDFTGGV+E ++  EAP N ++IL KA +R SL+GC I+    +  E +TP GL
Sbjct: 164 SAIEAMEDFTGGVAETFQTKEAPENFYEILEKALKRGSLLGCFIDTRSAAESEARTPFGL 223

Query: 175 VKGHAYSITRIKYVDISTPNTSGKIPLIRMRNPWGNEAEWNGAWSDKSQEWRFIPDHEKR 234
           +KGHAYS+T I  V         +I LIR+RNPWG + EWNG+WSD S EWR +   E++
Sbjct: 224 IKGHAYSVTGIDQVSFR----GQRIELIRIRNPWG-QVEWNGSWSDSSPEWRSVGPAEQK 278

Query: 235 ELGLTFDDDGEFWMSYKDFLKYFSRLEICNLS 266
            L  T  DDGEFWM++KDF  +F ++EICNL+
Sbjct: 279 RLCHTALDDGEFWMAFKDFKAHFDKVEICNLT 310
>d1ziva1 d.3.1.3 (A:28-337) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens), calpain 9 [TaxId: 9606]} Length = 310 Back     information, alignment and structure
>d1ziva1 d.3.1.3 (A:28-337) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens), calpain 9 [TaxId: 9606]} Length = 310 Back     information, alignment and structure
>d1mdwa_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 323 Back     information, alignment and structure
>d1mdwa_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 323 Back     information, alignment and structure
>d1mdwa_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 323 Back     information, alignment and structure
>d2r9fa1 d.3.1.3 (A:33-354) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 322 Back     information, alignment and structure
>d2r9fa1 d.3.1.3 (A:33-354) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 322 Back     information, alignment and structure
>d2r9fa1 d.3.1.3 (A:33-354) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 322 Back     information, alignment and structure
>d1qxpa3 b.14.1.1 (A:356-514) Calpain large subunit, middle domain (domain III) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 159 Back     information, alignment and structure
>d1qxpa3 b.14.1.1 (A:356-514) Calpain large subunit, middle domain (domain III) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 159 Back     information, alignment and structure
>d1df0a2 b.14.1.1 (A:356-514) Calpain large subunit, middle domain (domain III) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 159 Back     information, alignment and structure
>d1df0a2 b.14.1.1 (A:356-514) Calpain large subunit, middle domain (domain III) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 159 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query766
d2r9fa1322 Calpain large subunit, catalytic domain (domain II 100.0
d1ziva1310 Calpain large subunit, catalytic domain (domain II 100.0
d1mdwa_323 Calpain large subunit, catalytic domain (domain II 100.0
d1df0a2159 Calpain large subunit, middle domain (domain III) 100.0
d1qxpa3159 Calpain large subunit, middle domain (domain III) 100.0
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.95
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.94
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.94
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.91
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.91
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.78
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.75
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.75
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.73
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.73
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.71
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.7
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.69
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.69
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.66
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.65
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.63
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.61
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.6
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.58
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.58
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.57
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.56
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.55
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.55
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.54
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.53
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.53
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.51
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.51
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.5
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.49
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.49
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.48
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.48
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.45
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.41
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.4
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.4
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.4
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.4
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.37
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.35
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.35
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.34
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.3
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.27
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.26
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.25
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.25
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.24
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.24
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.21
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.19
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.19
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.18
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.17
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.16
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.16
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.15
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.14
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.14
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.14
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.14
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.14
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.14
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.13
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.13
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.12
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.11
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.11
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.1
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.09
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.08
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.06
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.06
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.06
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.05
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.04
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.03
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.03
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.02
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.02
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 98.97
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.97
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.96
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.95
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.9
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.89
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.89
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.87
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 98.86
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.86
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 98.85
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.84
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.82
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 98.8
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 98.78
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.78
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.76
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.74
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 98.74
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.73
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 98.72
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.71
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.71
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 98.68
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.66
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.66
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.66
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.63
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.62
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.61
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.6
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.57
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.57
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.53
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.53
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.53
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 98.53
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.52
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.52
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.52
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 98.51
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.5
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.48
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.48
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.47
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.47
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.46
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.45
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.44
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.44
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.39
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.39
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.36
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.31
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.3
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.22
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.17
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.16
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.11
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.1
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.06
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 97.98
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.9
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.9
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.88
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.77
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.68
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.55
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.47
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 96.93
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 96.62
d1ziva1310 Calpain large subunit, catalytic domain (domain II 96.54
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 96.04
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.98
d2r9fa1322 Calpain large subunit, catalytic domain (domain II 95.95
d1mdwa_323 Calpain large subunit, catalytic domain (domain II 95.76
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 93.6
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 92.22
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 91.13
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 90.46
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 87.33
d1h8ba_73 alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} 85.24
d1pula1103 Hypothetical protein c32e8.3 {Caenorhabditis elega 80.83
>d2r9fa1 d.3.1.3 (A:33-354) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Calpain large subunit, catalytic domain (domain II)
domain: Calpain large subunit, catalytic domain (domain II)
species: Rat (Rattus norvegicus), mu-type [TaxId: 10116]

Probab=100.00  E-value=8.5e-61  Score=513.52  Aligned_cols=244  Identities=56%  Similarity=1.018  Sum_probs=221.0

Q ss_pred             CCCHHHHHHHHHHcCCceeCCCCCCCCCCcccCCCCC-----CceEeeCCC-----------------------------
Q psy14118         17 VQDFAAIRDRCLSQGTLFEDPDFPCDDSSIFYSKMPP-----KSFEWMRPM-----------------------------   62 (766)
Q Consensus        17 ~~~~~~i~~~c~~~~~~f~D~~Fp~~~~sl~~~~~~~-----~~~~w~Rp~-----------------------------   62 (766)
                      +|||++|++.|+++|.+|+|++|||+..||+.+..++     ..++|+||+                             
T Consensus         7 ~q~~~~i~~~c~~~~~~f~D~~Fpp~~~Sl~~~~~~~~~~~~~~i~W~Rp~e~~~~~~~~~~~~~~~di~QG~lgDC~ll   86 (322)
T d2r9fa1           7 GQDYENLRARCLQNGVLFQDDAFPPVSHSLGFKELGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLL   86 (322)
T ss_dssp             GCCHHHHHHHHHHTTCCCCCTTSCSSHHHHCSSTTSTTSHHHHHCEEECHHHHCSSCBSCSSCSCGGGCBCCSSSCHHHH
T ss_pred             CcCHHHHHHHHHHcCCeeECcCCcCCccccccCcCCccccccCCcEEECcHHhcCCCeEEeCCCCcccccCCCcCCEEHH
Confidence            5999999999999999999999999999998765332     358999988                             


Q ss_pred             -------------------------------------CCeEEEEEeceeeeccCCcEEEEecCCCCchhHHHHHHHhhhh
Q psy14118         63 -------------------------------------YGRWVDVVIDDRLPTYYGKLVFLHSSTDNEFWSALLEKAYAKL  105 (766)
Q Consensus        63 -------------------------------------~G~W~~V~VDD~lP~~~g~~~~~~s~~~~e~W~~LlEKAyAKl  105 (766)
                                                           +|+|+.|+|||+|||.+|+++|+++.+++|+||+||||||||+
T Consensus        87 sal~~la~~~~~~~~i~~~~~~~~~~~~G~y~v~l~~~G~w~~V~VDD~lP~~~g~~~~~~~~~~~e~W~~LlEKAyAKl  166 (322)
T d2r9fa1          87 AAIASLTLNETILHRVVPYGQSFQEGYAGIFHFQLWQFGEWVDVVVDDLLPTKDGKLVFVHSAQGNEFWSALLEKAYAKV  166 (322)
T ss_dssp             HHHHHHTTCHHHHHHHSCSCCCSSTTCCSEEEEEEEETTEEEEEEEESCEEEETTEESSCBCSSTTBCHHHHHHHHHHHH
T ss_pred             HHHHHHHcChhhhhccCCcCcccccCcceeEEEEEeeCCeeEEEEecCceeccCCCEeeeecCCCCccHHHHHHHHHHHH
Confidence                                                 9999999999999999999999999999999999999999999


Q ss_pred             cCCcccccCCChhhhhhhccCCeeEEEEcCCCchHHHHHHHHHhhcCCceeeecCCC-CcccccccCCCCCCCceeEEee
Q psy14118        106 HGSYEALKGGSTCEAMEDFTGGVSEMYELNEAPSNLWQILLKAHERSSLMGCSIEPD-PSVLEMQTPQGLVKGHAYSITR  184 (766)
Q Consensus       106 ~GsY~~l~gg~~~~al~dlTG~~~~~~~l~~~~~~lw~~l~~~~~~g~l~~~~~~~~-~~~~~~~~~~GL~~~haYsv~~  184 (766)
                      ||||++|.||++.+||++|||+|++.++++..++++|+.|.+++++|++|+|++... ....+.....||+.+|||+|++
T Consensus       167 ~GsY~~l~gG~~~~aL~~LTG~~~~~~~~~~~~~~~~~~l~~~~~~g~~~~~~~~~~~~~~~e~~~~~GLv~~HaYsVl~  246 (322)
T d2r9fa1         167 NGSYEALSGGCTSEAFEDFTGGVTEWYDLQKAPSDLYQIILKALERGSLLGCSINISDIRDLEAITFKNLVRGHAYSVTD  246 (322)
T ss_dssp             HTSSGGGSSCCHHHHHHHTTCCEEEEEEGGGCCTTHHHHHHHHHHHTCEEEEECCCSSSSTTCSBCTTSCBTTCCEEEEE
T ss_pred             hCCccccCCCCHHHHHHHhcCCCcEEEEcccCchhHHHHHHHHHHCCCceEEEEecCCccchhhhhhcCCcCCcceEEEE
Confidence            999999999999999999999999999998888899999999999999999987643 2333455678999999999999


Q ss_pred             EEEecccCCCCCCceeEEEEeCCCCCCCcccccCCCCCccCCCCCHHHHHHhCCccCCCCeEEEeHhHHHhhcCeEEEEe
Q psy14118        185 IKYVDISTPNTSGKIPLIRMRNPWGNEAEWNGAWSDKSQEWRFIPDHEKRELGLTFDDDGEFWMSYKDFLKYFSRLEICN  264 (766)
Q Consensus       185 v~~~~~~~~~~~~~~~ll~lrNPWg~~~eW~G~wsd~s~~W~~~~~~~~~~l~~~~~~dG~Fwm~~~df~~~F~~~~vc~  264 (766)
                      ++++.    ..+.+++||||||||| ..+|+|+|||.|.+|+.+++..+..+... .+||+|||+|+||+++|+.|+||+
T Consensus       247 v~~~~----~~~~~~~Lv~LRNPwg-~~ew~G~ws~~s~~W~~~~~~~~~~~~~~-~ddG~FWms~~df~~~F~~v~vC~  320 (322)
T d2r9fa1         247 AKQVT----YQGQRVNLIRMRNPWG-EVEWKGPWSDNSYEWNKVDPYEREQLRVK-MEDGEFWMSFRDFIREFTKLEICN  320 (322)
T ss_dssp             EEEEE----ETTEEEEEEEEECTTS-CCCCCSTTSTTCGGGGGSCHHHHHHHCCC-CCSSEEEEEHHHHHHHCCEEEEEE
T ss_pred             EEEEe----eCCCcEEEEEEECCCC-CCcccCCCCCCChhhccCCHHHHHhcCCC-CCCCEEEeEHHHHHHhCCceEEEe
Confidence            99862    2446789999999999 89999999999999999988888877765 589999999999999999999999


Q ss_pred             cC
Q psy14118        265 LS  266 (766)
Q Consensus       265 ~~  266 (766)
                      +.
T Consensus       321 ~~  322 (322)
T d2r9fa1         321 LT  322 (322)
T ss_dssp             CC
T ss_pred             CC
Confidence            74
>d1ziva1 d.3.1.3 (A:28-337) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens), calpain 9 [TaxId: 9606]} Back     information, alignment and structure
>d1mdwa_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1df0a2 b.14.1.1 (A:356-514) Calpain large subunit, middle domain (domain III) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1qxpa3 b.14.1.1 (A:356-514) Calpain large subunit, middle domain (domain III) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ziva1 d.3.1.3 (A:28-337) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens), calpain 9 [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2r9fa1 d.3.1.3 (A:33-354) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1mdwa_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure