Psyllid ID: psy14256


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------
MSNLSSVGQYSLLFSTFSRVPNPSFSLRFWDDKTIAVTVPSVKPLEKKKKIVPNPKPWFARIGLVLTLKYVEFFIHYHLLLSESYLTSDRIPNDYVFNDFAEDETRRHIKYALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQKATPDPTSEEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNIPKELNFLEEASNITKVTKMFAHFPWLKIPQIHPDLCTSRVLAMDFMEGGQINDVDYITENNINVYEVSDKLGKLYSEMIFNSGFVHSDPHPGNILVRRAQSSNSAELILLDHGLYASLTDDFRTEYAKLWLSILNKDKVAMKEHCTKLGVGDMYGLFACMVSGRSWDAIEAGIEKTKFTESEKEVFQRDVPNLIPEISDILTRVNRQVLLILKTNDLIRGIEHTLKTHARRVSLLVMSRCCIRSVYSEEYSHAHSHLKKCVLLISEKWQLFKLSMYYFYLGISRPMLEGFHFWIDNTSSKENDATTPSSSDWWKGFLDAARNKVGAVLIDNTSSKENDATTPSSSDWWKGFLDAARNKVGAVLLVSMIERSTTLDLKSAEVLEFVKKDFDELSTTVKTEATNVVQQTTTVFRETLQLDKPESTASSMKKSVSTFLDQVSTVLNPSPDDEDEEAVVIHGTDVVPLTRLQAQLYALSNEPDTYLKEIDSINYVDQKYPWALFPEDKKCSWGLFPEFTVWPLFLTKVPLFKAIRTDSIIYDNQKSPRAGSREMYGTPAIQGENLEKAQKEEAFLSTYSNFGHQEHFSGQQIFYSLQNFNICSVVFPPCHAAFGKKNRCTPFELSYEAWLELLEEQGNKQLSNEKLIKMLVNNPQLQDNFQNLVPNQDSRAQLGNNEIHTENGIAENVNYDSIYRTAGHSLEIMKSTQKMEKSQTLNKKVWKLYS
cccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccEEEEEEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHEEEEEEEccccccccEEEEEHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEHHHHHHHccccccHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHcccccccHHHcHHHccEEEEcccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccEEEcccccccccccEEEEEcccccccccHHHHHHccccHHHHHHHHHHHHHHccccccccccccccccEEEEEcccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHcHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcccEEcccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEccccccHHHHHHHHHHHccccccHHHcccccccccccccccccccccccccccccccccccccccccccHHHHccccEEccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccEEEEcccccEEEEEccccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccc
ccccccHcHEEEEEEcccccccccEEEEEEcccEEEEEccccccHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcHHHHHHHcccccHHHHHHHHHHHcccccccHHHHHHHHHHHcccEEEEEcHHHccHHHcccHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHccccccEEEEHHHHHEEEcccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcEEEEccccccEEEEEEEccccccHHHHHHHccccHHHHHHcccEEEEEEEEccccEccccccccEEEEccccccccEEEEEEccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEccccccHHHHHHHHHHcccccccccHHHccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcHHHHHcEEEEEEccHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccHHcccccccHHHHHHHHHHHHHHHHHHHHEHHHHHcccccccccHHHHHHHHHcHHHccccEEcccccHHHHcHHHHHHHHccccccccHHHHHHcHHHHHHHHccccccccccccccEEEEEccccccHHHHHHHHHHHccccccHHHEEcccccccccccccccccccccccccccccEEcHHHHccccHHHHEccccEEEccccccccccccccccHHcccHHHHHHHHHHHHHHHcccccccccccccEEEEEcccccEEEEEccccHHHccccccccccHccHHHHHHHHHHHccccccHHHHHHHHHccHHHHHHHHHcccccccHHHcccccccccccccEEccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcc
msnlssvgqYSLLFSTfsrvpnpsfslrfwddktiavtvpsvkplekkkkivpnpkpwfARIGLVLTLKYVEFFIHYHLLLSesyltsdripndyvfndfaedeTRRHIKYALGVGSVIGGTGillhrnnydvNSLVAVRLVRAASCVFNIAYIYKKALyqkatpdptseeysnLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLhskapmspmKDILAVLKEdlgkdpseifasiepnpmgaASLAQVHKATlhdgstiaLKVQhrnvrdnanIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNIPKELNFLEEASNITKVTKMFahfpwlkipqihpdlctSRVLAMDfmeggqindvdyitenninVYEVSDKLGKLYSEMIFnsgfvhsdphpgnilvrraqssnsAELILLDHGLYASLTDDFRTEYAKLWLSILNKDKVAMKEHCtklgvgdmyGLFACMVSGRSWDAIEAGiektkftesEKEVFqrdvpnlipeiSDILTRVNRQVLLILKTNDLIRGIEHTLKTHARRVSLLVMSrccirsvyseeysHAHSHLKKCVLLISEKWQLFKLSMYYFYLgisrpmlegfhfwidntsskendattpsssdWWKGFLDAARNKVGAVLIdntsskendattpsssdWWKGFLDAARNKVGAVLLVSMIERSTTLDLKSAEVLEFVKKDFDELSTTVKTEATNVVQQTTTVFRETlqldkpestassMKKSVSTFLDQVstvlnpspddedeeavvihgtdvvplTRLQAQLYAlsnepdtylkeidsinyvdqkypwalfpedkkcswglfpeftvwplfltkvplfkairtdsiiydnqkspragsremygtpaiqgenLEKAQKEEAFLSTysnfghqehfsgqQIFYSLqnfnicsvvfppchaafgkknrctpfeLSYEAWLELLEEQGNKQLSNEKLIKMLVnnpqlqdnfqnlvpnqdsraqlgnneihtengiaenvnydsiyrtaGHSLEIMKSTQKMEKSQTLNKKVWKLYS
MSNLSSVGQYSLLFSTFSRVPNPSFSLRFWDDKTIAvtvpsvkplekkkkivpnpkpwFARIGLVLTLKYVEFFIHYHLLLSESYLTSDRIPNDYVFNDFAEDETRRHIKYALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQKATPDPTSEEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVlhskapmspMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNIPKELNFLEEASNITKVTKMFAHFPWLKIPQIHPDLCTSRVLAMDFMEGGQINDVDYITENNINVYEVSDKLGKLYSEMIFNSGFVHSDPHPGNILVRRAQSSNSAELILLDHGLYASLTDDFRTEYAKLWLSILNKDKVAMKEHCTKLGVGDMYGLFACMVSGRSWDAIEAGIektkftesekevfqrdvpnlipeisdiltrVNRQVLLILKTNDLIRGIEHTLKTHARRVSLLVMSRCCIRSVYSEEYSHAHSHLKKCVLLISEKWQLFKLSMYYFYLGISRPMLEGFHFWIDNTSSKENDATTPSSSDWWKGFLDAARNKVGAVLIdntsskendattpsssdWWKGFLDAARNKVGAVLLVSMIErsttldlksaEVLEFVKKDFDElsttvkteatnvvqqtttvfretlqldkpestassmkksVSTFLDQVSTVLNPSPDDEDEEAVVIHGTDVVPLTRLQAQLYALSNEPDTYLKEIDSINYVDQKYPWALFPEDKKCSWGLFPEFTVWPLFLTKVPLFKairtdsiiydnqkspragsreMYGTPAIQGENLEKAQKEEAFLSTYSNFGHQEHFSGQQIFYSLQNFNICSVVFPPCHAAFGKKNRCTPFELSYEAWLELLEEQGNKQLSNEKLIKMLVNNPQLQDNFQNLVPNQDSRAQLGNNEIHTENGIAENVNYDSIYRTAGHSLEIMKStqkmeksqtlnkkvwklys
MSNLSSVGQYSLLFSTFSRVPNPSFSLRFWDDKTIAVTVPSVKPLEKKKKIVPNPKPWFARIGLVLTLKYVEFFIHYHLLLSESYLTSDRIPNDYVFNDFAEDETRRHIKYALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQKATPDPTSEEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNIPKELNFLEEASNITKVTKMFAHFPWLKIPQIHPDLCTSRVLAMDFMEGGQINDVDYITENNINVYEVSDKLGKLYSEMIFNSGFVHSDPHPGNILVRRAQSSNSAELILLDHGLYASLTDDFRTEYAKLWLSILNKDKVAMKEHCTKLGVGDMYGLFACMVSGRSWDAIEAGIEKTKFTESEKEVFQRDVPNLIPEISDILTRVNRQVLLILKTNDLIRGIEHTLKTHARRVSLLVMSRCCIRSVYSEEYSHAHSHLKKCVLLISEKWQLFKLSMYYFYLGISRPMLEGFHFWIDNTSSKENDATTPSSSDWWKGFLDAARNKVGAVLIDNTSSKENDATTPSSSDWWKGFLDAARNKVGAVLLVSMIERSTTLDLKSAEVLEFVKKDFDELSTTVKTEATNVVQQTTTVFRETLQLDKPESTASSMKKSVSTFLDQVSTVLNPSPDDEDEEAVVIHGTDVVPLTRLQAQLYALSNEPDTYLKEIDSINYVDQKYPWALFPEDKKCSWGLFPEFTVWPLFLTKVPLFKAIRTDSIIYDNQKSPRAGSREMYGTPAIQGENLEKAQKEEAFLSTYSNFGHQEHFSGQQIFYSLQNFNICSVVFPPCHAAFGKKNRCTPFELSYEAWLELLEEQGNKQLSNEKLIKMLVNNPQLQDNFQNLVPNQDSRAQLGNNEIHTENGIAENVNYDSIYRTAGHSLEIMKSTQKMEKSQTLNKKVWKLYS
********QYSLLFSTFSRVPNPSFSLRFWDDKTIAVTVPSVKPLEKKKKIVPNPKPWFARIGLVLTLKYVEFFIHYHLLLSESYLTSDRIPNDYVFNDFAEDETRRHIKYALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQ***********************EQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHS********DILAVLK***********************LAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNIPKELNFLEEASNITKVTKMFAHFPWLKIPQIHPDLCTSRVLAMDFMEGGQINDVDYITENNINVYEVSDKLGKLYSEMIFNSGFVHSDPHPGNILVRRA***NSAELILLDHGLYASLTDDFRTEYAKLWLSILNKDKVAMKEHCTKLGVGDMYGLFACMVSGRSWDAIEAGIEKTKFTESEKEVFQRDVPNLIPEISDILTRVNRQVLLILKTNDLIRGIEHTLKTHARRVSLLVMSRCCIRSVYSEEYSHAHSHLKKCVLLISEKWQLFKLSMYYFYLGISRPMLEGFHFWIDN**************DWWKGFLDAARNKVGAVLID***************DWWKGFLDAARNKVGAVLLVSMIERSTTLDLKSAEVLEFVKKDFDELSTTVKTEATNVVQQTTTVFR****************************************AVVIHGTDVVPLTRLQAQLYALSNEPDTYLKEIDSINYVDQKYPWALFPEDKKCSWGLFPEFTVWPLFLTKVPLFKAIRTDSIIYD*******************************FLSTYSNFGHQEHFSGQQIFYSLQNFNICSVVFPPCHAAFGKKNRCTPFELSYEAWLELLEEQ********KLIKMLVN*****************************NGIAENVNYDSIYRTAGH**************************
*********YSL***************************************************LVLTLKYVEFFIHYHL*******************************YALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQKATPDPTSEEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNIPKELNFLEEASNITKVTKMFAHFPWLKIPQIHPDLCTSRVLAMDFMEGGQINDVDYITENNINVYEVSDKLGKLYSEMIFNSGFVHSDPHPGNILVRRAQSSNSAELILLDHGLYASLTDDFRTEYAKLWLSILNKDKVAMKEHCTKLGVGDMYGLFACMVSGRSWDAIEAG*****************VPNLIPEISDILTRVNRQVLLILKTNDLIRGIEHTLKTHARRVSLLVMSRCCIRSVYSE********LKKCVLLISEKWQLFKLSMYYFYLGISRPMLEGFHFWIDNTS*******TPSSSDWWKGFLDAARNKVGAVLIDN*********TPSSSDWWKGFLDAARNKVGAVLLVSMIERS********EVLEFVKKDFDELSTTVKTEATNVVQQTTTV**********************TFLDQVSTVLN*****EDEEAVVIHGTDVVPLTRLQAQLYALSNEPDTYLKEIDSINYVDQKYPWALFPEDKKCSWGLFPEFTVWPLFLTKVPLFKAIRTDSIIY*******************************AFLSTYSNFGHQEHFSGQQIFYSLQNFNICSVVFPPCHAAFGKKNRCTPFELSYEAWLELLEE*********KLIKMLVNNPQLQDNFQNLVP************IHTENGIAENVNYDSIYRTAGHSLE****************KVWKLYS
MSNLSSVGQYSLLFSTFSRVPNPSFSLRFWDDKTIAVTVPSVKPLEKKKKIVPNPKPWFARIGLVLTLKYVEFFIHYHLLLSESYLTSDRIPNDYVFNDFAEDETRRHIKYALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQK**************SKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNIPKELNFLEEASNITKVTKMFAHFPWLKIPQIHPDLCTSRVLAMDFMEGGQINDVDYITENNINVYEVSDKLGKLYSEMIFNSGFVHSDPHPGNILVRRAQSSNSAELILLDHGLYASLTDDFRTEYAKLWLSILNKDKVAMKEHCTKLGVGDMYGLFACMVSGRSWDAIEAGIEKTKF********QRDVPNLIPEISDILTRVNRQVLLILKTNDLIRGIEHTLKTHARRVSLLVMSRCCIRSVYSEEYSHAHSHLKKCVLLISEKWQLFKLSMYYFYLGISRPMLEGFHFWIDNTS***********SDWWKGFLDAARNKVGAVLIDNT************SDWWKGFLDAARNKVGAVLLVSMIERSTTLDLKSAEVLEFVKKDFDELSTTVKTEATNVVQQTTTVFRETLQLD************VSTFLDQVSTVLNPSPDDEDEEAVVIHGTDVVPLTRLQAQLYALSNEPDTYLKEIDSINYVDQKYPWALFPEDKKCSWGLFPEFTVWPLFLTKVPLFKAIRTDSIIYDNQKSPRAGSREMYGTPAIQGENLEKAQKEEAFLSTYSNFGHQEHFSGQQIFYSLQNFNICSVVFPPCHAAFGKKNRCTPFELSYEAWLELLEEQGNKQLSNEKLIKMLVNNPQLQDNFQNLVPNQDSRAQLGNNEIHTENGIAENVNYDSIYRTAGHSLEIMKS**********NKKVWKLYS
******VGQYSLLFSTFSRVPNPSFSLRFWDDKTIAVTVPSVKPLEKKKKIVPNPKPWFARIGLVLTLKYVEFFIHYHLLLSESYLTSDRIPNDYVFNDFAEDETRRHIKYALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQKATPDPTSEEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNIPKELNFLEEASNITKVTKMFAHFPWLKIPQIHPDLCTSRVLAMDFMEGGQINDVDYITENNINVYEVSDKLGKLYSEMIFNSGFVHSDPHPGNILVRRAQSSNSAELILLDHGLYASLTDDFRTEYAKLWLSILNKDKVAMKEHCTKLGVGDMYGLFACMVSGRSWDAIEAGIEKTKFTESEKEVFQRDVPNLIPEISDILTRVNRQVLLILKTNDLIRGIEHTLKTHARRVSLLVMSRCCIRSVYSEEYSHAHSHLKKCVLLISEKWQLFKLSMYYFYLGISRPMLEGFHFWIDNTSSKE******SSSDWWKGFLDAARNKVGAVLIDNTSSKENDATTPSSSDWWKGFLDAARNKVGAVLLVSMIERSTTLDLKSAEVLEFVKKDFDELSTTVKTEATNVVQQTTTVFRETLQLDK**************FLDQVSTVLNPSPDDEDEEAVVIHGTDVVPLTRLQAQLYALSNEPDTYLKEIDSINYVDQKYPWALFPEDKKCSWGLFPEFTVWPLFLTKVPLFKAIRTDSIIYDNQK*******EMYGTPAIQGENLEKAQKEEAFLSTYSNFGHQEHFSGQQIFYSLQNFNICSVVFPPCHAAFGKKNRCTPFELSYEAWLELLEEQGNKQLSNEKLIKMLVNNPQLQDNFQNLVPNQDSRAQLGNNEIHTENGIAENVNYDSIYRTAGHSLEIMKSTQKMEKSQTLNKKVWKLYS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNLSSVGQYSLLFSTFSRVPNPSFSLRFWDDKTIAVTVPSVKPLEKKKKIVPNPKPWFARIGLVLTLKYVEFFIHYHLLLSESYLTSDRIPNDYVFNDFAEDETRRHIKYALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQKATPDPTSEEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNIPKELNFLEEASNITKVTKMFAHFPWLKIPQIHPDLCTSRVLAMDFMEGGQINDVDYITENNINVYEVSDKLGKLYSEMIFNSGFVHSDPHPGNILVRRAQSSNSAELILLDHGLYASLTDDFRTEYAKLWLSILNKDKVAMKEHCTKLGVGDMYGLFACMVSGRSWDAIEAGIEKTKFTESEKEVFQRDVPNLIPEISDILTRVNRQVLLILKTNDLIRGIEHTLKTHARRVSLLVMSRCCIRSVYSEEYSHAHSHLKKCVLLISEKWQLFKLSMYYFYLGISRPMLEGFHFWIDNTSSKENDATTPSSSDWWKGFLDAARNKVGAVLIDNTSSKENDATTPSSSDWWKGFLDAARNKVGAVLLVSMIERSTTLDLKSAEVLEFVKKDFDELSTTVKTEATNVVQQTTTVFRETLQLDKPESTASSMKKSVSTFLDQVSTVLNPSPDDEDEEAVVIHGTDVVPLTRLQAQLYALSNEPDTYLKEIDSINYVDQKYPWALFPEDKKCSWGLFPEFTVWPLFLTKVPLFKAIRTDSIIYDNQKSPRAGSREMYGTPAIQGENLEKAQKEEAFLSTYSNFGHQEHFSGQQIFYSLQNFNICSVVFPPCHAAFGKKNRCTPFELSYEAWLELLEEQGNKQLSNEKLIKMLVNNPQLQDNFQNLVPNQDSRAQLGNNEIHTENGIAENVNYDSIYRTAGHSLEIMKSTQKMEKSQTLNKKVWKLYS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1046 2.2.26 [Sep-21-2011]
Q86TW2530 Uncharacterized aarF doma yes N/A 0.478 0.943 0.483 1e-138
Q9D0L4525 Uncharacterized aarF doma yes N/A 0.472 0.940 0.479 1e-137
Q5ZMT7519 Uncharacterized aarF doma yes N/A 0.458 0.924 0.485 1e-129
Q6INL7520 Uncharacterized aarF doma N/A N/A 0.455 0.915 0.458 1e-121
Q5M7P6523 Uncharacterized aarF doma yes N/A 0.459 0.919 0.444 1e-118
O04212538 Putative ABC1 protein At2 yes N/A 0.447 0.869 0.369 3e-82
O60111557 ABC1 family protein C15C4 yes N/A 0.414 0.779 0.341 5e-68
Q80V03582 Uncharacterized aarF doma no N/A 0.375 0.675 0.355 7e-68
Q06567569 ABC1 family protein YLR25 yes N/A 0.461 0.848 0.332 2e-65
Q3MIX3580 Uncharacterized aarF doma no N/A 0.365 0.658 0.355 3e-64
>sp|Q86TW2|ADCK1_HUMAN Uncharacterized aarF domain-containing protein kinase 1 OS=Homo sapiens GN=ADCK1 PE=2 SV=2 Back     alignment and function desciption
 Score =  493 bits (1270), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 247/511 (48%), Positives = 341/511 (66%), Gaps = 11/511 (2%)

Query: 105 TRRHIKYALGVGSVIGGTGILLHRNNY-DVNSLVAVRLVRAASCVFNIAYIYKKALYQKA 163
            R+ +K A      +  +GI  + N Y D N   AVR+ RA +    I+Y Y  +L  K+
Sbjct: 2   ARKALKLASWTSMALAASGIYFYSNKYLDPNDFGAVRVGRAVATTAVISYDYLTSL--KS 59

Query: 164 TPDPTSEEYSNLKSK-------VHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEY 216
            P   SEEY  L+SK       VH  +A +L ELC  N+G +IKVGQH+GAL+YLLP+EY
Sbjct: 60  VP-YGSEEYLQLRSKSWPVFLQVHLRSARRLCELCCANRGTFIKVGQHLGALDYLLPEEY 118

Query: 217 VETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGS 276
             T+KVLHS+AP S M++I  V++EDLGK+  ++F S +  P+G ASLAQVHKA LHDG 
Sbjct: 119 TSTLKVLHSQAPQSSMQEIRQVIREDLGKEIHDLFQSFDDTPLGTASLAQVHKAVLHDGR 178

Query: 277 TIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNIPKELNFLEEAS 336
           T+A+KVQH  VR  ++ DI  ME LV  V  +FPEF+F+WLVDE K+N+P EL+FL E  
Sbjct: 179 TVAVKVQHPKVRAQSSKDILLMEVLVLAVKQLFPEFEFMWLVDEAKKNLPLELDFLNEGR 238

Query: 337 NITKVTKMFAHFPWLKIPQIHPDLCTSRVLAMDFMEGGQINDVDYITENNINVYEVSDKL 396
           N  KV++M  HF +LK+P+IH DL T RVL M+F++GGQ+ND DY+  N I+V E+S  L
Sbjct: 239 NAEKVSQMLRHFDFLKVPRIHWDLSTERVLLMEFVDGGQVNDRDYMERNKIDVNEISRHL 298

Query: 397 GKLYSEMIFNSGFVHSDPHPGNILVRRAQSSNSAELILLDHGLYASLTDDFRTEYAKLWL 456
           GK+YSEMIF +GFVH DPHPGN+LVR+   +  AE++LLDHGLY  LT++FR  Y  LW 
Sbjct: 299 GKMYSEMIFVNGFVHCDPHPGNVLVRKHPGTGKAEIVLLDHGLYQMLTEEFRLNYCHLWQ 358

Query: 457 SILNKDKVAMKEHCTKLGVGDMYGLFACMVSGRSWDAIEAGIEKTKFTESEKEVFQRDVP 516
           S++  D   +KE+  +LG GD+Y LFACM++ RSWD++  GI +   T +E    + +  
Sbjct: 359 SLIWTDMKRVKEYSQRLGAGDLYPLFACMLTARSWDSVNRGISQAPVTATEDLEIRNNAA 418

Query: 517 NLIPEISDILTRVNRQVLLILKTNDLIRGIEHTLKTHARRVSLLVMSRCCIRSVYSEEYS 576
           N +P+IS +L  V RQ+LLILKTNDL+RGIE  L T A   S L MSRCCIR++   +  
Sbjct: 419 NYLPQISHLLNHVPRQMLLILKTNDLLRGIEAALGTRASASSFLNMSRCCIRALAEHKKK 478

Query: 577 HAHSHLKKCVLLISEKWQLFKLSMYYFYLGI 607
           +  S  ++  +  SE + L++++++   L +
Sbjct: 479 NTCSFFRRTQISFSEAFNLWQINLHELILRV 509




The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr).
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: -
>sp|Q9D0L4|ADCK1_MOUSE Uncharacterized aarF domain-containing protein kinase 1 OS=Mus musculus GN=Adck1 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZMT7|ADCK1_CHICK Uncharacterized aarF domain-containing protein kinase 1 OS=Gallus gallus GN=ADCK1 PE=2 SV=1 Back     alignment and function description
>sp|Q6INL7|ADCK1_XENLA Uncharacterized aarF domain-containing protein kinase 1 OS=Xenopus laevis GN=adck1 PE=2 SV=1 Back     alignment and function description
>sp|Q5M7P6|ADCK1_XENTR Uncharacterized aarF domain-containing protein kinase 1 OS=Xenopus tropicalis GN=adck1 PE=2 SV=1 Back     alignment and function description
>sp|O04212|Y2090_ARATH Putative ABC1 protein At2g40090 OS=Arabidopsis thaliana GN=At2g40090 PE=2 SV=2 Back     alignment and function description
>sp|O60111|YG62_SCHPO ABC1 family protein C15C4.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.02 PE=3 SV=2 Back     alignment and function description
>sp|Q80V03|ADCK5_MOUSE Uncharacterized aarF domain-containing protein kinase 5 OS=Mus musculus GN=Adck5 PE=2 SV=2 Back     alignment and function description
>sp|Q06567|YL253_YEAST ABC1 family protein YLR253W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR253W PE=1 SV=1 Back     alignment and function description
>sp|Q3MIX3|ADCK5_HUMAN Uncharacterized aarF domain-containing protein kinase 5 OS=Homo sapiens GN=ADCK5 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1046
189241943517 PREDICTED: similar to CG3608 CG3608-PA [ 0.478 0.967 0.595 1e-177
307192549522 Uncharacterized aarF domain-containing p 0.477 0.955 0.586 1e-175
322780432520 hypothetical protein SINV_09340 [Solenop 0.478 0.961 0.568 1e-172
340714268522 PREDICTED: uncharacterized aarF domain-c 0.476 0.954 0.581 1e-171
350417281522 PREDICTED: uncharacterized aarF domain-c 0.476 0.954 0.581 1e-170
307174003999 Uncharacterized aarF domain-containing p 0.478 0.500 0.565 1e-170
328791196522 PREDICTED: uncharacterized aarF domain-c 0.468 0.938 0.579 1e-169
383863997522 PREDICTED: uncharacterized aarF domain-c 0.467 0.936 0.588 1e-169
380025085522 PREDICTED: uncharacterized aarF domain-c 0.468 0.938 0.579 1e-169
170049278518 ABC1 family protein [Culex quinquefascia 0.478 0.967 0.561 1e-168
>gi|189241943|ref|XP_971607.2| PREDICTED: similar to CG3608 CG3608-PA [Tribolium castaneum] gi|270015338|gb|EFA11786.1| hypothetical protein TcasGA2_TC008565 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  630 bits (1626), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 300/504 (59%), Positives = 386/504 (76%), Gaps = 4/504 (0%)

Query: 107 RHIKYALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQKATPD 166
           R +KY+L +GS   GT + LH N Y +NS+  VRL RAA  VF I  IYKK LY K   D
Sbjct: 8   RLLKYSL-IGSAAIGTAVSLHGNQYQLNSIGIVRLSRAAVTVFQIGVIYKKDLYGKGL-D 65

Query: 167 PTSEEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSK 226
             S+EY  LKS  HK +AE+LLELC  NKG YIKVGQH+ AL+YLLP EYV+TMKVLHS 
Sbjct: 66  KNSQEYKELKSICHKRSAEKLLELCCTNKGTYIKVGQHLAALDYLLPSEYVQTMKVLHSH 125

Query: 227 APMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRN 286
           AP +P++D+  V++EDL KDP EIF +IEP P+G ASLAQVHKATL DG+ +A+KVQH  
Sbjct: 126 APTNPIEDVYKVIREDLKKDPFEIFQTIEPEPLGTASLAQVHKATLTDGTVVAVKVQHPY 185

Query: 287 VRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNIPKELNFLEEASNITKVTKMFA 346
           ++ NA +D+K ME LV +++WVFPEFKF WLVDETK+NIP+ELNF +E  N  KV KMF 
Sbjct: 186 IQGNARVDLKTMEYLVKIMSWVFPEFKFQWLVDETKKNIPQELNFEQEGHNAEKVAKMFE 245

Query: 347 HFPWLKIPQIHPDLCTSRVLAMDFMEGGQINDVDYITENNINVYEVSDKLGKLYSEMIFN 406
           H  WLKIP++  DL TSRVL M+F+EGGQ+ND+ YI E+ I+ +EVSDKLGKLYS+MIF 
Sbjct: 246 HVEWLKIPKVIWDLTTSRVLTMEFVEGGQVNDLKYINEHGIDPFEVSDKLGKLYSQMIFI 305

Query: 407 SGFVHSDPHPGNILVRRAQSSNSAELILLDHGLYASLTDDFRTEYAKLWLSILNKDKVAM 466
           +GFVHSDPHPGNI V+R++  +  ++ILLDHGLYA+L+D+FR EYA  WLSILN+D+ AM
Sbjct: 306 NGFVHSDPHPGNIFVKRSERGD-CDIILLDHGLYANLSDEFRVEYANFWLSILNRDRKAM 364

Query: 467 KEHCTKLGV-GDMYGLFACMVSGRSWDAIEAGIEKTKFTESEKEVFQRDVPNLIPEISDI 525
           + H   LG+ GD+YGLFACMV+GR+WD I  GI++ K ++SEKE+FQR+ PN++P+IS +
Sbjct: 365 RLHSANLGIKGDLYGLFACMVTGRTWDTILKGIDQQKQSKSEKELFQREFPNVLPQISGV 424

Query: 526 LTRVNRQVLLILKTNDLIRGIEHTLKTHARRVSLLVMSRCCIRSVYSEEYSHAHSHLKKC 585
           L +VNRQ+LLI KTNDL+RGIEHTLKT AR  +  VMS+CC++SVYSE     +S + K 
Sbjct: 425 LDKVNRQMLLIFKTNDLMRGIEHTLKTSARMGAFCVMSQCCVKSVYSERLCKENSKIGKF 484

Query: 586 VLLISEKWQLFKLSMYYFYLGISR 609
            +  ++ W LFK+ +YY  L + +
Sbjct: 485 KIAFAQFWALFKIKLYYSMLSLRQ 508




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307192549|gb|EFN75737.1| Uncharacterized aarF domain-containing protein kinase 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322780432|gb|EFZ09920.1| hypothetical protein SINV_09340 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|340714268|ref|XP_003395652.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350417281|ref|XP_003491345.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307174003|gb|EFN64713.1| Uncharacterized aarF domain-containing protein kinase 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328791196|ref|XP_392396.3| PREDICTED: uncharacterized aarF domain-containing protein kinase 1-like isoform 2 [Apis mellifera] gi|328791198|ref|XP_003251529.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 1-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|383863997|ref|XP_003707466.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380025085|ref|XP_003696310.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 1-like isoform 1 [Apis florea] gi|380025087|ref|XP_003696311.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 1-like isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|170049278|ref|XP_001855172.1| ABC1 family protein [Culex quinquefasciatus] gi|167871114|gb|EDS34497.1| ABC1 family protein [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1046
FB|FBgn0035039518 CG3608 [Drosophila melanogaste 0.477 0.963 0.532 1.2e-143
ZFIN|ZDB-GENE-080401-5521 adck1 "aarF domain containing 0.474 0.952 0.486 2.2e-128
UNIPROTKB|E2RSN4513 ADCK1 "Uncharacterized protein 0.477 0.972 0.483 7.6e-128
UNIPROTKB|Q86TW2530 ADCK1 "Uncharacterized aarF do 0.477 0.941 0.484 1.8e-126
UNIPROTKB|F1MYG8523 ADCK1 "Uncharacterized protein 0.486 0.973 0.470 3.7e-126
MGI|MGI:1919363525 Adck1 "aarF domain containing 0.477 0.950 0.477 2.1e-125
UNIPROTKB|Q5ZMT7519 ADCK1 "Uncharacterized aarF do 0.469 0.946 0.479 2.7e-123
UNIPROTKB|F1NNJ1519 ADCK1 "Uncharacterized aarF do 0.469 0.946 0.477 1.2e-122
UNIPROTKB|F1SE04455 ADCK1 "Uncharacterized protein 0.411 0.945 0.506 8.5e-120
UNIPROTKB|Q9UIE6455 ADCK1 "Uncharacterized aarF do 0.343 0.789 0.498 4e-104
FB|FBgn0035039 CG3608 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1404 (499.3 bits), Expect = 1.2e-143, P = 1.2e-143
 Identities = 269/505 (53%), Positives = 370/505 (73%)

Query:   106 RRHIKYALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQKATP 165
             RR + Y + VG+ +   G  LH N+YD NSL  VRL R+A+ V ++A  YK+ LY K   
Sbjct:     4 RRVLGYGV-VGAGLASAGWSLHTNDYDPNSLGIVRLSRSAAAVVDVALTYKRELYYKEW- 61

Query:   166 DPTSEEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHS 225
             D  + EY   KS+VHK AAE+LL+L  +NKGVYIKVGQHIGALEYLLPKE+V+TMKVLHS
Sbjct:    62 DKETPEYKAEKSRVHKIAAEKLLQLICINKGVYIKVGQHIGALEYLLPKEFVQTMKVLHS 121

Query:   226 KAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHR 285
              AP +P++D+  V+++DL  +P EIF S E  P+G ASLAQVHKA L  G  +A+KVQH 
Sbjct:   122 DAPQNPIEDLYKVIRQDLHCNPEEIFDSFEREPLGTASLAQVHKARLKTGELVAVKVQHP 181

Query:   286 NVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNIPKELNFLEEASNITKVTKMF 345
              V+ N+ +D+K ME  V+V+A +FP+FK  WLV+E+K+N+P EL+FL E  N  KV K F
Sbjct:   182 YVKGNSRVDMKTMELAVNVLARIFPDFKIHWLVEESKKNLPIELDFLNEGRNAEKVAKQF 241

Query:   346 AHFPWLKIPQIHPDLCTSRVLAMDFMEGGQINDVDYITENNINVYEVSDKLGKLYSEMIF 405
               + WL++P+I+    +SRVL M+++EGG + D+DYI  N I+ + V++++G+LYSEMIF
Sbjct:   242 KKYSWLRVPKIYWKYSSSRVLVMEYLEGGHVTDLDYIRRNKIDSFAVANRIGQLYSEMIF 301

Query:   406 NSGFVHSDPHPGNILVRRAQSSNSAELILLDHGLYASLTDDFRTEYAKLWLSILNKDKVA 465
              +GFVHSDPHPGNILVRR    NS E++LLDHGLYA+LTD FR +Y+ LWLSIL  D+ A
Sbjct:   302 RTGFVHSDPHPGNILVRRTPE-NSLEIVLLDHGLYANLTDKFRYDYSNLWLSILKVDRKA 360

Query:   466 MKEHCTKLGV-GDMYGLFACMVSGRSWDAIEAGIEKTKFTESEKEVFQRDVPNLIPEISD 524
             M++H  +LG+ GD+YGLFACMV+GR W+ +  G+ K K+++ EK   Q +   ++P ISD
Sbjct:   361 MRQHSEQLGIKGDLYGLFACMVTGRPWETVMQGLTKVKYSKEEKNTLQNNTSLVLPHISD 420

Query:   525 ILTRVNRQVLLILKTNDLIRGIEHTLKTHARRVSLLVMSRCCIRSVYSEEYS-HAHSHLK 583
             +L +V+RQ+LLILKTNDLIRGIE TL+T  R  +  VMS+CC++S Y+E+ +  + S   
Sbjct:   421 VLEQVDRQMLLILKTNDLIRGIESTLRTQNRMTAFWVMSKCCVQSSYAEQRAKQSDSGSS 480

Query:   584 KCVLL-ISEKWQLFKLSMYYFYLGI 607
             + + L + E+W+LFKL+ YY YLG+
Sbjct:   481 RILWLRVRERWELFKLNCYYLYLGL 505




GO:0004672 "protein kinase activity" evidence=IEA;NAS
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
ZFIN|ZDB-GENE-080401-5 adck1 "aarF domain containing kinase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSN4 ADCK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q86TW2 ADCK1 "Uncharacterized aarF domain-containing protein kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MYG8 ADCK1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1919363 Adck1 "aarF domain containing kinase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMT7 ADCK1 "Uncharacterized aarF domain-containing protein kinase 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNJ1 ADCK1 "Uncharacterized aarF domain-containing protein kinase 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SE04 ADCK1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UIE6 ADCK1 "Uncharacterized aarF domain-containing protein kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1046
COG0661517 COG0661, AarF, Predicted unusual protein kinase [G 1e-82
TIGR01982437 TIGR01982, UbiB, 2-polyprenylphenol 6-hydroxylase 7e-51
pfam03109117 pfam03109, ABC1, ABC1 family 6e-41
PRK04750537 PRK04750, ubiB, putative ubiquinone biosynthesis p 8e-33
>gnl|CDD|223733 COG0661, AarF, Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
 Score =  277 bits (711), Expect = 1e-82
 Identities = 110/422 (26%), Positives = 202/422 (47%), Gaps = 20/422 (4%)

Query: 128 RNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQKATPDPTSEEYSNLKSKVHKEAAEQL 187
           R    +   +   L R       +A + +   +   +   +SEE   L+ K  +     L
Sbjct: 9   RLPRIIRVRLRYLLGRLLRLTGRLALLLRLLSWLGKSKLASSEE---LREKRAERLRLAL 65

Query: 188 LELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDP 247
            EL       +IK+GQ +     L+P EY E +  L  + P  P ++   +++E+LG+  
Sbjct: 66  EEL----GPTFIKLGQILSTRPDLVPPEYAEELAKLQDRVPPFPFEEAERIIEEELGRPI 121

Query: 248 SEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAW 307
            E+F+  EP P+ +AS+AQVH+A L  G  +A+KVQ   +R+    D+K +  L  ++  
Sbjct: 122 EELFSEFEPEPIASASIAQVHRAVLKSGEEVAVKVQRPGIRERIEADLKLLRRLARLIKR 181

Query: 308 VFPEFKFL---WLVDETKRNIPKELNFLEEASNITKVTKMFAHFPWLKIPQIHPDLCTSR 364
           + P  + L    +VDE ++ + +EL++  EA+N  +  + F   P + +P+++ +  T R
Sbjct: 182 LPPGGRRLDLVEVVDEFEKRLREELDYRREAANAERFRENFKDDPDVYVPKVYWEYTTRR 241

Query: 365 VLAMDFMEGGQINDVDYITENNINVYEVSDKLGKLYSEMIFNSGFVHSDPHPGNILVRRA 424
           VL M++++G +I+D+  +    I+  E+++ L + +   +   GF H+DPHPGNILVR  
Sbjct: 242 VLTMEWIDGIKISDIAALKSAGIDRKELAELLVRAFLRQLLRDGFFHADPHPGNILVRSD 301

Query: 425 QSSNSAELILLDHGLYASLTDDFRTEYAKLWLSILNKDKVAMKEHCTKLGVGDMYGLFAC 484
                  ++LLD G+   L   FR   A+L L+ LN+D   + E   +LG          
Sbjct: 302 -----GRIVLLDFGIVGRLDPKFRRYLAELLLAFLNRDYDRVAELHVELGYVPPDTDRD- 355

Query: 485 MVSGRSWDAIEAGIEKTKFTESEKEVFQRDVPNLIPEISDILTRVNRQVLLILKTNDLIR 544
                +  A+   I      E         +  +      +  R+  +++L+ +T  L+ 
Sbjct: 356 -PLAAAIRAVLEPIYGKPLEEISFGEILDKLFEVA-RRFPM--RLPPELVLLQRTLLLVE 411

Query: 545 GI 546
           G+
Sbjct: 412 GV 413


Length = 517

>gnl|CDD|233667 TIGR01982, UbiB, 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>gnl|CDD|111949 pfam03109, ABC1, ABC1 family Back     alignment and domain information
>gnl|CDD|235310 PRK04750, ubiB, putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1046
KOG1235|consensus538 100.0
COG0661517 AarF Predicted unusual protein kinase [General fun 100.0
PRK04750537 ubiB putative ubiquinone biosynthesis protein UbiB 100.0
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 100.0
KOG1236|consensus565 100.0
KOG1234|consensus363 100.0
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 99.93
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.8
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.8
KOG0595|consensus429 99.75
smart00090237 RIO RIO-like kinase. 99.73
KOG0593|consensus396 99.72
KOG0605|consensus550 99.66
KOG0581|consensus364 99.66
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.65
KOG0600|consensus560 99.64
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.63
KOG0659|consensus318 99.62
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.61
KOG0661|consensus538 99.6
KOG0575|consensus592 99.58
KOG0660|consensus359 99.57
KOG0667|consensus586 99.56
KOG0594|consensus323 99.55
KOG0663|consensus419 99.55
PRK14879211 serine/threonine protein kinase; Provisional 99.53
KOG0615|consensus475 99.53
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 99.52
KOG0598|consensus357 99.52
KOG0574|consensus502 99.52
KOG0578|consensus550 99.51
KOG0583|consensus370 99.51
KOG0616|consensus355 99.49
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.48
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.48
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.47
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.46
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.46
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.46
KOG0592|consensus604 99.46
KOG4236|consensus888 99.46
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.46
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.45
KOG0192|consensus362 99.45
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.45
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.45
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.45
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.45
KOG4250|consensus732 99.44
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.44
PRK09188365 serine/threonine protein kinase; Provisional 99.44
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.44
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.44
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.44
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.44
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.44
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.44
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.44
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.43
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.43
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.43
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.43
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.43
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.43
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.43
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.43
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.43
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.43
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.42
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.42
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.42
KOG0597|consensus808 99.42
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.42
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.42
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.42
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.42
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.42
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.42
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.42
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.42
KOG0608|consensus1034 99.42
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.42
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.42
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.42
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.41
KOG0658|consensus364 99.41
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.41
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.41
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.41
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.41
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.41
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.4
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.4
KOG1163|consensus341 99.4
PTZ00284467 protein kinase; Provisional 99.4
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.39
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 99.39
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.38
KOG0577|consensus 948 99.38
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.38
KOG0694|consensus694 99.37
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.37
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.37
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.37
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.36
KOG0591|consensus375 99.36
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.36
KOG1187|consensus361 99.36
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.36
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.36
KOG0032|consensus382 99.36
KOG0580|consensus281 99.35
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.35
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.34
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.34
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.34
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.34
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.33
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.33
KOG0610|consensus459 99.33
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.33
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.33
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.33
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.33
KOG0588|consensus786 99.33
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.33
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.33
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.33
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.33
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.33
PHA03212391 serine/threonine kinase US3; Provisional 99.33
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.33
KOG0198|consensus313 99.32
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.32
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.32
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.32
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.32
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.32
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.32
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.32
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.32
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.32
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.32
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.31
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.31
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.31
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.31
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.31
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.3
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.3
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.3
KOG0201|consensus467 99.3
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.29
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.29
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.29
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.29
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.29
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.29
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.29
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.29
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.29
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.29
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.29
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.29
KOG0196|consensus996 99.29
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.28
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.28
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.28
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.28
PTZ00036440 glycogen synthase kinase; Provisional 99.28
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.28
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.28
KOG0611|consensus668 99.28
KOG1989|consensus738 99.28
PTZ00267478 NIMA-related protein kinase; Provisional 99.28
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.28
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.28
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.27
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.27
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.27
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.27
PRK12274218 serine/threonine protein kinase; Provisional 99.27
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.27
PTZ00283496 serine/threonine protein kinase; Provisional 99.27
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.27
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.27
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.27
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.27
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.26
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.26
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.26
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.26
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.26
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.26
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.26
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.26
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.26
COG1718268 RIO1 Serine/threonine protein kinase involved in c 99.25
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.25
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.25
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.25
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.25
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.25
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.25
KOG0585|consensus576 99.25
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.25
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.25
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.25
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.24
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.24
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.24
KOG0612|consensus 1317 99.24
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.24
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.24
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.24
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.24
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.24
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.24
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.24
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.24
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.24
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.23
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.23
KOG2690|consensus331 99.23
KOG0664|consensus449 99.23
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.23
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.23
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.23
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.23
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.23
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.23
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.23
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.23
KOG0197|consensus468 99.23
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.23
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.23
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.23
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.23
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.22
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.22
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.22
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.22
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.22
KOG0582|consensus516 99.22
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.22
PHA03209357 serine/threonine kinase US3; Provisional 99.22
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.22
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.22
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.22
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.22
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.22
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.22
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.21
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.21
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.21
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.21
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.21
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.21
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.21
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.21
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.21
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.21
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.21
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.21
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.21
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.21
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.21
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.2
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.2
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.2
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.2
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.2
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.2
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.2
KOG0193|consensus678 99.2
PRK10345210 hypothetical protein; Provisional 99.2
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.19
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.19
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.19
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.19
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.19
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.19
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.19
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.18
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.18
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.18
PHA03211461 serine/threonine kinase US3; Provisional 99.18
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.18
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.18
PHA02988283 hypothetical protein; Provisional 99.18
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.18
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.18
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.18
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.18
COG0478304 RIO-like serine/threonine protein kinase fused to 99.18
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.17
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.17
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.17
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.17
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.17
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.17
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.17
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.17
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.17
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.17
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.17
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.17
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.17
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.17
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.16
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.16
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.16
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.16
KOG1095|consensus1025 99.16
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.16
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.16
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.16
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.16
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.15
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.15
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.15
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.15
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.15
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.15
KOG0194|consensus474 99.15
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.15
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.15
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.15
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.14
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.14
KOG0587|consensus 953 99.14
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.14
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.14
KOG4721|consensus904 99.13
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.13
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.13
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.13
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.12
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.12
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.12
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.12
KOG1164|consensus322 99.12
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.12
PHA03207392 serine/threonine kinase US3; Provisional 99.12
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.12
KOG0589|consensus426 99.12
KOG0662|consensus292 99.11
KOG1166|consensus974 99.11
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 99.11
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.11
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.11
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.1
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.1
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.1
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.1
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.1
KOG0603|consensus612 99.1
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.1
PLN00009294 cyclin-dependent kinase A; Provisional 99.09
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.09
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 99.09
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.09
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.09
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.09
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.08
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.08
KOG4717|consensus864 99.08
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.08
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.08
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.08
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.07
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.07
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.07
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.06
PHA02882294 putative serine/threonine kinase; Provisional 99.06
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.06
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.05
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.05
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.05
KOG0668|consensus338 99.04
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.04
PLN03224507 probable serine/threonine protein kinase; Provisio 99.03
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.03
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.03
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.03
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.03
KOG0579|consensus 1187 99.03
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.02
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.01
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.0
KOG1167|consensus418 99.0
KOG1165|consensus449 98.99
KOG0199|consensus 1039 98.98
KOG1094|consensus807 98.97
KOG0604|consensus400 98.95
PHA03210501 serine/threonine kinase US3; Provisional 98.95
KOG0670|consensus752 98.94
KOG0586|consensus596 98.93
KOG1035|consensus1351 98.92
KOG1006|consensus361 98.92
KOG1151|consensus775 98.91
KOG0599|consensus411 98.9
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 98.9
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 98.89
KOG0695|consensus593 98.89
KOG0696|consensus683 98.88
KOG3653|consensus534 98.87
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 98.86
KOG4645|consensus1509 98.85
KOG1152|consensus772 98.85
KOG0607|consensus463 98.83
KOG0576|consensus829 98.83
KOG3087|consensus229 98.83
KOG4279|consensus1226 98.82
KOG0666|consensus438 98.82
KOG0033|consensus355 98.82
KOG0983|consensus391 98.82
KOG0984|consensus282 98.8
KOG1027|consensus903 98.79
KOG1026|consensus774 98.77
KOG0669|consensus376 98.76
PLN00113968 leucine-rich repeat receptor-like protein kinase; 98.74
KOG0596|consensus677 98.73
KOG0690|consensus516 98.67
KOG2270|consensus520 98.67
KOG0614|consensus732 98.67
KOG2052|consensus513 98.65
KOG4257|consensus974 98.65
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 98.6
KOG0665|consensus369 98.57
KOG1025|consensus1177 98.56
KOG0986|consensus591 98.55
COG0515384 SPS1 Serine/threonine protein kinase [General func 98.52
KOG1345|consensus378 98.51
PRK10593297 hypothetical protein; Provisional 98.5
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 98.5
KOG0200|consensus609 98.36
KOG2345|consensus302 98.3
KOG4278|consensus 1157 98.28
PRK09550401 mtnK methylthioribose kinase; Reviewed 98.25
cd05150244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 98.24
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 98.21
KOG0584|consensus632 98.18
KOG0671|consensus415 98.16
PF01636239 APH: Phosphotransferase enzyme family This family 98.16
PRK05231319 homoserine kinase; Provisional 98.12
cd05155235 APH_ChoK_like_1 Uncharacterized bacterial proteins 98.03
KOG2268|consensus465 97.96
PRK12396409 5-methylribose kinase; Reviewed 97.92
PLN02756418 S-methyl-5-thioribose kinase 97.85
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 97.84
cd05153296 HomoserineK_II Homoserine Kinase, type II. Homoser 97.79
TIGR02721256 ycfN_thiK thiamine kinase. Members of this family 97.77
PF03881288 Fructosamin_kin: Fructosamine kinase; InterPro: IP 97.74
PLN00181793 protein SPA1-RELATED; Provisional 97.74
KOG1290|consensus590 97.66
cd05157235 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. 97.61
TIGR00938307 thrB_alt homoserine kinase, Neisseria type. Homose 97.5
PRK09902216 hypothetical protein; Provisional 97.48
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 97.48
TIGR01767370 MTRK 5-methylthioribose kinase. This enzyme is inv 97.44
PLN02876822 acyl-CoA dehydrogenase 97.4
PRK06148 1013 hypothetical protein; Provisional 97.36
cd05156302 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The 97.11
KOG2269|consensus531 97.1
PRK11768325 serine/threonine protein kinase; Provisional 97.06
PRK06149 972 hypothetical protein; Provisional 97.03
COG2334331 Putative homoserine kinase type II (protein kinase 97.0
PF10707199 YrbL-PhoP_reg: PhoP regulatory network protein Yrb 96.95
cd05152276 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH 96.91
KOG4158|consensus598 96.72
PLN02236344 choline kinase 96.71
COG3001286 Uncharacterized protein conserved in bacteria [Fun 96.43
COG3173321 Predicted aminoglycoside phosphotransferase [Gener 96.34
KOG1240|consensus 1431 96.31
KOG0590|consensus601 96.17
KOG0606|consensus 1205 96.13
PLN02421330 phosphotransferase, alcohol group as acceptor/kina 95.96
KOG0603|consensus612 95.93
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 95.8
PF04655253 APH_6_hur: Aminoglycoside/hydroxyurea antibiotic r 95.51
COG4857408 Predicted kinase [General function prediction only 94.91
PRK10271188 thiK thiamine kinase; Provisional 93.43
PTZ00384383 choline kinase; Provisional 93.33
KOG1024|consensus563 93.33
KOG2690|consensus331 92.19
PTZ00296442 choline kinase; Provisional 91.01
KOG1033|consensus516 90.67
KOG0590|consensus601 90.36
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 90.3
TIGR02906313 spore_CotS spore coat protein, CotS family. Member 90.01
KOG0601|consensus524 89.48
smart00587196 CHK ZnF_C4 abd HLH domain containing kinases domai 88.71
PF12260188 PIP49_C: Protein-kinase domain of FAM69; InterPro: 88.37
COG5072488 ALK1 Serine/threonine kinase of the haspin family 88.3
PF02958294 EcKinase: Ecdysteroid kinase; InterPro: IPR004119 84.31
PF01633211 Choline_kinase: Choline/ethanolamine kinase; Inter 83.67
PF07914414 DUF1679: Protein of unknown function (DUF1679); In 82.1
KOG0601|consensus524 81.63
COG0510269 ycfN Thiamine kinase and related kinases [Coenzyme 81.14
>KOG1235|consensus Back     alignment and domain information
Probab=100.00  E-value=2.6e-85  Score=761.20  Aligned_cols=458  Identities=39%  Similarity=0.657  Sum_probs=409.0

Q ss_pred             HHHHHHHHHHhccCCCCCCCcHHHHHhHHHHHHHHHHHHHHHHHhcCCcEeehhhhhhcCCCCCcHHHHHHHHHhhcCCC
Q psy14256        149 FNIAYIYKKALYQKATPDPTSEEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAP  228 (1046)
Q Consensus       149 ~~I~~dYk~~l~~~~~~~~~~ee~~~~~~~~H~r~A~rL~~lle~lGG~yIKLGQ~LStr~dLLP~ey~~~L~~LqD~vP  228 (1046)
                      ..+.++|+..+.........++........+|.++|++|+++|+.|||+|||+||+||+++|++|+||+++|+.|||+||
T Consensus        59 ~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~a~~L~e~~~~nGg~yIKlGQ~lst~~dllP~Eyv~~L~~LqD~~P  138 (538)
T KOG1235|consen   59 VPGVLDYKHSLSALAVSLASSESRLSKLSKVLLSAAERLLELFLRNGGTYIKLGQHLSTRPDLLPKEYVKTLSELQDQAP  138 (538)
T ss_pred             cceEEehhhhcchhhccccchhhhHHHHHHHHHHHHHHHHHHHHHcCCeEEEechhhccccccCcHHHHHHHHHHhccCC
Confidence            34445555554222222235566667778899999999999999999999999999999999999999999999999999


Q ss_pred             CCCHHHHHHHHHHHhCCChhhhhcccCCcccccccceEEEEEEccCCCEEEEEEeecccchhhhHHHHHHHHHHHHHHHh
Q psy14256        229 MSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWV  308 (1046)
Q Consensus       229 p~p~eeV~~vieeeLG~~~eeIFs~FD~ePIGSASiGQVHrA~LkdGe~VAVKVQrP~I~~~i~~DL~iLr~La~ll~~l  308 (1046)
                      |+|++++.++|++|+|.+++++|++||++|||+||+||||+|++++|+.||||||||++++.+..|+.+++.++.+++++
T Consensus       139 p~~~ee~~~i~e~ElG~~ie~if~~f~~~piaaASlaQVhrA~L~~G~~VaVKVQ~P~l~~~~~~Dl~~~~~~~~~l~k~  218 (538)
T KOG1235|consen  139 PFPWEEAFKIFEEELGAPIEDIFSEFDEEPIAAASLAQVHRARLKNGEDVAVKVQHPGLEKLIMLDLRNLRLLAKVLQKF  218 (538)
T ss_pred             CCCHHHHHHHHHHHhCCCHHHHHHhcCcchhhhcchhheEEEEecCCCEEEEEecCcChHHHHHHHHHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCcchhhhHHHHHHhhHHHhhHHHHHHHHHHHHHHhcCCC---CeecceeecCCCCceEEEEEecCCcCcCchhhHHhc
Q psy14256        309 FPEFKFLWLVDETKRNIPKELNFLEEASNITKVTKMFAHFP---WLKIPQIHPDLCTSRVLAMDFMEGGQINDVDYITEN  385 (1046)
Q Consensus       309 fp~~~l~~LvdE~~~sL~~ELDFl~EA~N~erf~~~f~~~~---~V~VPkVy~elStkrVLVMEyIeG~sL~Dl~~L~~~  385 (1046)
                      +|++++.|+++|+++++.+|+||.+||+|+++++++|++.+   .|+||+|||++|++||||||||+|++++|++++++.
T Consensus       219 ~p~~~~~~lvdE~~~~L~~ELDF~~EA~Nae~~~~~f~~~~~~~~V~VP~Vy~~~st~RVLtME~~~G~~i~Dl~~i~~~  298 (538)
T KOG1235|consen  219 FPDFDLVWLVDEIAKSLPQELDFTKEAKNAERFRENFKDFSLLTYVLVPKVYWDLSTKRVLTMEYVDGIKINDLDAIDKR  298 (538)
T ss_pred             CcCCchhhHHHHHHhhhHhhcchHHHHHhHHHHHHHHHhcccccceeCCeehhhcCcceEEEEEecCCccCCCHHHHHHc
Confidence            99999999999999999999999999999999999999998   789999999999999999999999999999999999


Q ss_pred             CCCHHHHHHHHHHHHHHHHHhcCCcccCCCCCCeEeeccCCCCccEEEEEecccccccCHHHHHHHHHHHHHHHhcCHHH
Q psy14256        386 NINVYEVSDKLGKLYSEMIFNSGFVHSDPHPGNILVRRAQSSNSAELILLDHGLYASLTDDFRTEYAKLWLSILNKDKVA  465 (1046)
Q Consensus       386 gid~~eIa~~L~q~fl~qIf~~GfVHrDPHPGNILV~~~~~~Gk~qIvLLDFGLar~Ls~~~R~~y~~L~~All~~D~~~  465 (1046)
                      |+++.+++..+.++|++|||.+||||||||||||+|+++++ ++.+++|+|||+++.+++..|..||++|.+++..|...
T Consensus       299 gi~~~~i~~~l~~~~~~qIf~~GffHaDPHPGNilv~~~~~-~~~~ivllDhGl~~~is~~~r~~~~~~~~a~~~~d~~~  377 (538)
T KOG1235|consen  299 GISPHDILNKLVEAYLEQIFKTGFFHADPHPGNILVRPNPE-GDEEIVLLDHGLYAVISHKTRKDYAELWLALVFEDEKA  377 (538)
T ss_pred             CCCHHHHHHHHHHHHHHHHHhcCCccCCCCCCcEEEecCCC-CCccEEEEcccccccccHHHHHHHHHHHHHHhcccHHH
Confidence            99999999999999999999999999999999999997542 24599999999999999999999999999999999999


Q ss_pred             HHHHHHHcCCC--chhhhHHHHhcCCchhHHhh-hhcc-ccCChhHHHHHhhhhhchHHHHHHHHhhcChHHHHHHHHHH
Q psy14256        466 MKEHCTKLGVG--DMYGLFACMVSGRSWDAIEA-GIEK-TKFTESEKEVFQRDVPNLIPEISDILTRVNRQVLLILKTND  541 (1046)
Q Consensus       466 i~~~~~~lGi~--d~~~lfA~mltgRp~e~v~~-~i~~-~~~s~~e~~~i~~~~~~lL~~I~~ll~rlPrellLllKt~~  541 (1046)
                      |.+++.++|++  +.+++|++++++|+|++... ++.. .....++...++......++.+++.+.++|+.+++++|+++
T Consensus       378 ~~~~~~~~g~~~d~~~~~fa~~l~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~~p~~i~li~k~~~  457 (538)
T KOG1235|consen  378 MQALAEQLGLGLDDLYPLFATALTGRPWDSVIGAGITKYLKGLEEDADENQKIASAKFPGISQLLRRMPREILLILKTND  457 (538)
T ss_pred             HHHHHHHhccccchhhhhhHHHHhCCchhhccccchhhhhhhhhhhhhhHHHHHHHHhhHHHHHHHhchHhhhhhcccHH
Confidence            99999999996  89999999999999987655 4443 34455666677778888999999999999999999999999


Q ss_pred             HHHHHHHhhCCCc-chhhHHHHHHHHHHHHHHHhhccccc-hh-hHHHhHHHHHH-HHHHHHHHHHHHhc
Q psy14256        542 LIRGIEHTLKTHA-RRVSLLVMSRCCIRSVYSEEYSHAHS-HL-KKCVLLISEKW-QLFKLSMYYFYLGI  607 (1046)
Q Consensus       542 llrGI~~~L~~~~-~~~~fl~mar~~~~~l~~~~~~~~~s-~~-~~~~~~l~~~~-~~~~l~~~~~~L~~  607 (1046)
                      ++||+...++.+. ..+.|++|+|+|++..+.+......+ .. .+.+..+...+ ..++++.|++++++
T Consensus       458 l~r~~~~~l~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~  527 (538)
T KOG1235|consen  458 LLRGLSSNLGIPSSLERSFLEMARLCLRLSLALLATGRYSRLLSWRIKVFFESFFALLNRLNSYYLILRF  527 (538)
T ss_pred             HHHhHHHHhccccccchHHHHHHHHHHHHHHhccccchhhhcccchhhhhHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999984 45689999999999665543322222 11 23455566677 58899999999998



>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG1236|consensus Back     alignment and domain information
>KOG1234|consensus Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>KOG1163|consensus Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG2690|consensus Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>KOG1164|consensus Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>KOG1166|consensus Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>KOG0668|consensus Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG1167|consensus Back     alignment and domain information
>KOG1165|consensus Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0670|consensus Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>KOG1152|consensus Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>KOG3087|consensus Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>KOG0984|consensus Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>KOG2270|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>KOG0665|consensus Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1345|consensus Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG0200|consensus Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>PRK09550 mtnK methylthioribose kinase; Reviewed Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>PRK05231 homoserine kinase; Provisional Back     alignment and domain information
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members Back     alignment and domain information
>KOG2268|consensus Back     alignment and domain information
>PRK12396 5-methylribose kinase; Reviewed Back     alignment and domain information
>PLN02756 S-methyl-5-thioribose kinase Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>cd05153 HomoserineK_II Homoserine Kinase, type II Back     alignment and domain information
>TIGR02721 ycfN_thiK thiamine kinase Back     alignment and domain information
>PF03881 Fructosamin_kin: Fructosamine kinase; InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein [] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1290|consensus Back     alignment and domain information
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes Back     alignment and domain information
>TIGR00938 thrB_alt homoserine kinase, Neisseria type Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01767 MTRK 5-methylthioribose kinase Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes Back     alignment and domain information
>KOG2269|consensus Back     alignment and domain information
>PRK11768 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only] Back     alignment and domain information
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP Back     alignment and domain information
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2') Back     alignment and domain information
>KOG4158|consensus Back     alignment and domain information
>PLN02236 choline kinase Back     alignment and domain information
>COG3001 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only] Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>PLN02421 phosphotransferase, alcohol group as acceptor/kinase Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>PF04655 APH_6_hur: Aminoglycoside/hydroxyurea antibiotic resistance kinase; InterPro: IPR006748 The aminoglycosides are a large group of biologically active bacterial secondary metabolites, best known for their antibiotic properties [] Back     alignment and domain information
>COG4857 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK10271 thiK thiamine kinase; Provisional Back     alignment and domain information
>PTZ00384 choline kinase; Provisional Back     alignment and domain information
>KOG1024|consensus Back     alignment and domain information
>KOG2690|consensus Back     alignment and domain information
>PTZ00296 choline kinase; Provisional Back     alignment and domain information
>KOG1033|consensus Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>TIGR02906 spore_CotS spore coat protein, CotS family Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>smart00587 CHK ZnF_C4 abd HLH domain containing kinases domain Back     alignment and domain information
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) Back     alignment and domain information
>COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning] Back     alignment and domain information
>PF02958 EcKinase: Ecdysteroid kinase; InterPro: IPR004119 This family includes proteins of unknown function Back     alignment and domain information
>PF01633 Choline_kinase: Choline/ethanolamine kinase; InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2 Back     alignment and domain information
>PF07914 DUF1679: Protein of unknown function (DUF1679); InterPro: IPR012877 This region is found in a number of Caenorhabditis elegans and Caenorhabditis briggsae proteins, in one case (Q19034 from SWISSPROT) as a repeat Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>COG0510 ycfN Thiamine kinase and related kinases [Coenzyme transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1046
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 9e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 77.6 bits (190), Expect = 2e-14
 Identities = 89/737 (12%), Positives = 218/737 (29%), Gaps = 218/737 (29%)

Query: 76  HYHLLLSES----YLTSDRIPNDYVF-NDFAEDETRRHIKYALGVGSVIGGTGILLHRNN 130
           H+H +  E+    Y   D +    VF + F ++   + ++             IL   + 
Sbjct: 3   HHHHMDFETGEHQYQYKDILS---VFEDAFVDNFDCKDVQDMP--------KSIL---SK 48

Query: 131 YDVNSLVAVR-LVRAASCVFNIAYIYKKALYQKATPDPTSEEYSNLKSKVHKEAAEQLLE 189
            +++ ++  +  V     +F      ++ + QK   +     Y  L S +  E       
Sbjct: 49  EEIDHIIMSKDAVSGTLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTE------- 101

Query: 190 LCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDI-----LAVLKEDLG 244
             +    +                + Y+E    L++   +    ++        L++ L 
Sbjct: 102 -QRQPSMMT---------------RMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALL 145

Query: 245 KDPSEIFASIEPNPMG-------AASLAQVHKATLHDGSTIA-LKVQHRNVRDNANIDIK 296
           +        I+   +        A  +   +K        I  L +++ N      +++ 
Sbjct: 146 ELRPAKNVLID--GVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCN-SPETVLEM- 201

Query: 297 CMEALVHVVAWVFPEFKFLWLVDETKRNIPKELNFLEEASNITKVTKMFAHFPWLKIPQI 356
            ++ L++ +     +  +    D +  NI   ++ ++      ++ ++          + 
Sbjct: 202 -LQKLLYQI-----DPNWTSRSDHSS-NIKLRIHSIQA-----ELRRLLKS-------KP 242

Query: 357 HP-------DLCTSRVL-AMDF--------MEGGQINDVDYITENNINVYEVSDKLGKLY 400
           +        ++  ++   A +               + +   T  +I++   S  L    
Sbjct: 243 YENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDE 302

Query: 401 SEMIFNSGFVHSDPHPGNILVRRAQSSNSAELILLDHGLYASLTDDF--RTEYAKLWLSI 458
            + +    ++   P     L R   ++N          + A    D     +    W  +
Sbjct: 303 VKSLL-LKYLDCRPQD---LPREVLTTN-----PRRLSIIAESIRDGLATWDN---WKHV 350

Query: 459 LNKDKVAMKEHCTKLGVGDMYGLFACMVSGRSWDAIEAGIEKTKFTESEK-----EVFQR 513
            N DK+                             IE+ +   +  E  K      VF  
Sbjct: 351 -NCDKLTT--------------------------IIESSLNVLEPAEYRKMFDRLSVFPP 383

Query: 514 DVPNLIPEISDILTRVNRQVLLILKTNDLIRGIEHTLKTHARRVSLLV----MSRCCIRS 569
                IP            +L ++  + +   +   +    +  SL+      S   I S
Sbjct: 384 SAH--IPT----------ILLSLIWFDVIKSDVMVVVNKLHKY-SLVEKQPKESTISIPS 430

Query: 570 VYSEEYSHAHS----HLKKCV--LLISEKWQLFKLS-----MY-YFYLGISRPMLEGFHF 617
           +Y E      +    H +  V    I + +    L       Y Y ++        G H 
Sbjct: 431 IYLELKVKLENEYALH-RSIVDHYNIPKTFDSDDLIPPYLDQYFYSHI--------GHHL 481

Query: 618 WIDNTSSKENDATTPSSSDWWKGFLDAA--RNKVGAVLIDNTSSKENDATTPSSSD--WW 673
              N    E              FLD      K+     D+T+   + +   +     ++
Sbjct: 482 --KNIEHPERMTLFR------MVFLDFRFLEQKIRH---DSTAWNASGSILNTLQQLKFY 530

Query: 674 KGFLDAARNKVGAVLLVSMIERSTTLDLKSAEVLEFVKKDFDELSTTVKTEATNVVQ--- 730
           K +               + +     +     +L+F+ K  + L   + ++ T++++   
Sbjct: 531 KPY---------------ICDNDPKYERLVNAILDFLPKIEENL---ICSKYTDLLRIAL 572

Query: 731 --QTTTVFRETL-QLDK 744
             +   +F E   Q+ +
Sbjct: 573 MAEDEAIFEEAHKQVQR 589


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1046
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.9
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 99.78
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.77
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 99.76
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.75
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 99.75
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.74
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 99.74
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.74
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.73
4aoj_A329 High affinity nerve growth factor receptor; transf 99.72
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 99.71
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.71
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 99.7
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 99.7
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 99.69
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 99.68
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.68
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.68
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.67
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.66
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 99.65
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 99.65
4ase_A353 Vascular endothelial growth factor receptor 2; tra 99.64
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.64
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.61
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 99.61
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.61
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.61
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.6
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.6
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 99.6
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.59
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.59
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 99.58
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.58
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.57
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.56
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.55
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.55
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.55
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 99.55
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.55
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.54
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.54
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 99.54
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.54
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.54
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.54
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.53
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.53
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.53
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.53
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.53
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.53
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.53
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.53
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 99.52
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 99.52
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 99.52
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.52
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 99.52
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.51
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.51
3ork_A311 Serine/threonine protein kinase; structural genomi 99.51
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.51
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.51
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 99.51
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.51
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.51
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.51
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.51
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.51
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 99.51
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.51
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.5
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 99.5
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 99.5
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.5
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.5
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.5
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.5
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.5
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.5
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.5
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.5
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.5
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 99.5
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.5
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.5
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.5
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.5
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.5
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.5
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.49
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.49
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 99.49
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 99.49
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.49
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.49
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.49
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.49
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.49
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.49
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 99.49
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.49
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.49
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.49
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.49
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.49
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.49
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.49
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.49
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.48
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 99.48
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.48
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 99.48
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.48
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.48
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.48
3niz_A311 Rhodanese family protein; structural genomics, str 99.48
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.48
3q4u_A301 Activin receptor type-1; structural genomics conso 99.48
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.48
3uqc_A286 Probable conserved transmembrane protein; structur 99.48
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.48
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.48
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.47
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.47
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.47
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.47
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.47
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.47
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.47
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.47
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.47
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.47
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.47
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.47
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.47
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.46
2y0a_A326 Death-associated protein kinase 1; transferase, ca 99.46
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.46
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.46
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.46
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.46
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.46
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.46
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.46
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.46
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.46
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.46
3rp9_A458 Mitogen-activated protein kinase; structural genom 99.46
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.46
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.46
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.46
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.46
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 99.46
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.46
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.45
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.45
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.45
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.45
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.45
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.45
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 99.45
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.45
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.45
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 99.45
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.45
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.45
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.45
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.45
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 99.45
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.44
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.44
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.44
3soc_A322 Activin receptor type-2A; structural genomics cons 99.44
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.44
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.44
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.44
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.44
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.44
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.44
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.44
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 99.44
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.44
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.44
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.44
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.43
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.43
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.43
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 99.43
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.43
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.43
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.43
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.43
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.43
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.43
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.43
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.43
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.43
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.42
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.42
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.42
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.42
3bhy_A283 Death-associated protein kinase 3; death associate 99.42
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.42
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.42
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.42
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.42
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.42
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.42
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.42
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.42
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.42
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.42
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.42
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.42
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.41
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.41
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.41
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.41
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.4
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.4
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.4
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.39
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.39
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.39
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.39
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.39
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.39
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.38
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.38
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.38
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.38
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.38
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.38
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.38
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.38
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.37
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.37
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.36
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.36
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.36
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.36
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.36
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.35
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 99.34
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.31
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.28
3qa8_A676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.28
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.28
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.21
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 99.2
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.2
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 99.0
3d1u_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 98.86
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 98.82
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 98.64
3r70_A320 Aminoglycoside phosphotransferase; structural geno 98.6
3f7w_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 98.54
2olc_A397 MTR kinase, methylthioribose kinase; kinase ADP-2H 98.53
3ovc_A362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 98.51
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 98.43
2q83_A346 YTAA protein; 2635576, structural genomics, joint 98.4
3ats_A357 Putative uncharacterized protein; hypothetical pro 98.31
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 98.3
3jr1_A312 Putative fructosamine-3-kinase; YP_719053.1, struc 98.18
2ppq_A322 HSK, HK, homoserine kinase; structural genomics, M 98.12
1zyl_A328 Hypothetical protein YIHE; putative protein kinase 98.04
3i1a_A339 Spectinomycin phosphotransferase; protein kinase, 97.97
3csv_A333 Aminoglycoside phosphotransferase; YP_614837.1, ph 97.84
3dxq_A301 Choline/ethanolamine kinase family protein; NP_106 97.83
2pyw_A420 Uncharacterized protein; 5-methylthioribose kinase 97.74
1nw1_A429 Choline kinase (49.2 KD); phospholipid synthesis, 97.52
3c5i_A369 Choline kinase; choline, kinase, malaria, transfer 97.51
3feg_A379 Choline/ethanolamine kinase; non-protein kinase, c 97.35
3f2s_A401 CK, chetk-alpha, choline kinase alpha; non-protein 96.74
2qg7_A458 Ethanolamine kinase PV091845; malaria, SGC, struct 96.65
3mes_A424 Choline kinase; malaria, structural genomics, stru 96.18
1x3a_A100 Synapse associated protein 1; BSD domain, homolog 95.07
3g15_A401 CK, chetk-alpha, choline kinase alpha; non-protein 92.41
1cja_A342 Protein (actin-fragmin kinase); transferase; HET: 91.13
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
Probab=99.90  E-value=3.8e-24  Score=236.40  Aligned_cols=230  Identities=14%  Similarity=0.141  Sum_probs=124.5

Q ss_pred             HHHHHHHHHHHHHHHHhcCCcEe-ehhhhhhcCCCCCcHHHHHHHHHhhcCCCCCCHHHHHHHHHHHhCCChhhhhcccC
Q psy14256        177 SKVHKEAAEQLLELCKMNKGVYI-KVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIE  255 (1046)
Q Consensus       177 ~~~H~r~A~rL~~lle~lGG~yI-KLGQ~LStr~dLLP~ey~~~L~~LqD~vPp~p~eeV~~vieeeLG~~~eeIFs~FD  255 (1046)
                      ++.|.+.|+++.+.+..+++..+ +++|.+...++..+. ++.+++++||.+|+.+.+.+...++.+++.+..+.|..|+
T Consensus        15 ~~~~~~r~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~-~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   93 (365)
T 2y7j_A           15 FNKERRRARREIRHLPNLNREQRRAFIRSLRDDPSQSAN-LLAEAKKLNDAQPKGTENLYFQSMGPEDELPDWAAAKEFY   93 (365)
T ss_dssp             --------------------------------------------------------------------CBCHHHHHHHHH
T ss_pred             chHHHHHHHHHHhcCccchhcccccccccccCCCchhHH-HHHHHHhhhhcCCCCccccccccCCchhhcccchhhhhhh
Confidence            45677789999999999999998 888888877765544 5578999999999999999999999999999888887776


Q ss_pred             C-----cccccccceEEEEEEcc-CCCEEEEEEeecccchhhhHHHHHHHHHHHHHHHhccCcchhhhHHHHHHhhHHHh
Q psy14256        256 P-----NPMGAASLAQVHKATLH-DGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNIPKEL  329 (1046)
Q Consensus       256 ~-----ePIGSASiGQVHrA~Lk-dGe~VAVKVQrP~I~~~i~~DL~iLr~La~ll~~lfp~~~l~~LvdE~~~sL~~EL  329 (1046)
                      .     ++||+|++|+||+|+++ +|+.||||+++++.......|+                       +++.+.+.+|+
T Consensus        94 ~~y~~~~~lg~G~~g~Vy~a~~~~~g~~vavK~~~~~~~~~~~~~~-----------------------~~~~~~~~~E~  150 (365)
T 2y7j_A           94 QKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEVTAERLSPEQL-----------------------EEVREATRRET  150 (365)
T ss_dssp             HHEEEEEEEEECSSEEEEEEEETTTCCEEEEEEEETTSSCCCHHHH-----------------------HHHHHHHHHHH
T ss_pred             hhcccceEEecCCCEEEEEEEECCCCcEEEEEEEEccccccCHHHH-----------------------HHHHHHHHHHH
Confidence            5     89999999999999998 8999999999987654333332                       23333444454


Q ss_pred             hHHHHHHHHHHHHHHhcCCCCeecceeecCCCCceEEEEEecCCcCcCchhhHHhcCCCHHHHHHHHHHH--HHHHHHhc
Q psy14256        330 NFLEEASNITKVTKMFAHFPWLKIPQIHPDLCTSRVLAMDFMEGGQINDVDYITENNINVYEVSDKLGKL--YSEMIFNS  407 (1046)
Q Consensus       330 DFl~EA~N~erf~~~f~~~~~V~VPkVy~elStkrVLVMEyIeG~sL~Dl~~L~~~gid~~eIa~~L~q~--fl~qIf~~  407 (1046)
                      +++.+.          .+++.+..+..++..++..+|||||++|++|.++.. ....++...+...+.++  .+.++|..
T Consensus       151 ~~l~~l----------~~hp~iv~~~~~~~~~~~~~lv~e~~~g~~L~~~l~-~~~~l~~~~~~~i~~qi~~~L~~LH~~  219 (365)
T 2y7j_A          151 HILRQV----------AGHPHIITLIDSYESSSFMFLVFDLMRKGELFDYLT-EKVALSEKETRSIMRSLLEAVSFLHAN  219 (365)
T ss_dssp             HHHHHH----------TTCTTBCCEEEEEEBSSEEEEEECCCTTCBHHHHHH-HHSSCCHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHh----------cCCCCEeEEEEEEeeCCEEEEEEEeCCCCcHHHHHH-hcCCCCHHHHHHHHHHHHHHHHHHHhC
Confidence            444322          245566666666677788999999999999988533 23457777777777666  34889999


Q ss_pred             CCcccCCCCCCeEeeccCCCCccEEEEEecccccccCHH
Q psy14256        408 GFVHSDPHPGNILVRRAQSSNSAELILLDHGLYASLTDD  446 (1046)
Q Consensus       408 GfVHrDPHPGNILV~~~~~~Gk~qIvLLDFGLar~Ls~~  446 (1046)
                      |++|+||||+||+++.   +|  .++|+|||+++.+++.
T Consensus       220 gi~H~Dlkp~NIl~~~---~~--~ikl~DfG~~~~~~~~  253 (365)
T 2y7j_A          220 NIVHRDLKPENILLDD---NM--QIRLSDFGFSCHLEPG  253 (365)
T ss_dssp             TEECSCCSGGGEEECT---TC--CEEECCCTTCEECCTT
T ss_pred             CeecCCCCHHHEEECC---CC--CEEEEecCcccccCCC
Confidence            9999999999999987   56  8999999999887653



>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure
>1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 Back     alignment and structure
>3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* Back     alignment and structure
>3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>1nw1_A Choline kinase (49.2 KD); phospholipid synthesis, protein kinase fold, transferase; 2.02A {Caenorhabditis elegans} SCOP: d.144.1.8 Back     alignment and structure
>3c5i_A Choline kinase; choline, kinase, malaria, transferase, structural genomics, structural genomics consortium; 2.20A {Plasmodium knowlesi} PDB: 3fi8_A* Back     alignment and structure
>3feg_A Choline/ethanolamine kinase; non-protein kinase, choline kinase, structural genomics CONS SGC, hemicholinium-3, phosphorylation; HET: HC7 ADP AMP; 1.30A {Homo sapiens} PDB: 3lq3_A* 2ig7_A* Back     alignment and structure
>2qg7_A Ethanolamine kinase PV091845; malaria, SGC, structural genomics consortium, transferase; 2.41A {Plasmodium vivax} Back     alignment and structure
>3mes_A Choline kinase; malaria, structural genomics, structural genomics consortium, SGC, transferase; HET: ADP DME PT3; 2.35A {Cryptosporidium parvum} Back     alignment and structure
>1x3a_A Synapse associated protein 1; BSD domain, homolog of the drosophila SAP47, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.240.1.1 Back     alignment and structure
>3g15_A CK, chetk-alpha, choline kinase alpha; non-protein kinase, structural genomics CONS SGC, hemicholinium-3, transferase; HET: ADP HC6; 1.70A {Homo sapiens} PDB: 3f2r_A* 2i7q_A 2cko_A 2ckp_A* 2ckq_A* Back     alignment and structure
>1cja_A Protein (actin-fragmin kinase); transferase; HET: AMP; 2.90A {Physarum polycephalum} SCOP: d.144.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1046
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 0.001
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: gamma-subunit of glycogen phosphorylase kinase (Phk)
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
 Score = 39.7 bits (92), Expect = 0.001
 Identities = 40/280 (14%), Positives = 86/280 (30%), Gaps = 50/280 (17%)

Query: 260 GAASLAQVHKAT-LHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLV 318
           G    + V +          A+K+       + + +                       V
Sbjct: 12  GRGVSSVVRRCIHKPTCKEYAVKIIDVTGGGSFSAEE----------------------V 49

Query: 319 DETKRNIPKELNFLEEASNITKVTKMFAHFPWLKIPQIHPDLCTSRVLAMDFMEGGQIND 378
            E +    KE++ L + S    + ++   +      + +        L  D M+ G++ D
Sbjct: 50  QELREATLKEVDILRKVSGHPNIIQLKDTY------ETNTFFF----LVFDLMKKGELFD 99

Query: 379 VDYITEN-NINVYEVSDKLGKLYSEMIF--NSGFVHSDPHPGNILVRRAQSSNSAELILL 435
             Y+TE   ++  E    +  L   +        VH D  P NIL+      +   + L 
Sbjct: 100 --YLTEKVTLSEKETRKIMRALLEVICALHKLNIVHRDLKPENILL-----DDDMNIKLT 152

Query: 436 DHGLYASLTDDFRTEYAKLWLSILNKDKVAMKEHCTKLGVG---DMYGL---FACMVSGR 489
           D G    L    +        S L  + +    +    G G   DM+        +++G 
Sbjct: 153 DFGFSCQLDPGEKLREVCGTPSYLAPEIIECSMNDNHPGYGKEVDMWSTGVIMYTLLAGS 212

Query: 490 S-WDAIEAGIEKTKFTESEKEVFQRDVPNLIPEISDILTR 528
             +   +  +          +    +  +    + D+++R
Sbjct: 213 PPFWHRKQMLMLRMIMSGNYQFGSPEWDDYSDTVKDLVSR 252


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1046
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.81
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.74
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 99.74
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.72
d1s9ja_322 Dual specificity mitogen-activated protein kinase 99.72
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.72
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.71
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 99.7
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.7
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.7
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.7
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.69
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.69
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.69
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.68
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.68
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.68
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.68
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.68
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.68
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.68
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.67
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.66
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.66
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.66
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.65
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 99.65
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 99.64
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.64
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.64
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.64
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.64
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.64
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.63
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.63
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.63
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.62
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.62
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 99.62
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.62
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.62
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.61
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.61
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.59
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.59
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.58
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.57
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.57
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.55
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.55
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.55
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.55
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.54
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.54
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.53
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.52
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.51
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.51
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.49
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.46
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.31
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 98.6
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 98.19
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 98.16
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 98.11
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 96.97
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 96.56
d1x3aa187 Synapse associated protein 1, SYAP1 {Human (Homo s 90.91
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: RIO1-like kinases
domain: Rio2 serine protein kinase C-terminal domain
species: Archaeoglobus fulgidus [TaxId: 2234]
Probab=99.81  E-value=7.4e-20  Score=182.78  Aligned_cols=182  Identities=15%  Similarity=0.160  Sum_probs=114.1

Q ss_pred             cccccccceEEEEEEccCCCEEEEEEeecccchhhhHHHHHHHHHHHHHHHhccCcchhhhHHHHHHhhHHHhhHHHHHH
Q psy14256        257 NPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNIPKELNFLEEAS  336 (1046)
Q Consensus       257 ePIGSASiGQVHrA~LkdGe~VAVKVQrP~I~~~i~~DL~iLr~La~ll~~lfp~~~l~~LvdE~~~sL~~ELDFl~EA~  336 (1046)
                      ++||+|++|+||+|++.+|++||||+++++......               . ....   .................|..
T Consensus         6 ~~IG~G~~g~Vy~a~~~~g~~vAvKi~r~~~~~~~~---------------~-~~~~---~~~~~~~~~~~~~~~~~e~~   66 (191)
T d1zara2           6 KLMGEGKESAVFNCYSEKFGECVVKFHKVGHTSFKK---------------V-KEKR---DYGDLHFSVLAIRSARNEFR   66 (191)
T ss_dssp             EEEEECSSEEEEEEEETTTEEEEEEEECC------C---------------C-CC----------CHHHHHHHHHHHHHH
T ss_pred             CEeeeCcceEEEEEECCCCCEEEEEEEecccchhhh---------------h-hhhh---hhccHHHHHHHHHHHHHHHH
Confidence            579999999999999989999999999987542100               0 0000   00000000011123445666


Q ss_pred             HHHHHHHHhcCCCCeecceeecCCCCceEEEEEecCCcCcCchhhHHhcCCCHHHHHHHHHHHHHHHHHhcCCcccCCCC
Q psy14256        337 NITKVTKMFAHFPWLKIPQIHPDLCTSRVLAMDFMEGGQINDVDYITENNINVYEVSDKLGKLYSEMIFNSGFVHSDPHP  416 (1046)
Q Consensus       337 N~erf~~~f~~~~~V~VPkVy~elStkrVLVMEyIeG~sL~Dl~~L~~~gid~~eIa~~L~q~fl~qIf~~GfVHrDPHP  416 (1046)
                      ++.++       ..+.+|+.+..  ...+|+|||++|..+.++.     ......++..++++ +.++|.+|++|||+||
T Consensus        67 ~l~~l-------~~~~v~~~~~~--~~~~lvme~~~~~~~~~l~-----~~~~~~i~~ql~~~-l~~lH~~giiHrDiKP  131 (191)
T d1zara2          67 ALQKL-------QGLAVPKVYAW--EGNAVLMELIDAKELYRVR-----VENPDEVLDMILEE-VAKFYHRGIVHGDLSQ  131 (191)
T ss_dssp             HHHHT-------TTSSSCCEEEE--ETTEEEEECCCCEEGGGCC-----CSCHHHHHHHHHHH-HHHHHHTTEECSCCST
T ss_pred             HHHHc-------cCCCcceEEEe--cCCEEEEEeeccccccchh-----hHHHHHHHHHHHHH-HHHHhhCCEEEccCCh
Confidence            66543       23456777642  4568999999998765531     12345566665555 5789999999999999


Q ss_pred             CCeEeeccCCCCccEEEEEecccccccCHHHHHHHHHHHHHHHhcCHHHHHHHH-HHcCC-CchhhhHHHH
Q psy14256        417 GNILVRRAQSSNSAELILLDHGLYASLTDDFRTEYAKLWLSILNKDKVAMKEHC-TKLGV-GDMYGLFACM  485 (1046)
Q Consensus       417 GNILV~~~~~~Gk~qIvLLDFGLar~Ls~~~R~~y~~L~~All~~D~~~i~~~~-~~lGi-~d~~~lfA~m  485 (1046)
                      +|||+++   +   .++|+|||++...+.+....|       +.+|...+.+++ +..+. .|++.++..+
T Consensus       132 ~NILv~~---~---~~~liDFG~a~~~~~~~~~~~-------l~rd~~~~~~~f~r~y~~~~d~~s~~~~~  189 (191)
T d1zara2         132 YNVLVSE---E---GIWIIDFPQSVEVGEEGWREI-------LERDVRNIITYFSRTYRTEKDINSAIDRI  189 (191)
T ss_dssp             TSEEEET---T---EEEECCCTTCEETTSTTHHHH-------HHHHHHHHHHHHHHHHCCCCCHHHHHHHH
T ss_pred             hheeeeC---C---CEEEEECCCcccCCCCCcHHH-------HHHHHHHHHHHHcCCCCCcccHHHHHHHH
Confidence            9999986   3   699999999998875543332       344555555554 34555 5666665543



>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1x3aa1 a.240.1.1 (A:8-94) Synapse associated protein 1, SYAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure