Psyllid ID: psy14259

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------8
MIESRLPIRAEKQQNINDHEAPYLQHISWAPVDNALAFVYNRDVYYSPSATLQDIYRLSNTGSEVVSNGVPDWLYQARE
cccEEEEccccccccccccccccEEEEEEcccccEEEEEEcccEEEEcccccccEEEEEcccccEEEEccccEEEEEEc
ccHcccccEEEEcccccccccccEEEEEEcccccEEEEEEcccEEEEcccccccEEEEEcccccEEEcccccEEEEccc
miesrlpiraekqqnindheapylqhiswapvdnaLAFVynrdvyyspsatlqdiyrlsntgsevvsngvpdwlyqare
MIESRLPIRAEKQQNINDHEAPYLQHISWAPVDNALAFVYNRDVYYSPSATLQDIYRLsntgsevvsngvpdwlyqare
MIESRLPIRAEKQQNINDHEAPYLQHISWAPVDNALAFVYNRDVYYSPSATLQDIYRLSNTGSEVVSNGVPDWLYQARE
********************APYLQHISWAPVDNALAFVYNRDVYYSPSATLQDIYRLSNTGSEVVSNGVPDWLY****
*IESRLP****************LQHISWAPVDNALAFVYNRDVYYSPSATLQDIYRLSNTGSEVVSNGVPDWLYQAR*
MIESRLPIRAEKQQNINDHEAPYLQHISWAPVDNALAFVYNRDVYYSPSATLQDIYRLSNTGSEVVSNGVPDWLYQARE
*I**RLPIRAEKQQNINDHEAPYLQHISWAPVDNALAFVYNRDVYYSPSATLQDIYRLSNTGSEVVSNGVPDWLYQAR*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIESRLPIRAEKQQNINDHEAPYLQHISWAPVDNALAFVYNRDVYYSPSATLQDIYRLSNTGSEVVSNGVPDWLYQARE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query79 2.2.26 [Sep-21-2011]
P27487 766 Dipeptidyl peptidase 4 OS yes N/A 0.810 0.083 0.373 4e-05
B6V868 775 Dipeptidyl peptidase 4 OS N/A N/A 0.683 0.069 0.368 4e-05
P22411 766 Dipeptidyl peptidase 4 OS yes N/A 0.810 0.083 0.402 8e-05
A7UKV8 775 Dipeptidyl peptidase 4 OS N/A N/A 0.683 0.069 0.368 8e-05
B2D0J4 775 Venom dipeptidyl peptidas no N/A 0.632 0.064 0.403 0.0001
P46101 859 Dipeptidyl aminopeptidase yes N/A 0.658 0.060 0.388 0.0002
Q9Z218 804 Dipeptidyl aminopeptidase yes N/A 0.658 0.064 0.388 0.0002
P42658 865 Dipeptidyl aminopeptidase no N/A 0.658 0.060 0.388 0.0002
Q5IS50 803 Dipeptidyl aminopeptidase no N/A 0.658 0.064 0.388 0.0002
P42659 863 Dipeptidyl aminopeptidase yes N/A 0.658 0.060 0.388 0.0003
>sp|P27487|DPP4_HUMAN Dipeptidyl peptidase 4 OS=Homo sapiens GN=DPP4 PE=1 SV=2 Back     alignment and function desciption
 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 3/67 (4%)

Query: 12  KQQNINDHEAPY-LQHISWAPVDNALAFVYNRDVYYSPSATLQDIYRLSNTGSE-VVSNG 69
           K+Q I +   P   Q ++W+PV + LA+V+N D+Y      L   YR++ TG E ++ NG
Sbjct: 139 KRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPS-YRITWTGKEDIIYNG 197

Query: 70  VPDWLYQ 76
           + DW+Y+
Sbjct: 198 ITDWVYE 204
Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Acts as a positive regulator of T-cell coactivation, by binding at least ADA, CAV1, IGF2R, and PTPRC. Its binding to CAV1 and CARD11 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Its interaction with ADA also regulates lymphocyte-epithelial cell adhesion. In association with FAP is involved in the pericellular proteolysis of the extracellular matrix (ECM), the migration and invasion of endothelial cells into the ECM. May be involved in the promotion of lymphatic endothelial cells adhesion, migration and tube formation. When overexpressed, enhanced cell proliferation, a process inhibited by GPC3. Acts also as a serine exopeptidase with a dipeptidyl peptidase activity that regulates various physiological processes by cleaving peptides in the circulation, including many chemokines, mitogenic growth factors, neuropeptides and peptide hormones. Removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 4EC: .EC: 1EC: 4EC: .EC: 5
>sp|B6V868|DPP4_TRITO Dipeptidyl peptidase 4 OS=Trichophyton tonsurans GN=DPP4 PE=3 SV=1 Back     alignment and function description
>sp|P22411|DPP4_PIG Dipeptidyl peptidase 4 OS=Sus scrofa GN=DPP4 PE=1 SV=3 Back     alignment and function description
>sp|A7UKV8|DPP4_TRIEQ Dipeptidyl peptidase 4 OS=Trichophyton equinum GN=DPP4 PE=3 SV=1 Back     alignment and function description
>sp|B2D0J4|VDPP4_APIME Venom dipeptidyl peptidase 4 OS=Apis mellifera PE=1 SV=1 Back     alignment and function description
>sp|P46101|DPP6_RAT Dipeptidyl aminopeptidase-like protein 6 OS=Rattus norvegicus GN=Dpp6 PE=1 SV=1 Back     alignment and function description
>sp|Q9Z218|DPP6_MOUSE Dipeptidyl aminopeptidase-like protein 6 OS=Mus musculus GN=Dpp6 PE=1 SV=1 Back     alignment and function description
>sp|P42658|DPP6_HUMAN Dipeptidyl aminopeptidase-like protein 6 OS=Homo sapiens GN=DPP6 PE=1 SV=2 Back     alignment and function description
>sp|Q5IS50|DPP6_PANTR Dipeptidyl aminopeptidase-like protein 6 OS=Pan troglodytes GN=DPP6 PE=2 SV=1 Back     alignment and function description
>sp|P42659|DPP6_BOVIN Dipeptidyl aminopeptidase-like protein 6 OS=Bos taurus GN=DPP6 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query79
242009445 862 Inactive dipeptidyl peptidase, putative 0.848 0.077 0.472 8e-09
328723594 688 PREDICTED: venom dipeptidyl peptidase 4- 0.797 0.091 0.406 1e-07
91087141 847 PREDICTED: similar to CG9059 CG9059-PB [ 0.746 0.069 0.416 2e-07
357619809 837 hypothetical protein KGM_18948 [Danaus p 0.772 0.072 0.419 3e-07
312372761 964 hypothetical protein AND_19738 [Anophele 0.835 0.068 0.424 7e-07
328778949 795 PREDICTED: venom dipeptidyl peptidase 4- 0.810 0.080 0.4 3e-06
170052120 764 dipeptidyl-peptidase [Culex quinquefasci 0.898 0.092 0.386 3e-06
403182873 261 AAEL017387-PA, partial [Aedes aegypti] 0.721 0.218 0.448 4e-06
194870925 1040 GG15695 [Drosophila erecta] gi|190654532 0.708 0.053 0.438 5e-06
345485878 797 PREDICTED: venom dipeptidyl peptidase 4- 0.772 0.076 0.403 5e-06
>gi|242009445|ref|XP_002425496.1| Inactive dipeptidyl peptidase, putative [Pediculus humanus corporis] gi|212509351|gb|EEB12758.1| Inactive dipeptidyl peptidase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 42/72 (58%), Gaps = 5/72 (6%)

Query: 6   LPIRAEKQQNINDHEAPYLQHISWAPVDNALAFVYNRDVYYSPSATLQDIYRLS-NTGSE 64
            PI+     N  D +  + Q + WAP  NAL  VYN D+YY  S T   IYRL+ N    
Sbjct: 159 FPIKV----NSADEQDNFFQLVDWAPRGNALLIVYNYDIYYKTSPTTNKIYRLTENAEPG 214

Query: 65  VVSNGVPDWLYQ 76
           VVSNG+PDWLY+
Sbjct: 215 VVSNGLPDWLYE 226

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328723594|ref|XP_003247888.1| PREDICTED: venom dipeptidyl peptidase 4-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|91087141|ref|XP_975282.1| PREDICTED: similar to CG9059 CG9059-PB [Tribolium castaneum] gi|270009589|gb|EFA06037.1| hypothetical protein TcasGA2_TC008867 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357619809|gb|EHJ72238.1| hypothetical protein KGM_18948 [Danaus plexippus] Back     alignment and taxonomy information
>gi|312372761|gb|EFR20649.1| hypothetical protein AND_19738 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|328778949|ref|XP_394703.4| PREDICTED: venom dipeptidyl peptidase 4-like [Apis mellifera] Back     alignment and taxonomy information
>gi|170052120|ref|XP_001862077.1| dipeptidyl-peptidase [Culex quinquefasciatus] gi|167873102|gb|EDS36485.1| dipeptidyl-peptidase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|403182873|gb|EJY57688.1| AAEL017387-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|194870925|ref|XP_001972749.1| GG15695 [Drosophila erecta] gi|190654532|gb|EDV51775.1| GG15695 [Drosophila erecta] Back     alignment and taxonomy information
>gi|345485878|ref|XP_001603694.2| PREDICTED: venom dipeptidyl peptidase 4-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query79
FB|FBgn0030810 1077 CG9059 [Drosophila melanogaste 0.569 0.041 0.396 1.1e-07
FB|FBgn0259175 1040 ome "omega" [Drosophila melano 0.721 0.054 0.413 1.5e-07
ZFIN|ZDB-GENE-081104-439 753 fap "fibroblast activation pro 0.822 0.086 0.382 2.7e-07
UNIPROTKB|P27487 766 DPP4 "Dipeptidyl peptidase 4" 0.810 0.083 0.373 3.6e-07
UNIPROTKB|F1NDP3 757 FAP "Uncharacterized protein" 0.759 0.079 0.365 5.8e-07
UNIPROTKB|F1NDK7 762 DPP4 "Uncharacterized protein" 0.658 0.068 0.403 5.8e-07
UNIPROTKB|P22411 766 DPP4 "Dipeptidyl peptidase 4" 0.810 0.083 0.402 7.5e-07
FB|FBgn0031835 935 CG11319 [Drosophila melanogast 0.721 0.060 0.379 3.3e-06
UNIPROTKB|I3LSP997 I3LSP9 "Uncharacterized protei 0.658 0.536 0.388 3.4e-06
MGI|MGI:94919 760 Dpp4 "dipeptidylpeptidase 4" [ 0.810 0.084 0.358 4.2e-06
FB|FBgn0030810 CG9059 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 104 (41.7 bits), Expect = 1.1e-07, Sum P(2) = 1.1e-07
 Identities = 21/53 (39%), Positives = 33/53 (62%)

Query:    32 VDNALAFVYNRDVYYSPSATLQDIYRLSNTGSE--------VVSNGVPDWLYQ 76
             ++ A+AFV++ D+YY P    + + R++ TGS         VV NGVPDW+Y+
Sbjct:   276 LNQAIAFVHHNDIYYKPKVQGELVCRITQTGSGSLEGESTGVVFNGVPDWMYE 328
GO:0008239 "dipeptidyl-peptidase activity" evidence=ISS
GO:0008236 "serine-type peptidase activity" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
FB|FBgn0259175 ome "omega" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081104-439 fap "fibroblast activation protein, alpha" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P27487 DPP4 "Dipeptidyl peptidase 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NDP3 FAP "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NDK7 DPP4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P22411 DPP4 "Dipeptidyl peptidase 4" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0031835 CG11319 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|I3LSP9 I3LSP9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:94919 Dpp4 "dipeptidylpeptidase 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query79
pfam00930 348 pfam00930, DPPIV_N, Dipeptidyl peptidase IV (DPP I 1e-10
>gnl|CDD|216201 pfam00930, DPPIV_N, Dipeptidyl peptidase IV (DPP IV) N-terminal region Back     alignment and domain information 
 Score = 55.0 bits (133), Expect = 1e-10
 Identities = 16/55 (29%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 22 PYLQHISWAPVDNALAFVYNRDVYYSPSATLQDIYRLSNTGSEVVSNGVPDWLYQ 76
            +Q+  W+P  + LA+V + ++Y    AT ++  ++++ GS  + NG+ DW+Y+
Sbjct: 43 GKIQYAKWSPDGHKLAYVRDNNLYVRELATGKET-QITSDGSNGIFNGLADWVYE 96

This family is an alignment of the region to the N-terminal side of the active site. The Prosite motif does not correspond to this Pfam entry. Length = 348

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 79
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 99.76
KOG2100|consensus 755 99.35
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 96.78
PRK04043419 tolB translocation protein TolB; Provisional 96.72
KOG2281|consensus 867 96.36
PRK03629429 tolB translocation protein TolB; Provisional 95.52
PRK04043 419 tolB translocation protein TolB; Provisional 95.27
PRK00178 430 tolB translocation protein TolB; Provisional 94.9
PRK04922433 tolB translocation protein TolB; Provisional 94.58
PRK01029428 tolB translocation protein TolB; Provisional 94.0
PRK05137 435 tolB translocation protein TolB; Provisional 93.94
PRK01029428 tolB translocation protein TolB; Provisional 93.88
PRK04792 448 tolB translocation protein TolB; Provisional 93.87
PRK05137435 tolB translocation protein TolB; Provisional 93.84
PRK04792448 tolB translocation protein TolB; Provisional 93.78
PRK03629 429 tolB translocation protein TolB; Provisional 93.74
PRK00178430 tolB translocation protein TolB; Provisional 93.41
COG0823425 TolB Periplasmic component of the Tol biopolymer t 93.26
PRK01742 429 tolB translocation protein TolB; Provisional 93.15
PRK02889 427 tolB translocation protein TolB; Provisional 93.13
COG0823 425 TolB Periplasmic component of the Tol biopolymer t 92.36
PRK02889427 tolB translocation protein TolB; Provisional 92.26
PRK04922433 tolB translocation protein TolB; Provisional 91.42
COG4946 668 Uncharacterized protein related to the periplasmic 90.42
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 90.19
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 88.04
PRK13616591 lipoprotein LpqB; Provisional 87.68
TIGR02800 417 propeller_TolB tol-pal system beta propeller repea 87.53
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 87.31
PRK01742429 tolB translocation protein TolB; Provisional 86.29
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 84.82
TIGR02171 912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 82.68
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information 
Probab=99.76  E-value=4.4e-19  Score=131.46  Aligned_cols=70  Identities=29%  Similarity=0.522  Sum_probs=53.7

Q ss_pred             cCCccceeecccCCCCCCCeeeeEEccCCCeEEEEEcCCEEEEcCCCCCCeEEeccCCCceeEecccceeeeec
Q psy14259          5 RLPIRAEKQQNINDHEAPYLQHISWAPVDNALAFVYNRDVYYSPSATLQDIYRLSNTGSEVVSNGVPDWLYQAR   78 (79)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~~q~a~wsP~g~~lafV~~nnly~~~~~~~~~~~~lT~dG~~~i~nG~~DWvYeEE   78 (79)
                      .+.++..+++...   ...++.++|||+|+.||||++||||+.+...+ ..+|||+||...|+||+||||||||
T Consensus        29 d~~~~~~~~l~~~---~~~~~~~~~sP~g~~~~~v~~~nly~~~~~~~-~~~~lT~dg~~~i~nG~~dwvyeEE   98 (353)
T PF00930_consen   29 DIETGEITPLTPP---PPKLQDAKWSPDGKYIAFVRDNNLYLRDLATG-QETQLTTDGEPGIYNGVPDWVYEEE   98 (353)
T ss_dssp             ETTTTEEEESS-E---ETTBSEEEE-SSSTEEEEEETTEEEEESSTTS-EEEESES--TTTEEESB--HHHHHH
T ss_pred             ecCCCceEECcCC---ccccccceeecCCCeeEEEecCceEEEECCCC-CeEEeccccceeEEcCccceecccc
Confidence            3445555555544   56799999999999999999999999976544 6999999998899999999999999

Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This domain defines serine peptidases belonging to MEROPS peptidase family S9 (clan SC), subfamily S9B (dipeptidyl-peptidase IV). The protein fold of the peptidase domain for members of this family resembles that of serine carboxypeptidase D, the type example of clan SC. This domain is an alignment of the region to the N-terminal side of the active site, which is found in IPR001375 from INTERPRO. CD26 (3.4.14.5 from EC) is also called adenosine deaminase-binding protein (ADA-binding protein) or dipeptidylpeptidase IV (DPP IV ectoenzyme). The exopeptidase cleaves off N-terminal X-Pro or X-Ala dipeptides from polypeptides (dipeptidyl peptidase IV activity). CD26 serves as the costimulatory molecule in T cell activation and is an associated marker of autoimmune diseases, adenosine deaminase-deficiency and HIV pathogenesis. Dipeptidyl peptidase IV (DPP IV) is responsible for the removal of N-terminal dipeptides sequentially from polypeptides having unsubstituted N termini, provided that the penultimate residue is proline. The enzyme catalyses the reaction: Dipeptidyl-Polypeptide + H(2)O = Dipeptide + Polypeptide It is a type II membrane protein that forms a homodimer. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0006508 proteolysis, 0016020 membrane; PDB: 2RIP_A 3Q8W_B 2AJL_I 1TKR_B 1TK3_B 3C45_A 2G5P_A 3G0C_D 1R9M_C 1RWQ_A ....
>KOG2100|consensus Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2281|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query79
3qbj_A 748 Crystal Structure Of Dipeptidyl Peptidase Iv In Com 3e-06
2qt9_A 766 Human Dipeptidyl Peptidase IvCD26 IN COMPLEX WITH A 3e-06
3nox_A 753 Crystal Structure Of Human Dpp-Iv In Complex With S 3e-06
1u8e_A 728 Human Dipeptidyl Peptidase IvCD26 MUTANT Y547F Leng 3e-06
1n1m_A 728 Human Dipeptidyl Peptidase IvCD26 IN COMPLEX WITH A 3e-06
2rgu_A 734 Crystal Structure Of Complex Of Human Dpp4 And Inhi 3e-06
1pfq_A 731 Crystal Structure Of Human Apo Dipeptidyl Peptidase 3e-06
1x70_A 728 Human Dipeptidyl Peptidase Iv In Complex With A Bet 3e-06
2rip_A 729 Structure Of Dppiv In Complex With An Inhibitor Len 3e-06
3q8w_A 732 A B-Aminoacyl Containing Thiazolidine Derivative An 3e-06
2g5p_A 726 Crystal Structure Of Human Dipeptidyl Peptidase Iv 3e-06
4a5s_A 740 Crystal Structure Of Human Dpp4 In Complex With A N 3e-06
3ccb_A 740 Crystal Structure Of Human Dpp4 In Complex With A B 3e-06
2qjr_A 748 Dipepdyl Peptidase Iv In Complex With Inhibitor Pzf 3e-06
1r9n_A 739 Crystal Structure Of Human Dipeptidyl Peptidase Iv 3e-06
1j2e_A 740 Crystal Structure Of Human Dipeptidyl Peptidase Iv 3e-06
2bgr_A 738 Crystal Structure Of Hiv-1 Tat Derived Nonapeptides 3e-06
2onc_A 731 Crystal Structure Of Human Dpp-4 Length = 731 3e-06
1r9m_A 733 Crystal Structure Of Human Dipeptidyl Peptidase Iv 3e-06
2jid_A 736 Human Dipeptidyl Peptidase Iv In Complex With 1-(3, 3e-06
1orv_A 728 Crystal Structure Of Porcine Dipeptidyl Peptidase I 6e-06
1xfd_A 723 Structure Of A Human A-Type Potassium Channel Accel 2e-05
2gbc_A 730 Native Dpp-Iv (Cd26) From Rat Length = 730 6e-04
>pdb|3QBJ|A Chain A, Crystal Structure Of Dipeptidyl Peptidase Iv In Complex With Inhibitor Length = 748 Back     alignment and structure 
Iteration: 1

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
Query: 12  KQQNINDHEAPY-LQHISWAPVDNALAFVYNRDVYYSPSATLQDIYRLSNTGSE-VVSNG 69
           K+Q I +   P   Q ++W+PV + LA+V+N D+Y      L   YR++ TG E ++ NG
Sbjct: 109 KRQLITEERIPANTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPS-YRITWTGKEDIIYNG 167
Query: 70  VPDWLYQ 76
           + DW+Y+
Sbjct: 168 ITDWVYE 174
>pdb|2QT9|A Chain A, Human Dipeptidyl Peptidase IvCD26 IN COMPLEX WITH A 4-Aryl Cyclohexylalanine Inhibitor Length = 766 Back     alignment and structure
>pdb|3NOX|A Chain A, Crystal Structure Of Human Dpp-Iv In Complex With Sa-(+)-(6- (Aminomethyl)-5-(2,4-Dichlorophenyl)-7-Methylimidazo[1, 2-A]pyrimidin- 2-Yl)(Morpholino)methanone Length = 753 Back     alignment and structure
>pdb|1U8E|A Chain A, Human Dipeptidyl Peptidase IvCD26 MUTANT Y547F Length = 728 Back     alignment and structure
>pdb|1N1M|A Chain A, Human Dipeptidyl Peptidase IvCD26 IN COMPLEX WITH AN INHIBITOR Length = 728 Back     alignment and structure
>pdb|2RGU|A Chain A, Crystal Structure Of Complex Of Human Dpp4 And Inhibitor Length = 734 Back     alignment and structure
>pdb|1PFQ|A Chain A, Crystal Structure Of Human Apo Dipeptidyl Peptidase Iv / Cd26 Length = 731 Back     alignment and structure
>pdb|1X70|A Chain A, Human Dipeptidyl Peptidase Iv In Complex With A Beta Amino Acid Inhibitor Length = 728 Back     alignment and structure
>pdb|2RIP|A Chain A, Structure Of Dppiv In Complex With An Inhibitor Length = 729 Back     alignment and structure
>pdb|3Q8W|A Chain A, A B-Aminoacyl Containing Thiazolidine Derivative And Dppiv Complex Length = 732 Back     alignment and structure
>pdb|2G5P|A Chain A, Crystal Structure Of Human Dipeptidyl Peptidase Iv (Dppiv) Complexed With Cyanopyrrolidine (C5-Pro-Pro) Inhibitor 21ac Length = 726 Back     alignment and structure
>pdb|4A5S|A Chain A, Crystal Structure Of Human Dpp4 In Complex With A Noval Heterocyclic Dpp4 Inhibitor Length = 740 Back     alignment and structure
>pdb|3CCB|A Chain A, Crystal Structure Of Human Dpp4 In Complex With A Benzimidazole Derivative Length = 740 Back     alignment and structure
>pdb|2QJR|A Chain A, Dipepdyl Peptidase Iv In Complex With Inhibitor Pzf Length = 748 Back     alignment and structure
>pdb|1R9N|A Chain A, Crystal Structure Of Human Dipeptidyl Peptidase Iv In Complex With A Decapeptide (Tnpy) At 2.3 Ang. Resolution Length = 739 Back     alignment and structure
>pdb|1J2E|A Chain A, Crystal Structure Of Human Dipeptidyl Peptidase Iv Length = 740 Back     alignment and structure
>pdb|2BGR|A Chain A, Crystal Structure Of Hiv-1 Tat Derived Nonapeptides Tat(1-9) Bound To The Active Site Of Dipeptidyl Peptidase Iv (Cd26) Length = 738 Back     alignment and structure
>pdb|2ONC|A Chain A, Crystal Structure Of Human Dpp-4 Length = 731 Back     alignment and structure
>pdb|1R9M|A Chain A, Crystal Structure Of Human Dipeptidyl Peptidase Iv At 2.1 Ang. Resolution. Length = 733 Back     alignment and structure
>pdb|2JID|A Chain A, Human Dipeptidyl Peptidase Iv In Complex With 1-(3,4- Dimethoxy-Phenyl)-3-M-Tolyl-Piperidine-4-Ylamine Length = 736 Back     alignment and structure
>pdb|1ORV|A Chain A, Crystal Structure Of Porcine Dipeptidyl Peptidase Iv (Cd26) Length = 728 Back     alignment and structure
>pdb|1XFD|A Chain A, Structure Of A Human A-Type Potassium Channel Accelerating Factor Dppx, A Member Of The Dipeptidyl Aminopeptidase Family Length = 723 Back     alignment and structure
>pdb|2GBC|A Chain A, Native Dpp-Iv (Cd26) From Rat Length = 730 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query79
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 2e-11
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 2e-10
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 2e-10
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 2e-09
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 2e-05
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Length = 723 Back     alignment and structure
 Score = 56.8 bits (137), Expect = 2e-11
 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 2/72 (2%)

Query: 6   LPIRAEKQQNINDHEAPYLQHISWAPVDNALAFVYNRDVYYSPSATLQDIYRLSNTGSE- 64
           +P    +  +  +     LQ+  W P    L F++  ++YY      Q I R+ +TG E 
Sbjct: 98  IPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAI-RVVSTGKEG 156

Query: 65  VVSNGVPDWLYQ 76
           V+ NG+ DWLY+
Sbjct: 157 VIYNGLSDWLYE 168
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Length = 741 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Length = 719 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Length = 740 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Length = 706 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query79
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.35
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.05
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.03
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.7
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.42
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 96.32
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 95.27
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 95.26
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 95.03
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 94.9
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 94.27
1k32_A 1045 Tricorn protease; protein degradation, substrate g 93.82
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 93.72
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 93.65
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 93.47
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 92.71
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 92.44
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 92.06
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 91.46
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 90.99
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 89.7
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 89.52
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 88.58
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 88.34
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 88.09
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 87.54
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 86.95
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 86.55
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 86.35
4h5i_A 365 Guanine nucleotide-exchange factor SEC12; copii ve 86.21
1k32_A 1045 Tricorn protease; protein degradation, substrate g 84.23
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 83.15
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 82.87
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 82.14
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 80.55
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 80.09
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
Probab=99.35  E-value=7.3e-13  Score=102.34  Aligned_cols=56  Identities=36%  Similarity=0.791  Sum_probs=50.4

Q ss_pred             CCeeeeEEccCCCeEEEEEcCCEEEEcCCCCCCeEEeccCCCc-eeEecccceeeeec
Q psy14259         22 PYLQHISWAPVDNALAFVYNRDVYYSPSATLQDIYRLSNTGSE-VVSNGVPDWLYQAR   78 (79)
Q Consensus        22 ~~~q~a~wsP~g~~lafV~~nnly~~~~~~~~~~~~lT~dG~~-~i~nG~~DWvYeEE   78 (79)
                      ..++.++|||+|+.|||+.++|||+.+. ..+..+|||.+|.. .++||.+||||+||
T Consensus       112 ~~~~~~~~SPdG~~la~~~~~~i~~~~~-~~~~~~~lt~~g~~~~~~~g~~~~v~~ee  168 (740)
T 4a5s_A          112 NNTQWVTWSPVGHKLAYVWNNDIYVKIE-PNLPSYRITWTGKEDIIYNGITDWVYEEE  168 (740)
T ss_dssp             TTEEEEEECSSTTCEEEEETTEEEEESS-TTSCCEECCSCCBTTTEEESBCCHHHHHH
T ss_pred             CcceeeEECCCCCEEEEEECCeEEEEEC-CCCceEEEcCCCCccceecCcccccccch
Confidence            3589999999999999999999999974 44568999999987 79999999999998
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 79
d1xfda1 465 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-lik 0.001
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 465 Back     information, alignment and structure

class: All beta proteins
fold: 8-bladed beta-propeller
superfamily: DPP6 N-terminal domain-like
family: DPP6 N-terminal domain-like
domain: Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 33.8 bits (76), Expect = 0.001
 Identities = 19/71 (26%), Positives = 32/71 (45%)

Query: 6   LPIRAEKQQNINDHEAPYLQHISWAPVDNALAFVYNRDVYYSPSATLQDIYRLSNTGSEV 65
           +P    +  +  +     LQ+  W P    L F++  ++YY      Q I  +S     V
Sbjct: 98  IPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTGKEGV 157

Query: 66  VSNGVPDWLYQ 76
           + NG+ DWLY+
Sbjct: 158 IYNGLSDWLYE 168

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query79
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.74
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.28
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 97.52
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 97.39
d2hqsa1 269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.32
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 96.72
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 95.84
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 95.66
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 91.81
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 89.07
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 85.43
d1nr0a1 311 Actin interacting protein 1 {Nematode (Caenorhabdi 83.52
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 82.33
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 81.18
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 8-bladed beta-propeller
superfamily: DPP6 N-terminal domain-like
family: DPP6 N-terminal domain-like
domain: Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.74  E-value=6.8e-19  Score=130.72  Aligned_cols=74  Identities=27%  Similarity=0.627  Sum_probs=66.0

Q ss_pred             cCCccceeecccCCCCCCCeeeeEEccCCCeEEEEEcCCEEEEcCCCCCCeEEeccCCCc-eeEecccceeeeecC
Q psy14259          5 RLPIRAEKQQNINDHEAPYLQHISWAPVDNALAFVYNRDVYYSPSATLQDIYRLSNTGSE-VVSNGVPDWLYQARE   79 (79)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~~q~a~wsP~g~~lafV~~nnly~~~~~~~~~~~~lT~dG~~-~i~nG~~DWvYeEEf   79 (79)
                      .++++..+++.+.......+|+++|||+|++||||++||||+.+... +..+|||++|.+ .|+||++||+||||+
T Consensus        97 d~~~~~~~~l~~~~~~~~~l~~~~wSPDG~~iafv~~~nl~~~~~~~-~~~~~lt~~g~~~~i~nG~~d~vyeee~  171 (465)
T d1xfda1          97 KIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVG-KQAIRVVSTGKEGVIYNGLSDWLYEEEI  171 (465)
T ss_dssp             ESSSCCCEECCCTTCCSCCCSBCCBCSSTTCEEEEETTEEEEESSSS-SCCEEEECCCBTTTEEEEECCHHHHHTT
T ss_pred             EccCCceeeccCccCCccccceeeeccCCceEEEEecceEEEEecCC-CceEEEecccCcceeeccccchhhhhhh
Confidence            57788888888777778889999999999999999999999998654 568999999987 899999999999995
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure