Psyllid ID: psy14268

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MFIPTYALHHDPEIYPNPYVFDPERFRVPRCSYPHTHYIMILKSILIHTFLIQRDLPLRMRAIYPTMLTYRSEKDHEIALMERFAPENADNIPNYAYLPFGEGPRNCI
cEEEEEccccccccccccccccccccccccccccccEEEEEcEEEEEEEEEEccccccccEEEEEEEccccccccccccccccccHHHHcccccccEEcccccccccc
cccEEEEEccccccccccccccHHHccHHHHcccccHHHHHHHEEEHHHHcccccccccccEEEEEEEEcccccccccccHHHccHHHHcccccEEEEcccccccccc
mfiptyalhhdpeiypnpyvfdperfrvprcsyphthYIMILKSILIHTFLIQRDLPLRMRAIYPTMLTYRSEKDHEIALMErfapenadnipnyaylpfgegprnci
mfiptyalhhdpeiypnpyVFDPERFRVPRCSYPHTHYIMILKSILIHTFLIQRDLPLRMRAIYPTMLTYRSEKDHEIALMERfapenadnipnyaylpfgegprnci
MFIPTYALHHDPEIYPNPYVFDPERFRVPRCSYPHTHYIMILKSILIHTFLIQRDLPLRMRAIYPTMLTYRSEKDHEIALMERFAPENADNIPNYAYLPFGEGPRNCI
**IPTYALHHDPEIYPNPYVFDPERFRVPRCSYPHTHYIMILKSILIHTFLIQRDLPLRMRAIYPTMLTYRSEKDHEIALMERFAPENADNIPNYAYLPF********
MFIPTYALHHDPEIYPNPYVFDPERFRVPRCSYPHTHYIMILKSILIHTFLIQRDLPLRMRAIYPTMLTYRSEKDHEIALMERFAPENADNIPNYAYLPFGEGPRNCI
MFIPTYALHHDPEIYPNPYVFDPERFRVPRCSYPHTHYIMILKSILIHTFLIQRDLPLRMRAIYPTMLTYRSEKDHEIALMERFAPENADNIPNYAYLPFGEGPRNCI
MFIPTYALHHDPEIYPNPYVFDPERFRVPRCSYPHTHYIMILKSILIHTFLIQRDLPLRMRAIYPTMLTYRSEKDHEIALMERFAPENADNIPNYAYLPFGEGPRNCI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFIPTYALHHDPEIYPNPYVFDPERFRVPRCSYPHTHYIMILKSILIHTFLIQRDLPLRMRAIYPTMLTYRSEKDHEIALMERFAPENADNIPNYAYLPFGEGPRNCI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query108 2.2.26 [Sep-21-2011]
Q964R1501 Cytochrome P450 6j1 OS=Bl N/A N/A 0.462 0.099 0.314 3e-07
Q9V4U9493 Probable cytochrome P450 yes N/A 0.462 0.101 0.287 3e-06
Q964T2533 Cytochrome P450 9e2 OS=Bl N/A N/A 0.25 0.050 0.703 3e-05
P33268503 Cytochrome P450 3A8 OS=Ma N/A N/A 0.462 0.099 0.296 3e-05
P13527509 Cytochrome P450 6A1 OS=Mu N/A N/A 0.240 0.051 0.653 5e-05
Q9VB31507 Probable cytochrome P450 no N/A 0.25 0.053 0.666 7e-05
P51538503 Cytochrome P450 3A9 OS=Ra yes N/A 0.25 0.053 0.703 9e-05
P24463503 Cytochrome P450 3A12 OS=C yes N/A 0.462 0.099 0.375 9e-05
Q9PVE8496 Cytochrome P450 3A30 OS=F N/A N/A 0.490 0.106 0.428 0.0001
Q8AXY5496 Cytochrome P450 3A56 OS=F N/A N/A 0.490 0.106 0.428 0.0001
>sp|Q964R1|CP6J1_BLAGE Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 Back     alignment and function desciption
 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 44/108 (40%), Gaps = 58/108 (53%)

Query: 1   MFIPTYALHHDPEIYPNPYVFDPERFRVPRCSYPHTHYIMILKSILIHTFLIQRDLPLRM 60
           ++IP YALHHD + +P+P  FDPERF                                  
Sbjct: 396 VYIPVYALHHDSKYFPSPAKFDPERF---------------------------------- 421

Query: 61  RAIYPTMLTYRSEKDHEIALMERFAPENADNIPNYAYLPFGEGPRNCI 108
                      SEK+ +             NIP++AY+PFGEGPRNCI
Sbjct: 422 -----------SEKNKQ-------------NIPHFAYMPFGEGPRNCI 445

Blattella germanica (taxid: 6973)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 Back     alignment and function description
>sp|Q964T2|CP9E2_BLAGE Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 Back     alignment and function description
>sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 Back     alignment and function description
>sp|P13527|CP6A1_MUSDO Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 Back     alignment and function description
>sp|Q9VB31|C6A18_DROME Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 Back     alignment and function description
>sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 Back     alignment and function description
>sp|P24463|CP3AC_CANFA Cytochrome P450 3A12 OS=Canis familiaris GN=CYP3A12 PE=2 SV=1 Back     alignment and function description
>sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 Back     alignment and function description
>sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query108
322799570 424 hypothetical protein SINV_07302 [Solenop 0.935 0.238 0.362 7e-07
2323337 515 cytochrome P450 30 [Mercenaria mercenari 0.25 0.052 0.777 1e-05
47605529 501 RecName: Full=Cytochrome P450 6j1; AltNa 0.462 0.099 0.314 1e-05
408724227 500 cytochrome P450 CYP6FK1, partial [Laodel 0.462 0.1 0.314 4e-05
170072409 344 cytochrome P450 71A1 [Culex quinquefasci 0.333 0.104 0.555 6e-05
403183461 961 AAEL017061-PA [Aedes aegypti] 0.370 0.041 0.475 7e-05
195474747 493 GE19209 [Drosophila yakuba] gi|194175752 0.462 0.101 0.287 7e-05
312379839 1051 hypothetical protein AND_08194 [Anophele 0.240 0.024 0.769 7e-05
119067596 512 CYP6AB7 [Depressaria pastinacella] 0.25 0.052 0.740 8e-05
241659423 500 cytochrome P450 [Cnaphalocrocis medinali 0.194 0.042 0.740 8e-05
>gi|322799570|gb|EFZ20864.1| hypothetical protein SINV_07302 [Solenopsis invicta] Back     alignment and taxonomy information
 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 55/127 (43%), Gaps = 26/127 (20%)

Query: 1   MFIPTYALHHDPEIYPNPYVFDPERFR-------VPRCSYP---------HTHYIMILKS 44
           +  P YALHHDP+ +PNP  FDPERF        VP    P            + ++   
Sbjct: 285 VLFPVYALHHDPKYFPNPNKFDPERFNDENKDSIVPYTYLPFGLGPRMCVGNRFALMETK 344

Query: 45  ILIHTFLIQRDLPLRMRAIYPTMLTYRSEK---DHEIALMERFAPENADNIPNYAYLPFG 101
           ILI          L+   I P    +R  K   +      ERF  EN DNI    YLPFG
Sbjct: 345 ILIAQL-------LQNHVILPVFALHRDPKYFPNPNKFDPERFNNENKDNILPCTYLPFG 397

Query: 102 EGPRNCI 108
            GPR CI
Sbjct: 398 FGPRMCI 404

Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|2323337|gb|AAB66556.1| cytochrome P450 30 [Mercenaria mercenaria] Back     alignment and taxonomy information
>gi|47605529|sp|Q964R1.1|CP6J1_BLAGE RecName: Full=Cytochrome P450 6j1; AltName: Full=CYPVIJ1 gi|14268816|gb|AAK57913.1|AF281325_1 cytochrome P450 CYP6J1 [Blattella germanica] Back     alignment and taxonomy information
>gi|408724227|gb|AFU86431.1| cytochrome P450 CYP6FK1, partial [Laodelphax striatella] Back     alignment and taxonomy information
>gi|170072409|ref|XP_001870173.1| cytochrome P450 71A1 [Culex quinquefasciatus] gi|167868669|gb|EDS32052.1| cytochrome P450 71A1 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|403183461|gb|EJY58114.1| AAEL017061-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|195474747|ref|XP_002089651.1| GE19209 [Drosophila yakuba] gi|194175752|gb|EDW89363.1| GE19209 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|312379839|gb|EFR25999.1| hypothetical protein AND_08194 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|119067596|gb|ABL60877.1| CYP6AB7 [Depressaria pastinacella] Back     alignment and taxonomy information
>gi|241659423|emb|CAZ65618.1| cytochrome P450 [Cnaphalocrocis medinalis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query108
RGD|708379504 Cyp3a2 "cytochrome P450, famil 0.25 0.053 0.666 1.3e-12
UNIPROTKB|P05183504 Cyp3a2 "Cytochrome P450 3A2" [ 0.25 0.053 0.666 1.3e-12
UNIPROTKB|F1NT18508 CYP3A7 "Uncharacterized protei 0.25 0.053 0.740 1.9e-12
FB|FBgn0025454524 Cyp6g1 "Cyp6g1" [Drosophila me 0.240 0.049 0.692 2.2e-12
FB|FBgn0039519507 Cyp6a18 "Cyp6a18" [Drosophila 0.25 0.053 0.666 2.6e-12
MGI|MGI:106099504 Cyp3a16 "cytochrome P450, fami 0.25 0.053 0.666 5.3e-12
RGD|708392503 Cyp3a9 "cytochrome P450, famil 0.25 0.053 0.703 6.4e-12
UNIPROTKB|Q5PQX2503 Cyp3a9 "RCG55954" [Rattus norv 0.25 0.053 0.703 6.4e-12
FB|FBgn0033304493 Cyp6a13 "Cyp6a13" [Drosophila 0.240 0.052 0.576 1e-11
RGD|1595705502 Cyp3a73 "cytochrome P450, fami 0.25 0.053 0.666 2.2e-11
RGD|708379 Cyp3a2 "cytochrome P450, family 3, subfamily a, polypeptide 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 101 (40.6 bits), Expect = 1.3e-12, Sum P(2) = 1.3e-12
 Identities = 18/27 (66%), Positives = 20/27 (74%)

Query:    82 ERFAPENADNIPNYAYLPFGEGPRNCI 108
             ERF+ EN  +I  Y YLPFG GPRNCI
Sbjct:   418 ERFSKENKGSIDPYVYLPFGNGPRNCI 444
GO:0004497 "monooxygenase activity" evidence=ISO;IDA
GO:0005496 "steroid binding" evidence=ISO
GO:0005506 "iron ion binding" evidence=IEA;ISO
GO:0005737 "cytoplasm" evidence=ISO
GO:0005789 "endoplasmic reticulum membrane" evidence=IEA
GO:0006706 "steroid catabolic process" evidence=ISO
GO:0008202 "steroid metabolic process" evidence=ISO
GO:0008395 "steroid hydroxylase activity" evidence=ISO
GO:0009055 "electron carrier activity" evidence=IEA
GO:0009822 "alkaloid catabolic process" evidence=ISO
GO:0009986 "cell surface" evidence=ISO
GO:0016098 "monoterpenoid metabolic process" evidence=ISO
GO:0016491 "oxidoreductase activity" evidence=ISO
GO:0016712 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen" evidence=IEA
GO:0017144 "drug metabolic process" evidence=ISO;IDA
GO:0019899 "enzyme binding" evidence=ISO
GO:0020037 "heme binding" evidence=IEA
GO:0030343 "vitamin D3 25-hydroxylase activity" evidence=ISO
GO:0032451 "demethylase activity" evidence=IDA
GO:0034875 "caffeine oxidase activity" evidence=ISO
GO:0042737 "drug catabolic process" evidence=ISO
GO:0042738 "exogenous drug catabolic process" evidence=ISO
GO:0046483 "heterocycle metabolic process" evidence=ISO
GO:0050649 "testosterone 6-beta-hydroxylase activity" evidence=ISO;IMP
GO:0055114 "oxidation-reduction process" evidence=ISO
GO:0070330 "aromatase activity" evidence=IEA
GO:0070576 "vitamin D 24-hydroxylase activity" evidence=ISO
GO:0070989 "oxidative demethylation" evidence=ISO;IDA
UNIPROTKB|P05183 Cyp3a2 "Cytochrome P450 3A2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NT18 CYP3A7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0025454 Cyp6g1 "Cyp6g1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039519 Cyp6a18 "Cyp6a18" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:106099 Cyp3a16 "cytochrome P450, family 3, subfamily a, polypeptide 16" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|708392 Cyp3a9 "cytochrome P450, family 3, subfamily a, polypeptide 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5PQX2 Cyp3a9 "RCG55954" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0033304 Cyp6a13 "Cyp6a13" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|1595705 Cyp3a73 "cytochrome P450, family 3, subfamily a, polypeptide 73" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query108
pfam00067461 pfam00067, p450, Cytochrome P450 3e-07
pfam00067461 pfam00067, p450, Cytochrome P450 9e-07
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 5e-04
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 0.001
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 0.001
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information 
 Score = 46.5 bits (111), Expect = 3e-07
 Identities = 16/26 (61%), Positives = 20/26 (76%)

Query: 1   MFIPTYALHHDPEIYPNPYVFDPERF 26
           + +  YALH DPE++PNP  FDPERF
Sbjct: 362 VIVNLYALHRDPEVFPNPEEFDPERF 387

Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 108
KOG0158|consensus499 99.65
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.44
PLN02394503 trans-cinnamate 4-monooxygenase 99.43
PLN02183516 ferulate 5-hydroxylase 99.42
PLN02971543 tryptophan N-hydroxylase 99.42
PLN02500490 cytochrome P450 90B1 99.42
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 99.4
PLN03195516 fatty acid omega-hydroxylase; Provisional 99.39
PLN03234499 cytochrome P450 83B1; Provisional 99.39
KOG0157|consensus497 99.39
PTZ00404482 cytochrome P450; Provisional 99.37
PLN00168519 Cytochrome P450; Provisional 99.36
PLN02966502 cytochrome P450 83A1 99.36
PLN02738633 carotene beta-ring hydroxylase 99.34
KOG0156|consensus489 99.34
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.34
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.33
PLN02936489 epsilon-ring hydroxylase 99.3
PLN02687517 flavonoid 3'-monooxygenase 99.3
PLN02426502 cytochrome P450, family 94, subfamily C protein 99.29
PLN02290516 cytokinin trans-hydroxylase 99.29
PLN03018534 homomethionine N-hydroxylase 99.28
PLN02655466 ent-kaurene oxidase 99.28
PLN02774463 brassinosteroid-6-oxidase 99.26
PLN03112514 cytochrome P450 family protein; Provisional 99.26
PLN02302490 ent-kaurenoic acid oxidase 99.25
PLN02196463 abscisic acid 8'-hydroxylase 99.24
PLN02987472 Cytochrome P450, family 90, subfamily A 99.15
KOG0159|consensus519 99.11
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 98.98
KOG0684|consensus486 98.85
PLN02648480 allene oxide synthase 98.72
>KOG0158|consensus Back     alignment and domain information 
Probab=99.65  E-value=4.8e-17  Score=133.31  Aligned_cols=28  Identities=64%  Similarity=1.229  Sum_probs=26.3

Q ss_pred             CcccccccccCCCCCCCCCCCCCCCCCC
Q psy14268          1 MFIPTYALHHDPEIYPNPYVFDPERFRV   28 (108)
Q Consensus         1 V~v~~~~~h~dp~~w~~p~~F~PeRwl~   28 (108)
                      |+|+++++||||++|+||++|+||||+.
T Consensus       395 V~Ip~~alH~Dp~~~p~Pe~F~PERF~~  422 (499)
T KOG0158|consen  395 VMIPTYALHHDPEYWPEPEKFKPERFEE  422 (499)
T ss_pred             EEeecccccCCcccCCCcccCCCccCCC
Confidence            6799999999999999999999999964

>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>KOG0156|consensus Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query108
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 1e-05
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 1e-05
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 1e-05
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure 
Iteration: 1

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/27 (66%), Positives = 20/27 (74%)
Query: 82  ERFAPENADNIPNYAYLPFGEGPRNCI 108
           ERF+ +N DNI  Y Y PFG GPRNCI
Sbjct: 395 ERFSKKNKDNIDPYIYTPFGSGPRNCI 421
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query108
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 3e-12
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 4e-12
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 2e-10
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 5e-07
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 2e-10
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 2e-04
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 1e-09
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 1e-09
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 2e-08
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 2e-09
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 2e-08
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 3e-09
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 6e-09
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 1e-04
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 4e-08
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 5e-08
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 5e-08
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 6e-06
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 8e-08
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 2e-06
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 1e-07
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 1e-07
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 1e-07
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 2e-07
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 2e-07
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 4e-06
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 2e-07
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 3e-07
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 7e-07
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 2e-05
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 8e-07
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 8e-06
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 1e-06
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 2e-05
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 4e-05
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 4e-05
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 5e-05
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 5e-05
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 5e-05
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 6e-05
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 7e-05
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 9e-05
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 9e-05
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
 Score = 60.3 bits (147), Expect = 3e-12
 Identities = 18/27 (66%), Positives = 20/27 (74%)

Query: 82  ERFAPENADNIPNYAYLPFGEGPRNCI 108
           ERF+ +N DNI  Y Y PFG GPRNCI
Sbjct: 395 ERFSKKNKDNIDPYIYTPFGSGPRNCI 421
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query108
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.51
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.44
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.41
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.39
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 99.39
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.39
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.39
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.38
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.37
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.37
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.37
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 99.37
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.36
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.36
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.36
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.36
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.35
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.35
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.34
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 99.31
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.3
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.28
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.28
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.28
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.25
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.23
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.23
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.23
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.22
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.22
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.22
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.22
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.22
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.21
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.21
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.2
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.2
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.19
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.19
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.19
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.19
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.18
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.18
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.18
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.18
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.18
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.18
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.17
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.17
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.16
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.16
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.15
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.15
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.15
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.15
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.15
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.15
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.13
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.13
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.12
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.11
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.11
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.11
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.1
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.1
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.1
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.09
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.09
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.07
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.07
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.04
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.04
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.03
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.01
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.0
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 98.9
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 98.58
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=99.51  E-value=2.8e-15  Score=115.67  Aligned_cols=28  Identities=21%  Similarity=0.527  Sum_probs=26.1

Q ss_pred             CcccccccccCCCCCCCCCCCCCCCCCC
Q psy14268          1 MFIPTYALHHDPEIYPNPYVFDPERFRV   28 (108)
Q Consensus         1 V~v~~~~~h~dp~~w~~p~~F~PeRwl~   28 (108)
                      |+++++++||||++|+||++|+|||||.
T Consensus       373 V~~~~~~~h~d~~~~~dP~~F~PeRfl~  400 (479)
T 3tbg_A          373 LITNLSSVLKDEAVWEKPFRFHPEHFLD  400 (479)
T ss_dssp             EEEEHHHHHTCTTTSSSTTSCCGGGGBC
T ss_pred             eeechhhhcCChhhCCCccccCccccCC
Confidence            5688999999999999999999999985
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 108
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 2e-05
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 1e-04
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 3e-05
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 7e-04
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 7e-05
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 5e-04
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 8e-05
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 2e-04
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 0.002
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 0.004
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 0.004
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2b4
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score = 39.3 bits (90), Expect = 2e-05
 Identities = 8/27 (29%), Positives = 11/27 (40%)

Query: 82  ERFAPENADNIPNYAYLPFGEGPRNCI 108
             F   N     N  ++PF  G R C+
Sbjct: 384 GHFLDANGALKRNEGFMPFSLGKRICL 410
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query108
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.44
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.42
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.4
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.4
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.39
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.37
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.35
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.31
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.31
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.27
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.25
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.25
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.24
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.22
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.22
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.19
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.16
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.15
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.04
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.01
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 98.89
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.44  E-value=9.8e-15  Score=108.31  Aligned_cols=28  Identities=36%  Similarity=0.714  Sum_probs=26.0

Q ss_pred             CcccccccccCCCCCCCCCCCCCCCCCC
Q psy14268          1 MFIPTYALHHDPEIYPNPYVFDPERFRV   28 (108)
Q Consensus         1 V~v~~~~~h~dp~~w~~p~~F~PeRwl~   28 (108)
                      |+++.+++|+|+++|+||++|+|||||.
T Consensus       361 v~~~~~~~~~d~~~~~dp~~F~PeRfl~  388 (463)
T d3czha1         361 VITNLYSVHFDEKYWRDPEVFHPERFLD  388 (463)
T ss_dssp             EEEEHHHHHTCTTTCSSTTSCCGGGGBC
T ss_pred             ccCcHHHhhCCcccCCChhhcCccccCC
Confidence            5688999999999999999999999985
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure