Psyllid ID: psy14272


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190----
MASKTPNEDKEFNEQRPLAEVPSEFPFPFDAYDIQSNFMKNLYYTLDNSKFGIFESPTGTGKSLSLICGILKWYYDHKIVGLEKIEAKIKDLEISKNETVSEDWIEQQSFELKMRNQIDALKDALKSQKTYDELIENIRKQNEKRKKSLRNDQEVKVHALTYRNRMDEKNSKEKRKEEERDGLENETQELDESR
ccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHcccccHHHHHHHHHccccHHHHHHHHcc
ccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcHHHcccccccccccccccccHHHHccccHHHHHHHccc
masktpnedkefneqrplaevpsefpfpfdaydiQSNFMKNLYYtldnskfgifesptgtgksLSLICGILKWYYDHKIVGLEKIEAKIKDLeisknetvseDWIEQQSFELKMRNQIDALKDALKSQKTYDELIENIRKQNEKRKKSLRNDQEVKVHALTYRnrmdeknskeKRKEEERDGLENETQELDESR
masktpnedkefneqrplaevpsefPFPFDAYDIQSNFMKNLYYTLDNSKFGIFESPTGTGKSLSLICGILKWYYDHKIVGLEKIEAKIKdleisknetvsedWIEQQSFELKMRNQIDALKDALKSQKTYDELIENIRKqnekrkkslrndqevkvhaltyrnrmdeknskekrkeeerdglenetqeldesr
MASKTPNEDKEFNEQRPLAEVPSEFPFPFDAYDIQSNFMKNLYYTLDNSKFGIFESPTGTGKSLSLICGILKWYYDHKIVGLEKIEAKIKDLEISKNETVSEDWIEQQSFELKMRNQIDALKDALKSQKTYDELIENIRKQNEKRKKSLRNDQEVKVHALTYRNRMDeknskekrkeeerDGLENETQELDESR
************************FPFPFDAYDIQSNFMKNLYYTLDNSKFGIFESPTGTGKSLSLICGILKWYYDHKIVGLEKIEAKIKDLEISKNETVSEDWIEQQSFEL**********************************************************************************
*******************EVPSEFPFPFDAYDIQSNFMKNLYYTLDNSKFGIFESPTGTGKSLSLICGILKWYYDH*******************************************LKDALK********************************************************************
*****************LAEVPSEFPFPFDAYDIQSNFMKNLYYTLDNSKFGIFESPTGTGKSLSLICGILKWYYDHKIVGLEKIEAKIKDLEISKNETVSEDWIEQQSFELKMRNQIDALKDALKSQKTYDELIENIRKQN*********DQEVKVHALTYRNRM****************************
**********************SEFPFPFDAYDIQSNFMKNLYYTLDNSKFGIFESPTGTGKSLSLICGILKWYYDHKIVGLEKIEAKIK*********VSEDWIEQQSFELKMRNQIDALKDALKSQKTYDELIENIRKQNEKRK*********K***L**********************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASKTPNEDKEFNEQRPLAEVPSEFPFPFDAYDIQSNFMKNLYYTLDNSKFGIFESPTGTGKSLSLICGILKWYYDHKIVGxxxxxxxxxxxxxxxxxxxxxDWIEQQSFELKMRNQIDALKDxxxxxxxxxxxxxxxxxxxxxxxxxxxxDQEVKVHALTYRNRxxxxxxxxxxxxxxxxxxxxxxxxxxxxR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query194 2.2.26 [Sep-21-2011]
O14147 844 ATP-dependent RNA helicas yes N/A 0.608 0.139 0.406 7e-17
A8MPP1 907 Putative ATP-dependent RN yes N/A 0.824 0.176 0.333 4e-16
Q1E5T3 861 ATP-dependent RNA helicas N/A N/A 0.319 0.072 0.619 2e-15
Q96FC9 970 Probable ATP-dependent RN yes N/A 0.690 0.138 0.333 1e-14
A1D8E4 861 ATP-dependent RNA helicas N/A N/A 0.293 0.066 0.561 5e-14
A2QY22 874 ATP-dependent RNA helicas yes N/A 0.283 0.062 0.581 7e-14
A5DUW8 892 ATP-dependent RNA helicas N/A N/A 0.319 0.069 0.523 3e-12
Q6CAX3 803 ATP-dependent RNA helicas yes N/A 0.412 0.099 0.415 3e-12
A7ERG1 902 ATP-dependent RNA helicas N/A N/A 0.283 0.060 0.563 5e-12
Q6CIF0 807 ATP-dependent RNA helicas yes N/A 0.319 0.076 0.5 1e-11
>sp|O14147|CHL1_SCHPO ATP-dependent RNA helicase chl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chl1 PE=3 SV=1 Back     alignment and function desciption
 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 54/133 (40%), Positives = 79/133 (59%), Gaps = 15/133 (11%)

Query: 23  SEFPFPFDAYDIQSNFMKNLYYTLDNSKFGIFESPTGTGKSLSLICGILKWYYDHKIVGL 82
           + F  P+  YDIQ  FM++LY ++ + K GIFESPTGTGKSLSLIC  L W  +H  V L
Sbjct: 11  TNFHHPYTPYDIQLEFMRSLYSSISDGKIGIFESPTGTGKSLSLICASLTWLDEHGGVLL 70

Query: 83  EKIEAKIKDLEISKNETVSE--DWIEQQSFELKMRNQIDALKDALK-SQKTYDELIENIR 139
           E  E K  D   +K+ T S+  DW+ +Q  +++        KD +K +    ++ +E IR
Sbjct: 71  EDNE-KSND---NKSNTSSKIPDWVLEQDLKIQ--------KDLVKETHARLEQRLEEIR 118

Query: 140 KQNEKRKKSLRND 152
           K+N+ RK  + N+
Sbjct: 119 KRNQSRKNQMSNN 131




Important for chromosome transmission and normal cell cycle progression in G(2)/M. May have a role in changing DNA topology to allow the loading of proteins involved in maintaining sister chromatid cohesion in the vicinity of the centromeres. Has a specific role in chromosome segregation during meiosis II.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|A8MPP1|D11L8_HUMAN Putative ATP-dependent RNA helicase DDX11-like protein 8 OS=Homo sapiens GN=DDX11L8 PE=3 SV=1 Back     alignment and function description
>sp|Q1E5T3|CHL1_COCIM ATP-dependent RNA helicase CHL1 OS=Coccidioides immitis (strain RS) GN=CHL1 PE=3 SV=1 Back     alignment and function description
>sp|Q96FC9|DDX11_HUMAN Probable ATP-dependent RNA helicase DDX11 OS=Homo sapiens GN=DDX11 PE=1 SV=1 Back     alignment and function description
>sp|A1D8E4|CHL1_NEOFI ATP-dependent RNA helicase chl1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=chl1 PE=3 SV=1 Back     alignment and function description
>sp|A2QY22|CHL1_ASPNC ATP-dependent RNA helicase chl1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=chl1 PE=3 SV=1 Back     alignment and function description
>sp|A5DUW8|CHL1_LODEL ATP-dependent RNA helicase CHL1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=CHL1 PE=3 SV=1 Back     alignment and function description
>sp|Q6CAX3|CHL1_YARLI ATP-dependent RNA helicase CHL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CHL1 PE=3 SV=1 Back     alignment and function description
>sp|A7ERG1|CHL1_SCLS1 ATP-dependent RNA helicase CHL1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=CHL1 PE=3 SV=1 Back     alignment and function description
>sp|Q6CIF0|CHL1_KLULA ATP-dependent RNA helicase CHL1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CHL1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query194
91081131 861 PREDICTED: similar to regulator of telom 0.618 0.139 0.450 8e-23
270006445 817 DEAD/H (Asp-Glu-Ala-Asp/His) box polypep 0.618 0.146 0.450 9e-23
307191862 862 Probable ATP-dependent RNA helicase DDX1 0.798 0.179 0.401 8e-21
332029639 857 Putative ATP-dependent RNA helicase DDX1 0.747 0.169 0.389 2e-20
383850034 861 PREDICTED: putative ATP-dependent RNA he 0.804 0.181 0.369 3e-20
242025010 852 conserved hypothetical protein [Pediculu 0.597 0.136 0.461 1e-19
340378232 886 PREDICTED: putative ATP-dependent RNA he 0.690 0.151 0.383 4e-19
193608349 890 PREDICTED: probable ATP-dependent RNA he 0.680 0.148 0.367 8e-19
443709796 875 hypothetical protein CAPTEDRAFT_175213 [ 0.448 0.099 0.489 1e-17
198436769 907 PREDICTED: similar to DEAD/H (Asp-Glu-Al 0.422 0.090 0.505 7e-17
>gi|91081131|ref|XP_975541.1| PREDICTED: similar to regulator of telomere elongation helicase 1 rtel1 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  112 bits (280), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 80/122 (65%), Gaps = 2/122 (1%)

Query: 20  EVPSEFPFPFDAYDIQSNFMKNLYYTLDNSKFGIFESPTGTGKSLSLICGILKWYYDHKI 79
           EVP+ F FPF  Y IQ  FM+NL+  ++N KFGIFESPTGTGKSLS++CG ++W  DH +
Sbjct: 2   EVPNNFEFPFQPYPIQHAFMRNLFEVIENKKFGIFESPTGTGKSLSILCGAIRWLKDHNM 61

Query: 80  VGLEKIEAKIKDLEISKNETV--SEDWIEQQSFELKMRNQIDALKDALKSQKTYDELIEN 137
              E ++ +I++LE+ K +    S DW+  Q+ E+ +  QI+ LK        YD+ IE+
Sbjct: 62  YERENLKLQIEELELKKRKVSGNSSDWLSAQAQEIDLNRQINELKIRQNKIDEYDKKIES 121

Query: 138 IR 139
           +R
Sbjct: 122 LR 123




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270006445|gb|EFA02893.1| DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307191862|gb|EFN75286.1| Probable ATP-dependent RNA helicase DDX11 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332029639|gb|EGI69528.1| Putative ATP-dependent RNA helicase DDX11-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383850034|ref|XP_003700633.1| PREDICTED: putative ATP-dependent RNA helicase DDX11-like protein 8-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|242025010|ref|XP_002432919.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212518428|gb|EEB20181.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|340378232|ref|XP_003387632.1| PREDICTED: putative ATP-dependent RNA helicase DDX11-like protein 8-like [Amphimedon queenslandica] Back     alignment and taxonomy information
>gi|193608349|ref|XP_001949260.1| PREDICTED: probable ATP-dependent RNA helicase DDX11-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|443709796|gb|ELU04301.1| hypothetical protein CAPTEDRAFT_175213 [Capitella teleta] Back     alignment and taxonomy information
>gi|198436769|ref|XP_002122486.1| PREDICTED: similar to DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 [Ciona intestinalis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query194
POMBASE|SPAC3G6.11 844 chl1 "ATP-dependent DNA helica 0.685 0.157 0.401 3e-18
ZFIN|ZDB-GENE-041114-191 890 ddx11 "DEAD/H (Asp-Glu-Ala-Asp 0.701 0.152 0.386 3.3e-18
UNIPROTKB|F5GXL6192 DDX11 "Probable ATP-dependent 0.381 0.385 0.519 2.3e-17
UNIPROTKB|F5GYY1171 DDX11 "Probable ATP-dependent 0.381 0.432 0.519 2.3e-17
UNIPROTKB|E1BL06 913 E1BL06 "Uncharacterized protei 0.268 0.056 0.673 8.7e-17
UNIPROTKB|C9K0E8 302 DDX11 "Probable ATP-dependent 0.690 0.443 0.359 1.8e-15
FB|FBgn0026876 861 CG11403 [Drosophila melanogast 0.737 0.166 0.335 3.1e-15
UNIPROTKB|F5H235 297 DDX11 "Probable ATP-dependent 0.762 0.498 0.351 6.3e-15
UNIPROTKB|F1SK82210 F1SK82 "Uncharacterized protei 0.695 0.642 0.346 6.9e-15
UNIPROTKB|B4DMS8 304 DDX11 "Probable ATP-dependent 0.762 0.486 0.351 7.5e-15
POMBASE|SPAC3G6.11 chl1 "ATP-dependent DNA helicase Chl1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
 Score = 232 (86.7 bits), Expect = 3.0e-18, P = 3.0e-18
 Identities = 59/147 (40%), Positives = 86/147 (58%)

Query:    23 SEFPFPFDAYDIQSNFMKNLYYTLDNSKFGIFESPTGTGKSLSLICGILKWYYDHKIVGL 82
             + F  P+  YDIQ  FM++LY ++ + K GIFESPTGTGKSLSLIC  L W  +H  V L
Sbjct:    11 TNFHHPYTPYDIQLEFMRSLYSSISDGKIGIFESPTGTGKSLSLICASLTWLDEHGGVLL 70

Query:    83 EKIEAKIKDLEISKNETVSE--DWIEQQSFELKMRNQIDALKDALKSQKTYDELIENIRK 140
             E  E K  D   +K+ T S+  DW+ +Q  +LK+  Q D +K+   +    ++ +E IRK
Sbjct:    71 EDNE-KSND---NKSNTSSKIPDWVLEQ--DLKI--QKDLVKE---THARLEQRLEEIRK 119

Query:   141 QNEKRKKSLRNDQEVKVHALTYRNRMD 167
             +N+ RK  + N+     H  T R  ++
Sbjct:   120 RNQSRKNQMSNNSTT-YHRETKRRNIN 145




GO:0000790 "nuclear chromatin" evidence=IC
GO:0003677 "DNA binding" evidence=IEA
GO:0004003 "ATP-dependent DNA helicase activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISO;IDA
GO:0005829 "cytosol" evidence=IDA
GO:0006342 "chromatin silencing" evidence=NAS
GO:0007064 "mitotic sister chromatid cohesion" evidence=ISO
GO:0032508 "DNA duplex unwinding" evidence=IEA
GO:0045910 "negative regulation of DNA recombination" evidence=ISO
ZFIN|ZDB-GENE-041114-191 ddx11 "DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F5GXL6 DDX11 "Probable ATP-dependent RNA helicase DDX11" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5GYY1 DDX11 "Probable ATP-dependent RNA helicase DDX11" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BL06 E1BL06 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|C9K0E8 DDX11 "Probable ATP-dependent RNA helicase DDX11" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0026876 CG11403 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F5H235 DDX11 "Probable ATP-dependent RNA helicase DDX11" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SK82 F1SK82 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|B4DMS8 DDX11 "Probable ATP-dependent RNA helicase DDX11" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
smart00488 289 smart00488, DEXDc2, DEAD-like helicases superfamil 2e-21
COG1199 654 COG1199, DinG, Rad3-related DNA helicases [Transcr 5e-07
TIGR00604 705 TIGR00604, rad3, DNA repair helicase (rad3) 2e-06
>gnl|CDD|214693 smart00488, DEXDc2, DEAD-like helicases superfamily Back     alignment and domain information
 Score = 88.6 bits (220), Expect = 2e-21
 Identities = 52/174 (29%), Positives = 75/174 (43%), Gaps = 14/174 (8%)

Query: 24  EFPFPFDAYDIQSNFMKNLYYTLDNSKFGIFESPTGTGKSLSLICGILKWYYDHKIVGLE 83
            F FP++ Y IQ  FM+ L   LD  K GI ESPTGTGK+LSL+C  L W          
Sbjct: 2   LFYFPYEPYPIQYEFMEELKRVLDRGKIGILESPTGTGKTLSLLCLTLTWLRSFP----- 56

Query: 84  KIEAKIKDLEISKNETVSEDWIEQQSFELKMRNQIDALKDALKSQKTYDELIENIRKQNE 143
             E   K   I  + TVSE  IE++  EL+   Q    +   +S+K    L E  R++ +
Sbjct: 57  --ERIQKIKLIYLSRTVSE--IEKRLEELRKLMQKVEYESDEESEKQAQLLHELGREKPK 112

Query: 144 KRKKSLRNDQEVKVHALT-----YRNRMDEKNSKEKRKEEERDGLENETQELDE 192
               SL + + + ++            +DE        +  +   EN   E   
Sbjct: 113 VLGLSLTSRKNLCLNPEVRTLKQNGLVVDEVCRSLTASKARKYRYENPKVERCP 166


Length = 289

>gnl|CDD|224120 COG1199, DinG, Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233047 TIGR00604, rad3, DNA repair helicase (rad3) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 194
KOG1133|consensus 821 99.96
smart00488 289 DEXDc2 DEAD-like helicases superfamily. 99.74
smart00489 289 DEXDc3 DEAD-like helicases superfamily. 99.74
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 99.6
KOG1132|consensus 945 99.51
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 99.37
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 99.33
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.22
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 99.11
KOG1131|consensus 755 99.06
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 98.94
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.81
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 98.6
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 98.54
PF04851184 ResIII: Type III restriction enzyme, res subunit; 98.52
PTZ00424 401 helicase 45; Provisional 98.52
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 98.52
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 98.51
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 98.51
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 98.49
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 98.47
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 98.44
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 98.43
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 98.39
PTZ00110 545 helicase; Provisional 98.39
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 98.33
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 98.32
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 98.29
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 98.23
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 98.23
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 98.19
smart00487201 DEXDc DEAD-like helicases superfamily. 98.13
KOG0348|consensus 708 98.11
KOG0345|consensus 567 98.1
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 98.07
PRK13767 876 ATP-dependent helicase; Provisional 98.06
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 98.06
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 98.04
PRK01172 674 ski2-like helicase; Provisional 97.97
COG1201 814 Lhr Lhr-like helicases [General function predictio 97.94
PRK02362 737 ski2-like helicase; Provisional 97.92
COG1205 851 Distinct helicase family with a unique C-terminal 97.92
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 97.9
PRK00254 720 ski2-like helicase; Provisional 97.89
KOG0331|consensus 519 97.86
KOG0344|consensus 593 97.75
KOG0330|consensus 476 97.69
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 97.68
PRK10689 1147 transcription-repair coupling factor; Provisional 97.62
KOG0335|consensus 482 97.56
KOG0350|consensus 620 97.53
PRK09694 878 helicase Cas3; Provisional 97.51
PRK09401 1176 reverse gyrase; Reviewed 97.45
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 97.37
KOG0346|consensus 569 97.37
PRK14701 1638 reverse gyrase; Provisional 97.35
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 97.3
PRK05580 679 primosome assembly protein PriA; Validated 97.28
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 97.25
KOG0334|consensus 997 97.22
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 97.19
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 97.17
KOG0338|consensus 691 97.15
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 97.13
KOG0342|consensus 543 97.02
PHA02558 501 uvsW UvsW helicase; Provisional 97.0
TIGR03158 357 cas3_cyano CRISPR-associated helicase, Cyano-type. 96.93
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 96.92
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 96.91
PHA02653 675 RNA helicase NPH-II; Provisional 96.9
PRK13766 773 Hef nuclease; Provisional 96.86
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 96.86
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 96.85
KOG0354|consensus 746 96.82
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 96.79
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.78
COG1204 766 Superfamily II helicase [General function predicti 96.78
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 96.77
PRK09200 790 preprotein translocase subunit SecA; Reviewed 96.76
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 96.71
KOG0333|consensus 673 96.71
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 96.63
KOG0336|consensus 629 96.61
KOG0340|consensus 442 96.53
KOG0343|consensus 758 96.45
PRK08181269 transposase; Validated 96.42
PF1324576 AAA_19: Part of AAA domain 96.38
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 96.36
PRK10536262 hypothetical protein; Provisional 96.36
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 96.34
PRK12904 830 preprotein translocase subunit SecA; Reviewed 96.15
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 96.15
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.04
KOG0337|consensus 529 95.84
PRK13107 908 preprotein translocase subunit SecA; Reviewed 95.82
KOG0352|consensus 641 95.82
KOG0351|consensus 941 95.79
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 95.69
PRK06835329 DNA replication protein DnaC; Validated 95.69
KOG0327|consensus 397 95.68
PHA02244 383 ATPase-like protein 95.63
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 95.44
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 95.43
PRK13894319 conjugal transfer ATPase TrbB; Provisional 95.39
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 95.38
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 95.37
PRK15483 986 type III restriction-modification system StyLTI en 95.37
KOG0326|consensus 459 95.28
COG4096 875 HsdR Type I site-specific restriction-modification 95.26
KOG0347|consensus 731 95.21
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 95.12
PRK13833323 conjugal transfer protein TrbB; Provisional 95.04
PRK06526254 transposase; Provisional 95.01
KOG0952|consensus 1230 94.97
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 94.89
PRK13851344 type IV secretion system protein VirB11; Provision 94.88
KOG0328|consensus 400 94.83
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 94.8
PRK12402 337 replication factor C small subunit 2; Reviewed 94.77
PRK09183259 transposase/IS protein; Provisional 94.75
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 94.71
smart00382148 AAA ATPases associated with a variety of cellular 94.65
COG0714 329 MoxR-like ATPases [General function prediction onl 94.56
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 94.44
PF00580 315 UvrD-helicase: UvrD/REP helicase N-terminal domain 94.42
KOG0353|consensus 695 94.35
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 94.1
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 93.91
PRK13531 498 regulatory ATPase RavA; Provisional 93.88
PRK08939306 primosomal protein DnaI; Reviewed 93.82
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 93.81
COG1484254 DnaC DNA replication protein [DNA replication, rec 93.62
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 93.61
TIGR00376 637 DNA helicase, putative. The gene product may repre 93.57
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 93.56
PRK12326 764 preprotein translocase subunit SecA; Reviewed 93.55
KOG1803|consensus 649 93.52
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 93.4
PLN03025 319 replication factor C subunit; Provisional 93.28
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 93.25
KOG0989|consensus 346 93.13
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 93.03
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 92.94
TIGR02030 337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 92.9
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 92.9
TIGR02533486 type_II_gspE general secretory pathway protein E. 92.9
PRK10436462 hypothetical protein; Provisional 92.86
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 92.83
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 92.79
COG4889 1518 Predicted helicase [General function prediction on 92.75
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 92.68
PRK00440 319 rfc replication factor C small subunit; Reviewed 92.6
CHL00081 350 chlI Mg-protoporyphyrin IX chelatase 92.55
PRK08116268 hypothetical protein; Validated 92.54
KOG0339|consensus 731 92.49
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 92.49
PRK07952244 DNA replication protein DnaC; Validated 92.44
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 92.23
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 92.22
TIGR02538 564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 92.22
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 92.19
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 92.17
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 92.11
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 91.99
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 91.92
PRK12377248 putative replication protein; Provisional 91.81
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 91.78
KOG0341|consensus 610 91.69
PF13476202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 91.67
TIGR00595 505 priA primosomal protein N'. All proteins in this f 91.61
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 91.51
PF02534 469 T4SS-DNA_transf: Type IV secretory system Conjugat 91.38
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 91.34
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 91.33
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 91.26
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 91.22
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 91.2
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 91.18
KOG0947|consensus 1248 90.92
PRK13765 637 ATP-dependent protease Lon; Provisional 90.76
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 90.73
PF12846 304 AAA_10: AAA-like domain 90.63
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 90.57
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 90.46
cd01124187 KaiC KaiC is a circadian clock protein primarily f 90.36
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 90.21
PRK13764 602 ATPase; Provisional 90.2
cd01126 384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 90.13
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 90.1
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 90.1
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 90.03
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 89.87
TIGR00750 300 lao LAO/AO transport system ATPase. Mutations have 89.86
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 89.79
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 89.65
PRK08769 319 DNA polymerase III subunit delta'; Validated 89.59
PF05970 364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 89.57
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 89.52
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 89.45
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 89.39
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 89.33
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 89.32
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 89.31
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 89.2
TIGR02688449 conserved hypothetical protein TIGR02688. Members 89.18
KOG0991|consensus 333 89.15
PRK00411 394 cdc6 cell division control protein 6; Reviewed 89.12
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 89.11
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 89.11
PF1355562 AAA_29: P-loop containing region of AAA domain 89.1
KOG0349|consensus 725 89.08
PRK08903227 DnaA regulatory inactivator Hda; Validated 89.07
PRK06921266 hypothetical protein; Provisional 88.85
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 88.76
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 88.73
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 88.64
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 88.6
CHL00122 870 secA preprotein translocase subunit SecA; Validate 88.57
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 88.56
KOG0922|consensus 674 88.45
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 88.35
cd01376319 KISc_KID_like Kinesin motor domain, KIF22/Kid-like 88.28
KOG4284|consensus 980 88.21
PRK08727233 hypothetical protein; Validated 88.14
PF00004132 AAA: ATPase family associated with various cellula 88.11
TIGR01650 327 PD_CobS cobaltochelatase, CobS subunit. This model 88.04
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 87.98
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 87.96
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 87.92
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 87.87
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 87.85
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 87.83
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 87.71
PRK13342 413 recombination factor protein RarA; Reviewed 87.7
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 87.69
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 87.65
PHA00729226 NTP-binding motif containing protein 87.62
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 87.56
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 87.54
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 87.49
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 87.46
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 87.39
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 87.37
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 87.34
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 87.29
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 87.24
PRK00300205 gmk guanylate kinase; Provisional 87.22
COG0470 325 HolB ATPase involved in DNA replication [DNA repli 87.18
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 87.13
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 87.12
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 87.12
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 87.06
PRK08084235 DNA replication initiation factor; Provisional 87.02
PF10236 309 DAP3: Mitochondrial ribosomal death-associated pro 87.01
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 86.97
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 86.96
TIGR02759 566 TraD_Ftype type IV conjugative transfer system cou 86.9
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 86.84
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 86.75
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 86.73
PRK13850 670 type IV secretion system protein VirD4; Provisiona 86.73
PRK10865 857 protein disaggregation chaperone; Provisional 86.46
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 86.41
PF05729166 NACHT: NACHT domain 86.27
PRK13897 606 type IV secretion system component VirD4; Provisio 86.27
cd01127 410 TrwB Bacterial conjugation protein TrwB, ATP bindi 86.15
PF00176 299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 86.15
TIGR02768 744 TraA_Ti Ti-type conjugative transfer relaxase TraA 86.08
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 86.06
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 85.97
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 85.97
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 85.86
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 85.81
COG0606 490 Predicted ATPase with chaperone activity [Posttran 85.79
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 85.28
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 85.27
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 85.27
PRK13876 663 conjugal transfer coupling protein TraG; Provision 85.26
PRK05541176 adenylylsulfate kinase; Provisional 85.13
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 85.11
KOG1808|consensus 1856 85.08
PRK04296190 thymidine kinase; Provisional 85.07
cd01373 337 KISc_KLP2_like Kinesin motor domain, KLP2-like sub 85.01
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 85.0
PRK14729 300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 84.89
CHL00181287 cbbX CbbX; Provisional 84.83
PRK05298 652 excinuclease ABC subunit B; Provisional 84.79
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 84.72
PRK00698205 tmk thymidylate kinase; Validated 84.62
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 84.61
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 84.38
PRK13880 636 conjugal transfer coupling protein TraG; Provision 84.31
CHL00095 821 clpC Clp protease ATP binding subunit 84.28
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 84.2
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 84.16
KOG0332|consensus 477 84.09
PRK04195 482 replication factor C large subunit; Provisional 84.06
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 84.06
PRK10869 553 recombination and repair protein; Provisional 83.98
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 83.95
KOG0744|consensus 423 83.92
cd03241 276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 83.83
PRK09112 351 DNA polymerase III subunit delta'; Validated 83.79
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 83.77
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 83.74
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 83.69
TIGR02767 623 TraG-Ti Ti-type conjugative transfer system protie 83.68
cd01366 329 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ 83.58
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 83.51
PF13173128 AAA_14: AAA domain 83.51
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 83.48
PHA02544 316 44 clamp loader, small subunit; Provisional 83.46
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 83.45
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 83.43
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 83.37
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 83.25
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 83.21
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 83.21
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 83.17
COG1198 730 PriA Primosomal protein N' (replication factor Y) 83.15
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 83.11
cd01375 334 KISc_KIF9_like Kinesin motor domain, KIF9-like sub 83.11
cd03115173 SRP The signal recognition particle (SRP) mediates 82.95
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 82.87
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 82.76
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 82.72
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 82.65
KOG0390|consensus 776 82.64
KOG0743|consensus457 82.63
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 82.61
PTZ00112 1164 origin recognition complex 1 protein; Provisional 82.57
PRK14974336 cell division protein FtsY; Provisional 82.53
KOG1802|consensus 935 82.48
PRK10875 615 recD exonuclease V subunit alpha; Provisional 82.3
PRK06871 325 DNA polymerase III subunit delta'; Validated 82.26
COG5008 375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 82.26
PRK13822 641 conjugal transfer coupling protein TraG; Provision 82.0
TIGR00634 563 recN DNA repair protein RecN. All proteins in this 81.94
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 81.93
cd01374 321 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like 81.92
TIGR01817 534 nifA Nif-specific regulatory protein. This model r 81.89
PLN03188 1320 kinesin-12 family protein; Provisional 81.78
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 81.76
PRK06090 319 DNA polymerase III subunit delta'; Validated 81.64
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 81.63
KOG0923|consensus 902 81.53
KOG0239|consensus 670 81.5
KOG0948|consensus 1041 81.43
cd01367322 KISc_KIF2_like Kinesin motor domain, KIF2-like gro 81.42
PRK10416318 signal recognition particle-docking protein FtsY; 81.38
PRK11608 326 pspF phage shock protein operon transcriptional ac 81.32
PRK09361225 radB DNA repair and recombination protein RadB; Pr 81.27
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 81.19
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 81.18
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 80.98
KOG0951|consensus 1674 80.96
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 80.88
PF10412 386 TrwB_AAD_bind: Type IV secretion-system coupling p 80.88
PF00005137 ABC_tran: ABC transporter This structure is on hol 80.82
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 80.74
cd01371 333 KISc_KIF3 Kinesin motor domain, kinesins II or KIF 80.72
TIGR00368 499 Mg chelatase-related protein. The N-terminal end m 80.69
cd01369 325 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy 80.66
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 80.53
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 80.5
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 80.5
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 80.44
cd01370 338 KISc_KIP3_like Kinesin motor domain, KIP3-like sub 80.44
COG3973 747 Superfamily I DNA and RNA helicases [General funct 80.43
PRK07993 334 DNA polymerase III subunit delta'; Validated 80.38
TIGR02237209 recomb_radB DNA repair and recombination protein R 80.35
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 80.31
TIGR02974 329 phageshock_pspF psp operon transcriptional activat 80.24
KOG0745|consensus 564 80.23
PF00931 287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 80.15
>KOG1133|consensus Back     alignment and domain information
Probab=99.96  E-value=3.8e-29  Score=240.96  Aligned_cols=158  Identities=34%  Similarity=0.540  Sum_probs=128.3

Q ss_pred             CccCCCCCCCHHHHHHHHHHHHHHhcCCceeeeCCCCCCchHHHHHHHHHHHhhhhhhhHHHHHHHHHhhhh-hcCCCCC
Q psy14272         23 SEFPFPFDAYDIQSNFMKNLYYTLDNSKFGIFESPTGTGKSLSLICGILKWYYDHKIVGLEKIEAKIKDLEI-SKNETVS  101 (194)
Q Consensus        23 ~~~~fPy~py~iQ~e~M~~I~~~L~~gk~~I~ESPTGTGKTLS~L~~al~wl~~~~~~~~~~~~~~~~~~~~-~~~~d~e  101 (194)
                      ..|+|||+||+||.+||+.||++|+.|+++|||||||||||||+||++|+||++++.++..+....+..+.+ ..+.+++
T Consensus         8 ~~F~fPy~PYdIQ~~lM~elyrvLe~GkIgIfESPTGTGKSLSLiCaaltWL~~~eek~~t~~~~~l~~v~~~~~d~kde   87 (821)
T KOG1133|consen    8 IEFPFPYTPYDIQEDLMRELYRVLEEGKIGIFESPTGTGKSLSLICAALTWLRDFEEKKRTEEARLLETVTGPLHDEKDE   87 (821)
T ss_pred             cccCCCCCchhHHHHHHHHHHHHHhcCCeeeeeCCCCCCchHHHHHHHHHHHHHhHHhhhhHHHhhhccCCCcccccccc
Confidence            569999999999999999999999999999999999999999999999999999999888877666654421 2444677


Q ss_pred             ch----HHHHHHHHHHHHhhHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHhhccchHHHhhhhhhhhhhhhhchhhhhH
Q psy14272        102 ED----WIEQQSFELKMRNQIDA-LKDALKSQKTYDELIENIRKQNEKRKKSLRNDQEVKVHALTYRNRMDEKNSKEKRK  176 (194)
Q Consensus       102 Pd----Wv~e~~~~~~~~~~~~~-~~~~~~~~~~~E~rL~~ir~~~~~~k~~~r~~~~~~~~~~~~~~~~~e~~~~~~r~  176 (194)
                      ||    |+.++.++...+....+ ++......+.++.+++++...++..+.+.+++++.-..+--+.++|.+++    |.
T Consensus        88 ~d~~s~wl~~~~~~~~er~~~~r~l~~~qa~~~~re~r~q~~~~~~e~~k~ak~~~~e~~~reyl~~~e~~~pg----~~  163 (821)
T KOG1133|consen   88 SDSSSAWLTQFVQKKEERDLVDRNLKAEQARFKQREERLQQLQHRVQGKKGAKRLRQEEEEREYLLSREMLEPG----RL  163 (821)
T ss_pred             ccchhHHHHHHHHHHHhhccchHHHHHhhchHHHHHHHHHhhhhHHhhhhhhhccccccccchhcchhhccCcc----ch
Confidence            77    99999999999999888 77778888899999999999999999999999866332222344454444    44


Q ss_pred             HHhhcccc
Q psy14272        177 EEERDGLE  184 (194)
Q Consensus       177 ~~~~~~~~  184 (194)
                      |+-..|++
T Consensus       164 eq~e~~~~  171 (821)
T KOG1133|consen  164 EQLESGEE  171 (821)
T ss_pred             hhhhcccc
Confidence            44444443



>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13876 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>KOG1808|consensus Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13880 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG Back     alignment and domain information
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13822 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>KOG0239|consensus Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 5e-09
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 7e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 9e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-04
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Length = 620 Back     alignment and structure
 Score = 53.9 bits (130), Expect = 5e-09
 Identities = 15/74 (20%), Positives = 30/74 (40%), Gaps = 9/74 (12%)

Query: 29 FDAYDIQSNFMKNLYYTLDNSKFGIFESPTGTGKSLSLICGILKW---------YYDHKI 79
          ++    Q   +  L  +L  S     ESPTG+GK++  +   L++         Y     
Sbjct: 2  YENRQYQVEAIDFLRSSLQKSYGVALESPTGSGKTIMALKSALQYSSERKLKVLYLVRTN 61

Query: 80 VGLEKIEAKIKDLE 93
             E++  +++ L 
Sbjct: 62 SQEEQVIKELRSLS 75


>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Length = 540 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Length = 551 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query194
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.3
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.12
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.08
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 98.76
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 98.74
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 98.74
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 98.73
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 98.69
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 98.68
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 98.67
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 98.66
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 98.64
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 98.64
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 98.64
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 98.62
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 98.62
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 98.6
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 98.58
3bor_A237 Human initiation factor 4A-II; translation initiat 98.58
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.55
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 98.55
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 98.53
3b6e_A216 Interferon-induced helicase C domain-containing P; 98.53
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 98.52
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 98.5
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 98.5
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 98.49
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 98.48
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 98.46
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 98.46
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 98.45
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 98.44
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 98.44
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 98.42
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 98.38
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.36
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 98.34
4gl2_A 699 Interferon-induced helicase C domain-containing P; 98.26
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 98.26
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 98.23
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 98.23
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 98.16
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 98.15
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 98.14
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 98.14
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 98.11
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 98.1
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 98.06
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 98.06
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 98.03
3h1t_A 590 Type I site-specific restriction-modification syst 97.99
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 97.98
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 97.98
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 97.95
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 97.93
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 97.91
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 97.87
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 97.84
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 97.83
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 97.81
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 97.74
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 97.62
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 97.59
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 97.51
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 97.46
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 97.46
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 97.46
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 97.39
1yks_A 440 Genome polyprotein [contains: flavivirin protease 97.38
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 97.25
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 97.23
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 97.19
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 97.12
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.04
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 97.01
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 96.65
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 96.47
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 96.46
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 96.37
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 96.04
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 96.02
3jux_A 822 Protein translocase subunit SECA; protein transloc 95.41
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 95.33
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 95.24
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 95.2
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 95.19
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 95.1
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 94.98
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 94.93
2r44_A 331 Uncharacterized protein; putative ATPase, structur 94.92
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 94.86
3co5_A143 Putative two-component system transcriptional RES 94.85
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.67
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 94.67
2chg_A226 Replication factor C small subunit; DNA-binding pr 94.6
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 94.31
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 94.21
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 94.21
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 94.15
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 94.1
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 94.03
2chq_A 319 Replication factor C small subunit; DNA-binding pr 93.83
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 93.8
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 93.72
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 93.64
2qgz_A308 Helicase loader, putative primosome component; str 93.62
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 93.58
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 93.46
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 93.45
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 93.25
3bos_A242 Putative DNA replication factor; P-loop containing 93.25
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 93.12
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 92.94
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 92.86
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 92.85
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 92.81
1p9r_A 418 General secretion pathway protein E; bacterial typ 92.39
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 91.78
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 91.68
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 91.57
2eyu_A261 Twitching motility protein PILT; pilus retraction 91.56
2r62_A268 Cell division protease FTSH homolog; ATPase domain 91.56
3pvs_A 447 Replication-associated recombination protein A; ma 91.39
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 91.34
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 91.29
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 91.27
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 91.22
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 90.96
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 90.96
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 90.91
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 90.67
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 90.67
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 90.64
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 90.62
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 90.41
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 90.37
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 90.12
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 90.05
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 89.97
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 89.95
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 89.84
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 89.81
1ry6_A 360 Internal kinesin; kinesin motor domain, nucleotide 89.77
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 89.73
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 89.69
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 89.69
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 89.56
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 89.46
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 89.45
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 89.1
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 89.08
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 88.96
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 88.89
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 88.84
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 88.83
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 88.58
1tue_A212 Replication protein E1; helicase, replication, E1E 88.56
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 88.51
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 88.39
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 88.15
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 88.15
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 88.1
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 87.87
2ewv_A372 Twitching motility protein PILT; pilus retraction 87.85
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 87.82
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 87.79
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 87.77
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 87.42
2fna_A 357 Conserved hypothetical protein; structural genomic 87.28
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 87.28
2kjq_A149 DNAA-related protein; solution structure, NESG, st 87.2
3dc4_A 344 Kinesin-like protein NOD; catalytic domain, ATPase 87.14
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 87.1
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 86.97
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 86.62
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 86.54
1t5c_A 349 CENP-E protein, centromeric protein E; kinesin mot 86.49
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 86.41
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 85.9
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 85.76
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 85.75
3vaa_A199 Shikimate kinase, SK; structural genomics, center 85.72
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 85.64
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 85.48
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 85.47
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 85.45
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 85.43
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 85.28
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 85.11
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 85.07
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 84.97
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 84.63
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 84.52
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 84.44
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 84.43
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 84.37
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 84.36
1f9v_A 347 Kinesin-like protein KAR3; kinesin-related protein 84.21
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 84.12
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 83.97
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 83.94
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 83.83
2rep_A 376 Kinesin-like protein KIFC1; structural genomics co 83.83
3cob_A 369 Kinesin heavy chain-like protein; motor, switch II 83.73
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 83.56
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 83.53
2cvh_A220 DNA repair and recombination protein RADB; filamen 83.52
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 83.48
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 83.44
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 83.42
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 83.41
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 83.36
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 83.25
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 83.2
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 83.07
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 83.03
3t0q_A 349 AGR253WP; kinesin, alpha and beta proteins, P-loop 82.97
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 82.94
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 82.92
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 82.89
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 82.87
4a14_A 344 Kinesin, kinesin-like protein KIF7; motor protein, 82.74
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 82.67
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 82.52
1kag_A173 SKI, shikimate kinase I; transferase, structural g 82.31
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 82.2
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 81.9
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 81.85
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 81.83
3kta_A182 Chromosome segregation protein SMC; structural mai 81.77
1goj_A 355 Kinesin, kinesin heavy chain; motor protein, ATPas 81.71
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 81.68
1xjc_A169 MOBB protein homolog; structural genomics, midwest 81.48
2h58_A 330 Kinesin-like protein KIFC3 variant; motor domain, 81.44
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 81.43
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 81.31
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 81.24
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 81.23
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 81.19
3auy_A 371 DNA double-strand break repair RAD50 ATPase; DNA r 81.08
3lre_A 355 Kinesin-like protein KIF18A; motor protein, nucleo 80.86
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 80.85
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 80.84
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 80.76
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 80.66
2y65_A 365 Kinesin, kinesin heavy chain; motor protein; HET: 80.35
1x88_A 359 Kinesin-like protein KIF11; switch II, motor domai 80.33
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 80.09
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 80.09
1bg2_A 325 Kinesin; motor protein, ATPase, microtubule associ 80.06
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 80.04
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 80.02
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
Probab=99.30  E-value=1.2e-12  Score=123.59  Aligned_cols=52  Identities=25%  Similarity=0.353  Sum_probs=45.6

Q ss_pred             CCCCHHHHHHHHHHHHHHhcCCceeeeCCCCCCchHHHHHHHHHHHhhhhhh
Q psy14272         29 FDAYDIQSNFMKNLYYTLDNSKFGIFESPTGTGKSLSLICGILKWYYDHKIV   80 (194)
Q Consensus        29 y~py~iQ~e~M~~I~~~L~~gk~~I~ESPTGTGKTLS~L~~al~wl~~~~~~   80 (194)
                      |+|||.|.+||.+|+++|.+|+++|++||||||||++||+|++.|+...+.+
T Consensus         2 ~~~R~~Q~~~~~~v~~~l~~~~~~~~~apTGtGKT~a~l~p~l~~~~~~~~k   53 (620)
T 4a15_A            2 YENRQYQVEAIDFLRSSLQKSYGVALESPTGSGKTIMALKSALQYSSERKLK   53 (620)
T ss_dssp             ---CHHHHHHHHHHHHHHHHSSEEEEECCTTSCHHHHHHHHHHHHHHHHTCE
T ss_pred             CCCCHHHHHHHHHHHHHHHcCCCEEEECCCCCCHHHHHHHHHHHhhhhcCCe
Confidence            7899999999999999999999999999999999999999999998764433



>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query194
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 98.91
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 98.88
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 98.83
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 98.81
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 98.81
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 98.74
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 98.7
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 98.68
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 98.67
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 98.57
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 98.52
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 98.39
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 98.35
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 97.95
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 97.9
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 97.82
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 97.81
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 97.74
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.56
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.51
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.1
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 95.92
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 95.57
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 95.53
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.42
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.37
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 95.34
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 95.19
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.07
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.02
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 94.92
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.75
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 94.58
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 94.54
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 94.07
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 93.87
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 93.59
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 93.57
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 93.55
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 93.38
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 93.32
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 93.32
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 92.9
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 92.77
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 92.74
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 92.54
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 92.53
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 92.42
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 92.13
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 91.93
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 91.87
d1okkd2207 GTPase domain of the signal recognition particle r 91.77
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 91.75
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 91.74
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 91.42
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 91.18
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 90.98
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 90.68
d1svma_362 Papillomavirus large T antigen helicase domain {Si 90.66
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 90.62
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 90.53
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.48
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 90.45
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 90.36
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 89.89
d1vmaa2213 GTPase domain of the signal recognition particle r 89.76
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 89.67
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 89.57
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 89.41
d1j8yf2211 GTPase domain of the signal sequence recognition p 89.32
d1ls1a2207 GTPase domain of the signal sequence recognition p 89.24
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 89.23
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 89.08
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 88.23
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 87.84
d1ry6a_330 Kinesin {Malaria parasite (Plasmodium falciparum) 87.79
d2qy9a2211 GTPase domain of the signal recognition particle r 87.64
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 87.6
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 87.27
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 87.16
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 87.02
d1v8ka_ 362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 86.66
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 86.52
d1bg2a_ 323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 86.39
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 86.37
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 86.35
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 86.32
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 86.02
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 85.85
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 85.82
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 85.48
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 85.46
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 85.19
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 85.07
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 85.01
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 84.53
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 84.53
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 84.43
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 84.29
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 83.96
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 83.89
d1f9va_ 342 Kinesin motor Ncd (non-claret disjunctional) {Bake 83.55
d1sdma_ 364 Kinesin heavy chain-like protein {Potato (Solanum 83.53
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 83.42
d1x88a1 345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 83.18
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 83.05
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 82.88
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 82.76
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 82.53
d1goja_ 354 Kinesin {Neurospora crassa [TaxId: 5141]} 82.35
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 81.42
d1tuea_205 Replication protein E1 helicase domain {Human papi 81.32
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 81.03
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 80.77
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 80.6
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable DEAD box RNA helicase YqfR
species: Bacillus stearothermophilus [TaxId: 1422]
Probab=98.91  E-value=3e-10  Score=89.34  Aligned_cols=48  Identities=21%  Similarity=0.243  Sum_probs=40.7

Q ss_pred             CCCC-CCHHHHHHHHHHHHHHhcCCceeeeCCCCCCchHHHHHHHHHHHhhhh
Q psy14272         27 FPFD-AYDIQSNFMKNLYYTLDNSKFGIFESPTGTGKSLSLICGILKWYYDHK   78 (194)
Q Consensus        27 fPy~-py~iQ~e~M~~I~~~L~~gk~~I~ESPTGTGKTLS~L~~al~wl~~~~   78 (194)
                      +.|. |+|+|.+.+..+    -+|+++|+.||||||||+||++|++..+....
T Consensus        19 ~g~~~pt~iQ~~aip~~----l~G~dvii~a~TGSGKTlayllp~l~~~~~~~   67 (209)
T d1q0ua_          19 LRFYKPTEIQERIIPGA----LRGESMVGQSQTGTGKTHAYLLPIMEKIKPER   67 (209)
T ss_dssp             TTCCSCCHHHHHHHHHH----HHTCCEEEECCSSHHHHHHHHHHHHHHCCTTS
T ss_pred             CCCCCCCHHHHHHHHHH----HCCCCeEeecccccccceeeeeeecccccccc
Confidence            5676 999999987765    46899999999999999999999988775443



>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure