Psyllid ID: psy14368
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 128 | ||||||
| 189234985 | 1843 | PREDICTED: similar to myosin-rhogap prot | 0.570 | 0.039 | 0.808 | 1e-28 | |
| 270002356 | 2021 | hypothetical protein TcasGA2_TC001372 [T | 0.570 | 0.036 | 0.808 | 1e-28 | |
| 328701267 | 1776 | PREDICTED: myosin-IXb isoform 4 [Acyrtho | 0.515 | 0.037 | 0.848 | 1e-27 | |
| 328701265 | 1863 | PREDICTED: myosin-IXb isoform 3 [Acyrtho | 0.515 | 0.035 | 0.848 | 1e-27 | |
| 357623270 | 1062 | hypothetical protein KGM_18974 [Danaus p | 0.515 | 0.062 | 0.848 | 1e-27 | |
| 328701263 | 1931 | PREDICTED: myosin-IXb isoform 2 [Acyrtho | 0.515 | 0.034 | 0.848 | 1e-27 | |
| 328701269 | 1847 | PREDICTED: myosin-IXb isoform 1 [Acyrtho | 0.515 | 0.035 | 0.848 | 1e-27 | |
| 242011074 | 783 | myosin IIIB, putative [Pediculus humanus | 0.617 | 0.100 | 0.734 | 3e-27 | |
| 321455065 | 1839 | hypothetical protein DAPPUDRAFT_64918 [D | 0.617 | 0.042 | 0.696 | 6e-27 | |
| 427791915 | 1463 | Putative myosin class i heavy chain, par | 0.570 | 0.049 | 0.726 | 1e-26 |
| >gi|189234985|ref|XP_968193.2| PREDICTED: similar to myosin-rhogap protein, myr [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 131 bits (329), Expect = 1e-28, Method: Compositional matrix adjust.
Identities = 59/73 (80%), Positives = 64/73 (87%)
Query: 30 SFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLL 89
SFEQLCINYANEHLQYYFNQHVF+YEQEEY KEGIRW +I+F DNT CLQL+EGKPNGLL
Sbjct: 523 SFEQLCINYANEHLQYYFNQHVFKYEQEEYRKEGIRWNNIDFMDNTGCLQLIEGKPNGLL 582
Query: 90 CVLDDQAKRGNAT 102
C+LDDQ AT
Sbjct: 583 CLLDDQCNFPGAT 595
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270002356|gb|EEZ98803.1| hypothetical protein TcasGA2_TC001372 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|328701267|ref|XP_003241548.1| PREDICTED: myosin-IXb isoform 4 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328701265|ref|XP_003241547.1| PREDICTED: myosin-IXb isoform 3 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|357623270|gb|EHJ74495.1| hypothetical protein KGM_18974 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|328701263|ref|XP_003241546.1| PREDICTED: myosin-IXb isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328701269|ref|XP_001944223.2| PREDICTED: myosin-IXb isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|242011074|ref|XP_002426282.1| myosin IIIB, putative [Pediculus humanus corporis] gi|212510345|gb|EEB13544.1| myosin IIIB, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|321455065|gb|EFX66210.1| hypothetical protein DAPPUDRAFT_64918 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|427791915|gb|JAA61409.1| Putative myosin class i heavy chain, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 128 | ||||||
| UNIPROTKB|F1S9U2 | 548 | F1S9U2 "Uncharacterized protei | 0.570 | 0.133 | 0.575 | 2.7e-21 | |
| WB|WBGene00002040 | 1880 | hum-7 [Caenorhabditis elegans | 0.570 | 0.038 | 0.630 | 7.4e-21 | |
| MGI|MGI:107735 | 2542 | Myo9a "myosin IXa" [Mus muscul | 0.742 | 0.037 | 0.5 | 9.6e-20 | |
| UNIPROTKB|G3MXH1 | 1104 | Bt.27781 "Uncharacterized prot | 0.617 | 0.071 | 0.556 | 1.1e-19 | |
| UNIPROTKB|H3BMM1 | 1301 | MYO9A "Unconventional myosin-I | 0.617 | 0.060 | 0.556 | 1.4e-19 | |
| UNIPROTKB|E1BS57 | 2001 | Gga.50857 "Uncharacterized pro | 0.617 | 0.039 | 0.544 | 1.5e-19 | |
| UNIPROTKB|E1C471 | 2031 | Gga.50857 "Uncharacterized pro | 0.617 | 0.038 | 0.544 | 1.5e-19 | |
| UNIPROTKB|E1C470 | 2140 | Gga.50857 "Uncharacterized pro | 0.617 | 0.036 | 0.544 | 1.6e-19 | |
| UNIPROTKB|E1BNV7 | 2159 | MYO9B "Uncharacterized protein | 0.570 | 0.033 | 0.575 | 1.8e-19 | |
| UNIPROTKB|E2R266 | 2161 | MYO9B "Uncharacterized protein | 0.570 | 0.033 | 0.575 | 1.8e-19 |
| UNIPROTKB|F1S9U2 F1S9U2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Score = 246 (91.7 bits), Expect = 2.7e-21, Sum P(2) = 2.7e-21
Identities = 42/73 (57%), Positives = 55/73 (75%)
Query: 30 SFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLL 89
SFEQ CINYANE LQYYFNQH+F+ EQEEY EGI W +I+++DN C+ L+ KP GL
Sbjct: 404 SFEQFCINYANEQLQYYFNQHIFKLEQEEYQSEGISWHNIDYTDNVGCIHLISKKPTGLF 463
Query: 90 CVLDDQAKRGNAT 102
+LD+++ +AT
Sbjct: 464 YLLDEESNFPHAT 476
|
|
| WB|WBGene00002040 hum-7 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:107735 Myo9a "myosin IXa" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3MXH1 Bt.27781 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H3BMM1 MYO9A "Unconventional myosin-IXa" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BS57 Gga.50857 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C471 Gga.50857 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C470 Gga.50857 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BNV7 MYO9B "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R266 MYO9B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 128 | |||
| smart00242 | 677 | smart00242, MYSc, Myosin | 7e-36 | |
| cd01385 | 692 | cd01385, MYSc_type_IX, Myosin motor domain, type I | 7e-34 | |
| cd00124 | 679 | cd00124, MYSc, Myosin motor domain | 2e-31 | |
| pfam00063 | 679 | pfam00063, Myosin_head, Myosin head (motor domain) | 7e-30 | |
| cd01384 | 674 | cd01384, MYSc_type_XI, Myosin motor domain, plant- | 2e-29 | |
| cd01381 | 671 | cd01381, MYSc_type_VII, Myosin motor domain, type | 1e-28 | |
| cd01380 | 691 | cd01380, MYSc_type_V, Myosin motor domain, type V | 2e-28 | |
| cd01383 | 677 | cd01383, MYSc_type_VIII, Myosin motor domain, plan | 9e-26 | |
| cd01387 | 677 | cd01387, MYSc_type_XV, Myosin motor domain, type X | 1e-25 | |
| COG5022 | 1463 | COG5022, COG5022, Myosin heavy chain [Cytoskeleton | 4e-25 | |
| cd01377 | 693 | cd01377, MYSc_type_II, Myosin motor domain, type I | 2e-23 | |
| cd01382 | 717 | cd01382, MYSc_type_VI, Myosin motor domain, type V | 1e-22 | |
| cd01379 | 653 | cd01379, MYSc_type_III, Myosin motor domain, type | 3e-22 | |
| cd01378 | 674 | cd01378, MYSc_type_I, Myosin motor domain, type I | 1e-21 | |
| PTZ00014 | 821 | PTZ00014, PTZ00014, myosin-A; Provisional | 1e-11 | |
| cd01386 | 767 | cd01386, MYSc_type_XVIII, Myosin motor domain, typ | 7e-05 |
| >gnl|CDD|214580 smart00242, MYSc, Myosin | Back alignment and domain information |
|---|
Score = 129 bits (326), Expect = 7e-36
Identities = 45/79 (56%), Positives = 57/79 (72%)
Query: 24 EYYYVTSFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEG 83
E + V SFEQLCINYANE LQ +FNQHVF+ EQEEY +EGI W I+F DN C+ L+E
Sbjct: 380 EIFEVNSFEQLCINYANEKLQQFFNQHVFKLEQEEYEREGIDWTFIDFFDNQDCIDLIEK 439
Query: 84 KPNGLLCVLDDQAKRGNAT 102
KP G+L +LD++ + T
Sbjct: 440 KPPGILSLLDEECRFPKGT 458
|
Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin. Length = 677 |
| >gnl|CDD|238681 cd01385, MYSc_type_IX, Myosin motor domain, type IX myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238071 cd00124, MYSc, Myosin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain) | Back alignment and domain information |
|---|
| >gnl|CDD|238680 cd01384, MYSc_type_XI, Myosin motor domain, plant-specific type XI myosin, involved in organelle transport | Back alignment and domain information |
|---|
| >gnl|CDD|238677 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238676 cd01380, MYSc_type_V, Myosin motor domain, type V myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238679 cd01383, MYSc_type_VIII, Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata | Back alignment and domain information |
|---|
| >gnl|CDD|238683 cd01387, MYSc_type_XV, Myosin motor domain, type XV myosins | Back alignment and domain information |
|---|
| >gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238678 cd01382, MYSc_type_VI, Myosin motor domain, type VI myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238675 cd01379, MYSc_type_III, Myosin motor domain, type III myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238674 cd01378, MYSc_type_I, Myosin motor domain, type I myosins | Back alignment and domain information |
|---|
| >gnl|CDD|240229 PTZ00014, PTZ00014, myosin-A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238682 cd01386, MYSc_type_XVIII, Myosin motor domain, type XVIII myosins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 128 | |||
| COG5022 | 1463 | Myosin heavy chain [Cytoskeleton] | 100.0 | |
| PTZ00014 | 821 | myosin-A; Provisional | 100.0 | |
| cd01383 | 677 | MYSc_type_VIII Myosin motor domain, plant-specific | 100.0 | |
| cd01387 | 677 | MYSc_type_XV Myosin motor domain, type XV myosins. | 100.0 | |
| cd01381 | 671 | MYSc_type_VII Myosin motor domain, type VII myosin | 100.0 | |
| cd01382 | 717 | MYSc_type_VI Myosin motor domain, type VI myosins. | 100.0 | |
| cd01384 | 674 | MYSc_type_XI Myosin motor domain, plant-specific t | 100.0 | |
| cd01379 | 653 | MYSc_type_III Myosin motor domain, type III myosin | 100.0 | |
| cd01378 | 674 | MYSc_type_I Myosin motor domain, type I myosins. M | 100.0 | |
| cd01385 | 692 | MYSc_type_IX Myosin motor domain, type IX myosins. | 100.0 | |
| cd01377 | 693 | MYSc_type_II Myosin motor domain, type II myosins. | 100.0 | |
| cd01380 | 691 | MYSc_type_V Myosin motor domain, type V myosins. M | 100.0 | |
| smart00242 | 677 | MYSc Myosin. Large ATPases. ATPase; molecular moto | 100.0 | |
| cd00124 | 679 | MYSc Myosin motor domain. This catalytic (head) do | 99.98 | |
| cd01386 | 767 | MYSc_type_XVIII Myosin motor domain, type XVIII my | 99.97 | |
| PF00063 | 689 | Myosin_head: Myosin head (motor domain); InterPro: | 99.97 | |
| KOG0164|consensus | 1001 | 99.97 | ||
| KOG0161|consensus | 1930 | 99.97 | ||
| KOG0163|consensus | 1259 | 99.95 | ||
| KOG0162|consensus | 1106 | 99.95 | ||
| KOG0160|consensus | 862 | 99.93 | ||
| KOG4229|consensus | 1062 | 99.9 |
| >COG5022 Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3e-36 Score=269.48 Aligned_cols=108 Identities=41% Similarity=0.635 Sum_probs=102.0
Q ss_pred cCCCCCCCcceeeecceeeecccCCCchhhhHhhhhhhhhhhhhhhhhhhhhhhhhhhcCcceeeeeeCCcHHHHHHHhc
Q psy14368 4 VRATEQDTNVTRRDTQELKHEYYYVTSFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEG 83 (128)
Q Consensus 4 ~~~~~~~~~~~i~di~~lfE~f~~~NsfeQlciN~anEkLq~~~~~~if~~e~eey~~Egi~~~~i~~~dn~~~ldLi~~ 83 (128)
+.|+..+..+|||||+| ||+|+ .|||||||||||||||||+|++++|+.||++|.+|||+|.+|+|.||++|+|||++
T Consensus 421 ~~~~~~~~fIGVLDIyG-FEiFE-kNSFEQlCINYtNEKLQQ~Fn~h~FklEQEeY~kE~IeW~~Idy~DnQ~~IDLIE~ 498 (1463)
T COG5022 421 DHSAAASNFIGVLDIYG-FEIFE-KNSFEQLCINYTNEKLQQFFNQHMFKLEQEEYVKEGIEWSFIDYFDNQPCIDLIEK 498 (1463)
T ss_pred cCccccccceeEEeecc-hhhhc-cCcHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHhcCcccccccccCcchhHHHhc
Confidence 34555788999999999 99999 99999999999999999999999999999999999999999999999999999996
Q ss_pred -CCCcccccchhhhhcCCCCchhHHHHhhhh
Q psy14368 84 -KPNGLLCVLDDQAKRGNATLRYENMKLYID 113 (128)
Q Consensus 84 -~p~Gll~lLDeec~~p~~td~~~~~kl~~~ 113 (128)
.|.|||++|||||..|.++|++|..||...
T Consensus 499 ~~p~GIlslLDEE~~~p~atd~s~~sKL~~~ 529 (1463)
T COG5022 499 KNPLGILSLLDEECVMPHATDESFTSKLAQR 529 (1463)
T ss_pred cCCCchHhhhcHHhcCCCCCchHHHHHHHHH
Confidence 378999999999999999999999999763
|
|
| >PTZ00014 myosin-A; Provisional | Back alignment and domain information |
|---|
| >cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata | Back alignment and domain information |
|---|
| >cd01387 MYSc_type_XV Myosin motor domain, type XV myosins | Back alignment and domain information |
|---|
| >cd01381 MYSc_type_VII Myosin motor domain, type VII myosins | Back alignment and domain information |
|---|
| >cd01382 MYSc_type_VI Myosin motor domain, type VI myosins | Back alignment and domain information |
|---|
| >cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport | Back alignment and domain information |
|---|
| >cd01379 MYSc_type_III Myosin motor domain, type III myosins | Back alignment and domain information |
|---|
| >cd01378 MYSc_type_I Myosin motor domain, type I myosins | Back alignment and domain information |
|---|
| >cd01385 MYSc_type_IX Myosin motor domain, type IX myosins | Back alignment and domain information |
|---|
| >cd01377 MYSc_type_II Myosin motor domain, type II myosins | Back alignment and domain information |
|---|
| >cd01380 MYSc_type_V Myosin motor domain, type V myosins | Back alignment and domain information |
|---|
| >smart00242 MYSc Myosin | Back alignment and domain information |
|---|
| >cd00124 MYSc Myosin motor domain | Back alignment and domain information |
|---|
| >cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins | Back alignment and domain information |
|---|
| >PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0164|consensus | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >KOG0163|consensus | Back alignment and domain information |
|---|
| >KOG0162|consensus | Back alignment and domain information |
|---|
| >KOG0160|consensus | Back alignment and domain information |
|---|
| >KOG4229|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 128 | ||||
| 2x9h_A | 695 | Crystal Structure Of Myosin-2 Motor Domain In Compl | 2e-17 | ||
| 3myh_X | 762 | Insights Into The Importance Of Hydrogen Bonding In | 2e-17 | ||
| 1yv3_A | 762 | The Structural Basis Of Blebbistatin Inhibition And | 3e-17 | ||
| 1mmn_A | 762 | X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga | 3e-17 | ||
| 1mma_A | 762 | X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga | 3e-17 | ||
| 2xo8_A | 776 | Crystal Structure Of Myosin-2 In Complex With Tribr | 3e-17 | ||
| 1mmd_A | 762 | Truncated Head Of Myosin From Dictyostelium Discoid | 3e-17 | ||
| 1mmg_A | 762 | X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga | 3e-17 | ||
| 3mkd_A | 692 | Crystal Structure Of Myosin-2 Dictyostelium Discoid | 3e-17 | ||
| 1jwy_A | 776 | Crystal Structure Of The Dynamin A Gtpase Domain Co | 3e-17 | ||
| 1fmv_A | 761 | Crystal Structure Of The Apo Motor Domain Of Dictyo | 3e-17 | ||
| 1d0x_A | 761 | Dictyostelium Myosin S1dc (Motor Domain Fragment) C | 3e-17 | ||
| 3mnq_A | 788 | Crystal Structure Of Myosin-2 Motor Domain In Compl | 3e-17 | ||
| 1w9i_A | 770 | Myosin Ii Dictyostelium Discoideum Motor Domain S45 | 3e-17 | ||
| 1w9k_A | 770 | Dictyostelium Discoideum Myosin Ii Motor Domain S45 | 3e-17 | ||
| 2aka_A | 776 | Structure Of The Nucleotide-Free Myosin Ii Motor Do | 3e-17 | ||
| 2y9e_X | 758 | Structural Basis For The Allosteric Interference Of | 3e-17 | ||
| 2y0r_X | 758 | Structural Basis For The Allosteric Interference Of | 3e-17 | ||
| 2xel_A | 776 | Molecular Mechanism Of Pentachloropseudilin Mediate | 3e-17 | ||
| 2jhr_A | 788 | Crystal Structure Of Myosin-2 Motor Domain In Compl | 3e-17 | ||
| 1w9l_A | 770 | Myosin Ii Dictyostelium Discoideum Motor Domain S45 | 3e-17 | ||
| 1w9j_A | 770 | Myosin Ii Dictyostelium Discoideum Motor Domain S45 | 3e-17 | ||
| 1g8x_A | 1010 | Structure Of A Genetically Engineered Molecular Mot | 5e-17 | ||
| 1lvk_A | 762 | X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N | 8e-17 | ||
| 1oe9_A | 795 | Crystal Structure Of Myosin V Motor With Essential | 8e-17 | ||
| 1w8j_A | 766 | Crystal Structure Of Myosin V Motor Domain - Nucleo | 8e-17 | ||
| 2dfs_A | 1080 | 3-D Structure Of Myosin-V Inhibited State Length = | 1e-16 | ||
| 2os8_A | 840 | Rigor-Like Structures Of Muscle Myosins Reveal Key | 1e-16 | ||
| 2ec6_A | 838 | Placopecten Striated Muscle Myosin Ii Length = 838 | 1e-16 | ||
| 1qvi_A | 840 | Crystal Structure Of Scallop Myosin S1 In The Pre-P | 2e-16 | ||
| 1b7t_A | 835 | Myosin Digested By Papain Length = 835 | 2e-16 | ||
| 1kk7_A | 837 | Scallop Myosin In The Near Rigor Conformation Lengt | 2e-16 | ||
| 1dfk_A | 830 | Nucleotide-Free Scallop Myosin S1-Near Rigor State | 2e-16 | ||
| 1dfl_A | 831 | Scallop Myosin S1 Complexed With Mgadp:vanadate-Tra | 2e-16 | ||
| 3i5g_A | 839 | Crystal Structure Of Rigor-Like Squid Myosin S1 Len | 4e-16 | ||
| 2w4g_M | 840 | Isometrically Contracting Insect Asynchronous Fligh | 5e-16 | ||
| 4db1_A | 783 | Cardiac Human Myosin S1dc, Beta Isoform Complexed W | 1e-15 | ||
| 1i84_S | 1184 | Cryo-Em Structure Of The Heavy Meromyosin Subfragme | 1e-14 | ||
| 3dtp_B | 973 | Tarantula Heavy Meromyosin Obtained By Flexible Doc | 1e-14 | ||
| 3dtp_A | 971 | Tarantula Heavy Meromyosin Obtained By Flexible Doc | 1e-14 | ||
| 1br1_A | 820 | Smooth Muscle Myosin Motor Domain-Essential Light C | 2e-14 | ||
| 1br2_A | 791 | Smooth Muscle Myosin Motor Domain Complexed With Mg | 2e-14 | ||
| 3j04_A | 909 | Em Structure Of The Heavy Meromyosin Subfragment Of | 2e-14 | ||
| 2mys_A | 843 | Myosin Subfragment-1, Alpha Carbon Coordinates Only | 2e-14 | ||
| 1m8q_A | 840 | Molecular Models Of Averaged Rigor Crossbridges Fro | 2e-14 | ||
| 2x51_A | 789 | M6 Delta Insert1 Length = 789 | 2e-14 | ||
| 2vas_A | 788 | Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigo | 2e-14 | ||
| 4dbq_A | 788 | Myosin Vi D179y (md-insert2-cam, Delta-insert1) Pos | 2e-14 | ||
| 2bki_A | 858 | Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal St | 2e-14 | ||
| 2ycu_A | 995 | Crystal Structure Of Human Non Muscle Myosin 2c In | 2e-14 | ||
| 3l9i_A | 814 | Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant | 3e-14 | ||
| 2v26_A | 784 | Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) L | 4e-13 | ||
| 4e7s_A | 798 | Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke Stat | 4e-13 | ||
| 4e7z_A | 798 | Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal F | 4e-13 | ||
| 2bkh_A | 814 | Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc | 4e-13 | ||
| 4dbr_A | 786 | Myosin Vi D179y (md) Pre-powerstroke State Length = | 4e-13 | ||
| 4dbp_A | 814 | Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal | 4e-13 | ||
| 4anj_A | 1052 | Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke St | 4e-13 | ||
| 1lkx_A | 697 | Motor Domain Of Myoe, A Class-I Myosin Length = 697 | 6e-13 | ||
| 4a7f_C | 697 | Structure Of The Actin-Tropomyosin-Myosin Complex ( | 1e-12 |
| >pdb|2X9H|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentachlorocarbazole Length = 695 | Back alignment and structure |
|
| >pdb|3MYH|X Chain X, Insights Into The Importance Of Hydrogen Bonding In The Gamma- Phosphate Binding Pocket Of Myosin: Structural And Functional Studies Of Ser236 Length = 762 | Back alignment and structure |
| >pdb|1YV3|A Chain A, The Structural Basis Of Blebbistatin Inhibition And Specificity For Myosin Ii Length = 762 | Back alignment and structure |
| >pdb|1MMN|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|1MMA|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|2XO8|A Chain A, Crystal Structure Of Myosin-2 In Complex With Tribromodichloropseudilin Length = 776 | Back alignment and structure |
| >pdb|1MMD|A Chain A, Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Bef3 Length = 762 | Back alignment and structure |
| >pdb|1MMG|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|3MKD|A Chain A, Crystal Structure Of Myosin-2 Dictyostelium Discoideum Motor Domain S456y Mutant In Complex With Adp-Orthovanadate Length = 692 | Back alignment and structure |
| >pdb|1JWY|A Chain A, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 776 | Back alignment and structure |
| >pdb|1FMV|A Chain A, Crystal Structure Of The Apo Motor Domain Of Dictyostellium Myosin Ii Length = 761 | Back alignment and structure |
| >pdb|1D0X|A Chain A, Dictyostelium Myosin S1dc (Motor Domain Fragment) Complexed With M-Nitrophenyl Aminoethyldiphosphate Beryllium Trifluoride. Length = 761 | Back alignment and structure |
| >pdb|3MNQ|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp- Metavanadate And Resveratrol Length = 788 | Back alignment and structure |
| >pdb|1W9I|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Befx Length = 770 | Back alignment and structure |
| >pdb|1W9K|A Chain A, Dictyostelium Discoideum Myosin Ii Motor Domain S456e With Bound Mgadp-Befx Length = 770 | Back alignment and structure |
| >pdb|2AKA|A Chain A, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 776 | Back alignment and structure |
| >pdb|2Y9E|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 | Back alignment and structure |
| >pdb|2Y0R|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 | Back alignment and structure |
| >pdb|2XEL|A Chain A, Molecular Mechanism Of Pentachloropseudilin Mediated Inhibition Of Myosin Motor Activity Length = 776 | Back alignment and structure |
| >pdb|2JHR|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentabromopseudilin Length = 788 | Back alignment and structure |
| >pdb|1W9L|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456e Bound With Mgadp-Alf4 Length = 770 | Back alignment and structure |
| >pdb|1W9J|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Alf4 Length = 770 | Back alignment and structure |
| >pdb|1G8X|A Chain A, Structure Of A Genetically Engineered Molecular Motor Length = 1010 | Back alignment and structure |
| >pdb|1LVK|A Chain A, X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N- Methylanthraniloyl) Nucleotide Bound To Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|1OE9|A Chain A, Crystal Structure Of Myosin V Motor With Essential Light Chain - Nucleotide-Free Length = 795 | Back alignment and structure |
| >pdb|1W8J|A Chain A, Crystal Structure Of Myosin V Motor Domain - Nucleotide-Free Length = 766 | Back alignment and structure |
| >pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State Length = 1080 | Back alignment and structure |
| >pdb|2OS8|A Chain A, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 840 | Back alignment and structure |
| >pdb|2EC6|A Chain A, Placopecten Striated Muscle Myosin Ii Length = 838 | Back alignment and structure |
| >pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840 | Back alignment and structure |
| >pdb|1B7T|A Chain A, Myosin Digested By Papain Length = 835 | Back alignment and structure |
| >pdb|1KK7|A Chain A, Scallop Myosin In The Near Rigor Conformation Length = 837 | Back alignment and structure |
| >pdb|1DFK|A Chain A, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 830 | Back alignment and structure |
| >pdb|1DFL|A Chain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831 | Back alignment and structure |
| >pdb|3I5G|A Chain A, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 839 | Back alignment and structure |
| >pdb|4DB1|A Chain A, Cardiac Human Myosin S1dc, Beta Isoform Complexed With Mn-Amppnp Length = 783 | Back alignment and structure |
| >pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 | Back alignment and structure |
| >pdb|3DTP|B Chain B, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 973 | Back alignment and structure |
| >pdb|3DTP|A Chain A, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 971 | Back alignment and structure |
| >pdb|1BR1|A Chain A, Smooth Muscle Myosin Motor Domain-Essential Light Chain Complex With Mgadp.Alf4 Bound At The Active Site Length = 820 | Back alignment and structure |
| >pdb|1BR2|A Chain A, Smooth Muscle Myosin Motor Domain Complexed With Mgadp.Alf4 Length = 791 | Back alignment and structure |
| >pdb|3J04|A Chain A, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 909 | Back alignment and structure |
| >pdb|2MYS|A Chain A, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 843 | Back alignment and structure |
| >pdb|1M8Q|A Chain A, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 840 | Back alignment and structure |
| >pdb|2X51|A Chain A, M6 Delta Insert1 Length = 789 | Back alignment and structure |
| >pdb|2VAS|A Chain A, Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigor State Length = 788 | Back alignment and structure |
| >pdb|4DBQ|A Chain A, Myosin Vi D179y (md-insert2-cam, Delta-insert1) Post-rigor State Length = 788 | Back alignment and structure |
| >pdb|2BKI|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal Structure Length = 858 | Back alignment and structure |
| >pdb|2YCU|A Chain A, Crystal Structure Of Human Non Muscle Myosin 2c In Pre-power Stroke State Length = 995 | Back alignment and structure |
| >pdb|3L9I|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant Crystal Structure Length = 814 | Back alignment and structure |
| >pdb|2V26|A Chain A, Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) Length = 784 | Back alignment and structure |
| >pdb|4E7S|A Chain A, Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke State Length = 798 | Back alignment and structure |
| >pdb|4E7Z|A Chain A, Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal Form Length = 798 | Back alignment and structure |
| >pdb|2BKH|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 814 | Back alignment and structure |
| >pdb|4DBR|A Chain A, Myosin Vi D179y (md) Pre-powerstroke State Length = 786 | Back alignment and structure |
| >pdb|4DBP|A Chain A, Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal Structure Length = 814 | Back alignment and structure |
| >pdb|4ANJ|A Chain A, Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke State (Mg.Adp.Alf4) Length = 1052 | Back alignment and structure |
| >pdb|1LKX|A Chain A, Motor Domain Of Myoe, A Class-I Myosin Length = 697 | Back alignment and structure |
| >pdb|4A7F|C Chain C, Structure Of The Actin-Tropomyosin-Myosin Complex (Rigor Atm 3) Length = 697 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 128 | |||
| 2v26_A | 784 | Myosin VI; calmodulin-binding, nucleotide-binding, | 1e-37 | |
| 1lkx_A | 697 | Myosin IE heavy chain; myosin motor domain, lever | 2e-36 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 7e-35 | |
| 1w7j_A | 795 | Myosin VA; motor protein, unconventional myosin, m | 1e-34 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 4e-33 | |
| 4db1_A | 783 | Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb | 6e-33 | |
| 1w9i_A | 770 | Myosin II heavy chain; molecular motor, ATPase, mo | 7e-33 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 8e-33 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 1e-32 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-31 |
| >2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784 | Back alignment and structure |
|---|
Score = 133 bits (337), Expect = 1e-37
Identities = 32/79 (40%), Positives = 49/79 (62%)
Query: 24 EYYYVTSFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEG 83
EY+ SFEQ CINY NE LQ +FN+ + + EQE Y KEG+ + + DN C+ L+E
Sbjct: 457 EYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEA 516
Query: 84 KPNGLLCVLDDQAKRGNAT 102
+ G+L +LD++ + +
Sbjct: 517 RLVGILDILDEENRLPQPS 535
|
| >1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Length = 697 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783 | Back alignment and structure |
|---|
| >1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770 | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 128 | |||
| 2v26_A | 784 | Myosin VI; calmodulin-binding, nucleotide-binding, | 100.0 | |
| 1lkx_A | 697 | Myosin IE heavy chain; myosin motor domain, lever | 100.0 | |
| 1w7j_A | 795 | Myosin VA; motor protein, unconventional myosin, m | 100.0 | |
| 4anj_A | 1052 | Unconventional myosin-VI, green fluorescent prote; | 100.0 | |
| 4db1_A | 783 | Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb | 100.0 | |
| 1w9i_A | 770 | Myosin II heavy chain; molecular motor, ATPase, mo | 100.0 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 100.0 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 100.0 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 100.0 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 100.0 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 100.0 |
| >2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=9.6e-37 Score=265.32 Aligned_cols=106 Identities=29% Similarity=0.486 Sum_probs=101.6
Q ss_pred CCCCcceeeecceeeecccCCCchhhhHhhhhhhhhhhhhhhhhhhhhhhhhhhcCcceeeeeeCCcHHHHHHHhcCCCc
Q psy14368 8 EQDTNVTRRDTQELKHEYYYVTSFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNG 87 (128)
Q Consensus 8 ~~~~~~~i~di~~lfE~f~~~NsfeQlciN~anEkLq~~~~~~if~~e~eey~~Egi~~~~i~~~dn~~~ldLi~~~p~G 87 (128)
.....+|||||+| ||+|+ .||||||||||||||||++|++++|+.||++|.+|||+|..++|.||++|+|||+++|.|
T Consensus 443 ~~~~~IGvLDI~G-FE~f~-~NsFEQlcINyaNEkLQq~F~~~~f~~EqeeY~~EgI~w~~i~f~DN~~~idLie~kp~G 520 (784)
T 2v26_A 443 TSSYFIGVLDIAG-FEYFE-HNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEARLVG 520 (784)
T ss_dssp CCSEEEEEEECCC-CCCCS-SCCHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHTTCCCCCCCCCCCHHHHHHHHCTTTS
T ss_pred cccceeeecccCC-cccCC-cCCHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHhcCCCcccccccChHHHHHHHhhcccc
Confidence 4457899999999 99999 999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccccchhhhhcCCCCchhHHHHhhhhhh
Q psy14368 88 LLCVLDDQAKRGNATLRYENMKLYIDTE 115 (128)
Q Consensus 88 ll~lLDeec~~p~~td~~~~~kl~~~~~ 115 (128)
||+||||||++|++||++|++||+....
T Consensus 521 IlslLDEe~~~p~~tD~~f~~kl~~~~~ 548 (784)
T 2v26_A 521 ILDILDEENRLPQPSDQHFTSAVHQKHK 548 (784)
T ss_dssp HHHHHHHHHHSSSCCHHHHHHHHHHHTT
T ss_pred HHHHHHHHhcCCCCChHHHHHHHHHHhC
Confidence 9999999999999999999999987554
|
| >1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A | Back alignment and structure |
|---|
| >4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} | Back alignment and structure |
|---|
| >4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* | Back alignment and structure |
|---|
| >1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 128 | ||||
| d1lkxa_ | 684 | c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli | 5e-18 | |
| d2mysa2 | 794 | c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain | 8e-17 | |
| d1kk8a2 | 789 | c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain | 2e-16 | |
| d1br2a2 | 710 | c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick | 9e-16 | |
| d1w7ja2 | 730 | c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick | 4e-15 | |
| d1d0xa2 | 712 | c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain | 4e-14 |
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Myosin S1, motor domain species: Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]
Score = 76.3 bits (187), Expect = 5e-18
Identities = 34/88 (38%), Positives = 51/88 (57%)
Query: 24 EYYYVTSFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEG 83
E + SFEQL IN+ NE LQ F + + EQEEY +EGI W++IE+ +N +L+E
Sbjct: 383 EVFQNNSFEQLNINFCNEKLQQLFIELTLKSEQEEYVREGIEWKNIEYFNNKPICELIEK 442
Query: 84 KPNGLLCVLDDQAKRGNATLRYENMKLY 111
KP GL+ +LD+ +T + +
Sbjct: 443 KPIGLISLLDEACLIAKSTDQTFLDSIC 470
|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730 | Back information, alignment and structure |
|---|
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 128 | |||
| d1d0xa2 | 712 | Myosin S1, motor domain {Dictyostelium discoideum | 99.97 | |
| d1lkxa_ | 684 | Myosin S1, motor domain {Dictyostelium discoideum, | 99.97 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 99.97 | |
| d1br2a2 | 710 | Myosin S1, motor domain {Chicken (Gallus gallus), | 99.97 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 99.97 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 99.96 |
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Myosin S1, motor domain species: Dictyostelium discoideum [TaxId: 44689]
Probab=99.97 E-value=2.1e-32 Score=234.22 Aligned_cols=109 Identities=40% Similarity=0.609 Sum_probs=95.1
Q ss_pred CCCCCCCcceeeecceeeecccCCCchhhhHhhhhhhhhhhhhhhhhhhhhhhhhhhcCcceeeeee-CCcHHHHHHHhc
Q psy14368 5 RATEQDTNVTRRDTQELKHEYYYVTSFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEF-SDNTLCLQLVEG 83 (128)
Q Consensus 5 ~~~~~~~~~~i~di~~lfE~f~~~NsfeQlciN~anEkLq~~~~~~if~~e~eey~~Egi~~~~i~~-~dn~~~ldLi~~ 83 (128)
.|......+||||||| ||+|+ .|||||||||||||+||++|++++|..++++|.+|||+|..++| .||++|++||++
T Consensus 395 ~~~~~~~~IgiLDifG-FE~f~-~NsfEQLcINyaNEkLQ~~f~~~~f~~eq~eY~~EgI~~~~i~~~~dn~~~~~Li~~ 472 (712)
T d1d0xa2 395 CQERKAYFIGVLDISG-FEIFK-VNSFEQLCINYTNEKLQQFFNHHMFKLEQEEYLKEKINWTFIDFGLDSQATIDLIDG 472 (712)
T ss_dssp CCSCCSEEEEEEECCC-CCCCS-SBCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCC--------CHHHHHHHHHC
T ss_pred ccCcccceeeeeeccc-ccccc-cCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCCcccccCCCcHHHHHHHhc
Confidence 3556677899999999 99999 99999999999999999999999999999999999999999999 599999999986
Q ss_pred -CCCcccccchhhhhcCCCCchhHHHHhhhhhh
Q psy14368 84 -KPNGLLCVLDDQAKRGNATLRYENMKLYIDTE 115 (128)
Q Consensus 84 -~p~Gll~lLDeec~~p~~td~~~~~kl~~~~~ 115 (128)
+|.|||++|||||++|+++|++|++|+.....
T Consensus 473 k~p~Gll~lLdee~~~~~~td~~~l~kl~~~~~ 505 (712)
T d1d0xa2 473 RQPPGILALLDEQSVFPNATDNTLITKLHSHFS 505 (712)
T ss_dssp TTTTCHHHHHHHHHTCTTCCHHHHHHHHHHHHT
T ss_pred cCCCcHHHHhHHHhcCCCCChHHHHHHHHHHhc
Confidence 48999999999999999999999999977543
|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|