Psyllid ID: psy14504


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-
MGIKNNSLNVNGKNILSQQDEEHIGYLKKYTIDLTEKARLGKLDPVIGRDDEIRRAIQVLQRRSKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPNSLLSKKILLLDIALLLAGTKYRGEFEDRLKKILKEISNNQKDIIIFIDELHTMIGTGKVEGSIDAGNMLKPELSRGELHCIGATTLNEYRQYIEKDAAFERRFQKILVEEPDIEETISILRGLQKKYEVHHGVEITDPAIVAASELSYRYISDRFMPDKAIDLIDEAAAKIKIEIDSKPEIMDKLERRLIQLKIEHEAIKREYDESSKKRLLLIKKEINKLEIKYANLEKIWKYEKTLIKDSQQIKEEIEKVRLKINKATRKSDWQTVSKLKYGELNKLERILKEKSQKDIQLPNNANKFTLLKTKVGSEEIAEIVSRTTGIPVSKIVQVEREKLLNIENLLCKRVVGQDEAISAVSNAIRRSRSGLSDAKRPYGSFMFLGPTGVGKTELCKTLSACIFNNEESIIRIDMSEFIEKHSISRLIGAPPGYIGYEEGGYLTEIVRRKPYSLILLDEIEKANSDVFNILLQILDDGRLTDNRGRTINFRNTIIVMTSNLGSDKIKEMEKGDKEIIKLAVMNEVKIYFRPEFINRIDDIIVFRYLNRKNILSIANIQLNILKNKLLKMNMDLKISKAALKKISNIGFDLIYGARDVHGCKKSLSILLKKIHKKSPEANFIFLGDLINKGPQSLDTLRMVYSMRNYAKIVLGNHEIHLLDVLININKKSKLDTFDDILDAPDKKKLVSWLRTQPLAIYYKKYLMIHAGVAKQWTAQQTIKLSHQVEKILRTSYWKNLFFKLYNHNSINWDNHLHTIHLNTIDKLQFIINTLTRTRFCKIDGTIEFIKKNIKNNNFQNNYIPWFDLPNRKTIDITVLFGHWSTLGLIMKPNIICLDTGCVWGNKLTALCLEDRSIIQVNNF
ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccccEEccccccHHHHHHHHHHHHHccccccccccccEEEEEHHHHHHccccccHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccccccccccccccccHHHHHHHcccHHHHHcccccccccccHHHHHHHHHcccHHHccccccccccHHHHHHHHHcccccccccccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHccHHHHHcccccHHHHHHHHHHHHHHHHccccccccccEEEEEEccccccHHHHHHHHHHHccccccccEEcccccccHHHHHHHHccccccccccccccccHHHHcccccEEEEEHHHHcccccHHHHHHHHHccccccccccccccccccEEEEcccccHHHHHHcccccHHHHHHHHHHHHHHcccccccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHccccEEccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccHHHHHHHcccccccccEEEEccccEEEEEcccEEEccccccHHHHHHHcccccccccHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEccccHHHHHHHHHHcccEEcccccHHHHHHHHccccccccccccccccccccEEEEEEEEcccccccccccccEEEEccccccccccccccccccccEEcccc
cHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHHcccccHHHHccHEEEEHHHHHHHHcccccHHHHHHHHHHHHHHHHcccEEEEEEcHHHHEccccccccccHHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHHHHcHHccccccHHHHHHHHHHHHHHHHHHcccEEccHHHHHHHHHccHccccccccHHHHHHHHHHHHHHHEEEcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccEEEEcccccccHHHHHHHHHHHHccccccEEEEcHHHHHHHHHHHHHccccccccccccccHHHHHHHccccEEEEEHHHHHHccHHHHHHHHHHcccccccccccEEEcccEEEEEEccccHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHcEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHccccccccccHHHHHHHHHHHHHccHHHHcHHHHHHHccccccccEEEEEccccEEEEccccEEEcccccEEHcHccHcccccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHEEHHHHHHHHHHHHHHccccEEccccHHHHHHHHccccccccccccccccccccEEEEEEEEccHHHHHHHccccEEEEcccccccccHEHEEcccccEEEEccc
mgiknnslnvngknilsqqDEEHIGYLKKYTIDLtekarlgkldpvigrdDEIRRAIQVLQRrsknnpvligepgvgKTAIVEGLAQRiingevpnsllsKKILLLDIALLLAGTKYRGEFEDRLKKILKEISNNQKDIIIFIDELHTmigtgkvegsidagnmlkpelsrgelhcigaTTLNEYRQYIEKDAAFERRFQKILVEEPDIEETISILRGLQKKYevhhgveitdpaIVAASELSYRYIsdrfmpdkaIDLIDEAAAKIKIEIDSKPEIMDKLERRLIQLKIEHEAIKREYDESSKKRLLLIKKEINKLEIKYANLEKIWKYEKTLIKDSQQIKEEIEKVRLKINKatrksdwqtvsKLKYGELNKLERILKEKsqkdiqlpnnankFTLLKTKVGSEEIAEIVSrttgipvskIVQVEREKLLNIENLLCKRVVGQDEAISAVSNAIRRSrsglsdakrpygsfmflgptgvgkteLCKTLSACifnneesiiridmseFIEKHSIsrligappgyigyeeggylteivrrkpyslILLDEIEKANSDVFNILLQIlddgrltdnrgrtinFRNTIIVMTSnlgsdkikEMEKGDKEIIKLAVMNEVkiyfrpefinriDDIIVFRYLNRKNILSIANIQLNILKNKLLKMNMDLKISKAALKKISNIGfdliygardvhgCKKSLSILLKKIhkkspeanfiflgdlinkgpqsldTLRMVYSMRNYAKIVLGNHEIHLLDVLINInkkskldtfddildapdkkKLVSWLRTQPLAIYYKKYLMIHAGVAKQWTAQQTIKLSHQVEKILRTSYWKNLFFKLYnhnsinwdnhlhtIHLNTIDKLQFIINTLTRTRFCKIDGTIEFIKKNiknnnfqnnyipwfdlpnrktidiTVLFGHwstlglimkpniicldtgcvwgNKLTAlcledrsiiqvnnf
mgiknnslnvngknilsqqdEEHIGYLKKYTidltekarlgkldpvigrddEIRRAIQvlqrrsknnpvligepgvGKTAIVEGLAQRIINGEVPNSLLSKKILLLDIALLLAGTKYRGEFEDRLKKILKEISNNQKDIIIFIDELHTMIGTGKVEGSIDAGNMLKPELSRGELHCIGATTLNEYRQYIEKDAAFERRFQKilveepdieeTISILRGLQKKYEVHHgveitdpaivAASELSYRYISDRFMPDKAIDLIDEAAAKIkieidskpeimdKLERRLIQLKIEheaikreydesskkrLLLIKKEINKLEIKYANLEKIWKYEKTLIKDSQQIKEEIEKVrlkinkatrksdwqtvsklkygelNKLERILKeksqkdiqlpnnankftllktkvgseEIAEivsrttgipvskivQVEREKLLNIENLlckrvvgqdeaisavsnairrsrsglsdakrpygSFMFLGPTGVGKTELCKTLSACIFNNEESIIRIDMSEFIEKHSISRLIGAPPGYIGYEEGGYLTEIVRRKPYSLILLDEIEKANSDVFNILLQilddgrltdnrgrtinfrntiivmtsnlgsdkikeMEKGDKEIIKLAVMNEVKIYFRPEFINRIDDIIVFRYLNRKNILSIANIQLNILKNKLLKMNMDLKISKAALKKISNIGFDLIYGARDVHGCKKSLSILLKKIHKKSPEANFIFLGDLINKGPQSLDTLRMVYSMRNYAKIVLGNHEIHLLDVLININKKSKLDTFddildapdkkklvsWLRTQPLAIYYKKYLMIHAGVAKQWTAQQTIKLSHQVEKILRTSYWKNLFFKLYNHNSINWDNHLHTIHLNTIDKLQFIINTLTRTRFCKIDGTIEFIKkniknnnfqnnyiPWFDLPNRKTIDITVLFGHWSTLGLIMKPNIICLDTGCVWGNKLTalcledrsiiqvnnf
MGIKNNSLNVNGKNILSQQDEEHIGYLKKYTIDLTEKARLGKLDPVIGRDDEIRRAIQVLQRRSKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPNsllskkillldialllaGTKYRGEFEDRLKKILKEISNNQKDIIIFIDELHTMIGTGKVEGSIDAGNMLKPELSRGELHCIGATTLNEYRQYIEKDAAFERRFQKILVEEPDIEETISILRGLQKKYEVHHGVEITDPAIVAASELSYRYISDRFMPdkaidlideaaakikieidskPEIMDKLERRLIQLKIEHEAIKREYDesskkrlllikkeinkleikYANLEKIWKYEKTLIKDSQQIKEEIEKVRLKINKATRKSDWQTVSKLKYGELNKLERILKEKSQKDIQLPNNANKFTLLKTKVGSEEIAEIVSRTTGIPVSKIVQVEREKLLNIENLLCKRVVGQDEAISAVSNAIRRSRSGLSDAKRPYGSFMFLGPTGVGKTELCKTLSACIFNNEESIIRIDMSEFIEKHSISRLIgappgyigyeeggyLTEIVRRKPYSLILLDEIEKANSDVFNILLQILDDGRLTDNRGRTINFRNTIIVMTSNLGSDKIKEMEKGDKEIIKLAVMNEVKIYFRPEFINRIDDIIVFRYLNRKNILSianiqlnilknkllkmnmdlkiSKAALKKISNIGFDLIYGARDVHGCkkslsillkkihkksPEANFIFLGDLINKGPQSLDTLRMVYSMRNYAKIVLGNHEIHLLDVLININKKSKLDTFDDILDAPDKKKLVSWLRTQPLAIYYKKYLMIHAGVAKQWTAQQTIKLSHQVEKILRTSYWKNLFFKLYNHNSINWDNHLHTIHLNTIDKLQFIINTLTRTRFCKIDGTIEfikkniknnnfqnnYIPWFDLPNRKTIDITVLFGHWSTLGLIMKPNIICLDTGCVWGNKLTALCLEDRSIIQVNNF
*********************EHIGYLKKYTIDLTEKARLGKLDPVIGRDDEIRRAIQVLQRRSKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPNSLLSKKILLLDIALLLAGTKYRGEFEDRLKKILKEISNNQKDIIIFIDELHTMIGTGKVEGSIDAGNMLKPELSRGELHCIGATTLNEYRQYIEKDAAFERRFQKILVEEPDIEETISILRGLQKKYEVHHGVEITDPAIVAASELSYRYISDRFMPDKAIDLIDEAAAKIKIEIDSKPEIMDKLERRLIQLKIEHEAIKREYD***KKRLLLIKKEINKLEIKYANLEKIWKYEKTLIKDSQQIKEEIEKVRLKINKATRKSDWQTVSKLKYGELNKLERIL************NANKFTLLKTKVGSEEIAEIVSRTTGIPVSKIVQVEREKLLNIENLLCKRVVGQDEAISAVSNA*************PYGSFMFLGPTGVGKTELCKTLSACIFNNEESIIRIDMSEFIEKHSISRLIGAPPGYIGYEEGGYLTEIVRRKPYSLILLDEIEKANSDVFNILLQILDDGRLTDNRGRTINFRNTIIVMTSNLGSDKIK***KGDKEIIKLAVMNEVKIYFRPEFINRIDDIIVFRYLNRKNILSIANIQLNILKNKLLKMNMDLKISKAALKKISNIGFDLIYGARDVHGCKKSLSILLKKIHKKSPEANFIFLGDLINKGPQSLDTLRMVYSMRNYAKIVLGNHEIHLLDVLININKKSKLDTFDDILDAPDKKKLVSWLRTQPLAIYYKKYLMIHAGVAKQWTAQQTIKLSHQVEKILRTSYWKNLFFKLYNHNSINWDNHLHTIHLNTIDKLQFIINTLTRTRFCKIDGTIEFIKKNIKNNNFQNNYIPWFDLPNRKTIDITVLFGHWSTLGLIMKPNIICLDTGCVWGNKLTALCLEDRSIIQ****
*G*K******************HIGYLKKYTIDLTEKARLGKLDPVIGRDDEIRRAIQVLQRRSKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPNSLLSKKILLLDIALLLAGTKYRGEFEDRLKKILKEISNNQKDIIIFIDELHTMIGTGKVEGSIDAGNMLKPELSRGELHCIGATTLNEYRQYIEKDAAFERRFQKILVEEPDIEETISILRGLQKKYEVHHGVEITDPAIVAASELSYRYISDRFMPDKAIDLIDEAAAKIKIEIDSKPEIMDKLERRLIQLKIE******************************************************EKVRLKINKATRKSDWQTVSKLKYGELNKLE*************************KVGSEEIAEIVSRTTGIPVSKIVQVEREKLLNIENLLCKRVVGQDEAISAVSNAIRRSRSGLSDAKRPYGSFMFLGPTGVGKTELCKTLSACIFNNEESIIRIDMSEFIEKHSISRLIGAPPGYIGYEEGGYLTEIVRRKPYSLILLDEIEKANSDVFNILLQILDDGRLTDNRGRTINFRNTIIVMTSNLGSDKI*************AVMNEVKIYFRPEFINRIDDIIVFRYLNRKNILSIANIQLNILKNKLLKMNMDLKISKAALKKISNIGFDLIYGARDVHGCKKSLSILLKKIHKKSPEANFIFLGDLINKGPQSLDTLRMVYSMRNYAKIVLGNHEIHLLDVLININKKSKLDTFDDILDAPDKKKLVSWLRTQPLAIYYKKYLMIHAGVAKQWTAQQTIKLSHQVEKILRTSYWKNLFFKLYNHNSINWDNHLHTIHLNTIDKLQFIINTLTRTRFCKIDGTIEFIKKNIKNNNFQNNYIPWFDLPNRKTIDITVLFGHWSTLGLIMKPNIICLDTGCVWGNKLTALCLEDRSIIQVNN*
MGIKNNSLNVNGKNILSQQDEEHIGYLKKYTIDLTEKARLGKLDPVIGRDDEIRRAIQVLQRRSKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPNSLLSKKILLLDIALLLAGTKYRGEFEDRLKKILKEISNNQKDIIIFIDELHTMIGTGKVEGSIDAGNMLKPELSRGELHCIGATTLNEYRQYIEKDAAFERRFQKILVEEPDIEETISILRGLQKKYEVHHGVEITDPAIVAASELSYRYISDRFMPDKAIDLIDEAAAKIKIEIDSKPEIMDKLERRLIQLKIEHEAIKREYDESSKKRLLLIKKEINKLEIKYANLEKIWKYEKTLIKDSQQIKEEIEKVRLKINKATRKSDWQTVSKLKYGELNKLERILKEKSQKDIQLPNNANKFTLLKTKVGSEEIAEIVSRTTGIPVSKIVQVEREKLLNIENLLCKRVVGQDEAISAVSNAIRRSRSGLSDAKRPYGSFMFLGPTGVGKTELCKTLSACIFNNEESIIRIDMSEFIEKHSISRLIGAPPGYIGYEEGGYLTEIVRRKPYSLILLDEIEKANSDVFNILLQILDDGRLTDNRGRTINFRNTIIVMTSNLGSDKIKEMEKGDKEIIKLAVMNEVKIYFRPEFINRIDDIIVFRYLNRKNILSIANIQLNILKNKLLKMNMDLKISKAALKKISNIGFDLIYGARDVHGCKKSLSILLKKIHKKSPEANFIFLGDLINKGPQSLDTLRMVYSMRNYAKIVLGNHEIHLLDVLININKKSKLDTFDDILDAPDKKKLVSWLRTQPLAIYYKKYLMIHAGVAKQWTAQQTIKLSHQVEKILRTSYWKNLFFKLYNHNSINWDNHLHTIHLNTIDKLQFIINTLTRTRFCKIDGTIEFIKKNIKNNNFQNNYIPWFDLPNRKTIDITVLFGHWSTLGLIMKPNIICLDTGCVWGNKLTALCLEDRSIIQVNNF
MGIKNNSLNVNGKNILSQQDEEHIGYLKKYTIDLTEKARLGKLDPVIGRDDEIRRAIQVLQRRSKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPNSLLSKKILLLDIALLLAGTKYRGEFEDRLKKILKEISNNQKDIIIFIDELHTMIGTGKVEGSIDAGNMLKPELSRGELHCIGATTLNEYRQYIEKDAAFERRFQKILVEEPDIEETISILRGLQKKYEVHHGVEITDPAIVAASELSYRYISDRFMPDKAIDLIDEAAAKIKIEIDSKPEIMDKLERRLIQLKIEHEAIKREYDESSKKRLLLIKKEINKLEIKYANLEKIWKYEKTLIKDSQQIKEEIEKVRLKINKATRKSDWQTVSKLKYGELNKLERILKEKSQKDIQL******FTLLKTKVGSEEIAEIVSRTTGIPVSKIVQVEREKLLNIENLLCKRVVGQDEAISAVSNAIRRSRSGLSDAKRPYGSFMFLGPTGVGKTELCKTLSACIFNNEESIIRIDMSEFIEKHSISRLIGAPPGYIGYEEGGYLTEIVRRKPYSLILLDEIEKANSDVFNILLQILDDGRLTDNRGRTINFRNTIIVMTSNLGSDKIKEMEKGDKEIIKLAVMNEVKIYFRPEFINRIDDIIVFRYLNRKNILSIANIQLNILKNKLLKMNMDLKISKAALKKISNIGFDLIYGARDVHGCKKSLSILLKKIHKKSPEANFIFLGDLINKGPQSLDTLRMVYSMRNYAKIVLGNHEIHLLDVLININKKSKLDTFDDILDAPDKKKLVSWLRTQPLAIYYKKYLMIHAGVAKQWTAQQTIKLSHQVEKILRTSYWKNLFFKLYNHNSINWDNHLHTIHLNTIDKLQFIINTLTRTRFCKIDGTIEFIKKNIKNNNFQNNYIPWFDLPNRKTIDITVLFGHWSTLGLIMKPNIICLDTGCVWGNKLTALCLEDRSIIQVNNF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGIKNNSLNVNGKNILSQQDEEHIGYLKKYTIDLTEKARLGKLDPVIGRDDEIRRAIQVLQRRSKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPNSLLSKKILLLDIALLLAGTKYRGEFEDRLKKILKEISNNQKDIIIFIDELHTMIGTGKVEGSIDAGNMLKPELSRGELHCIGATTLNEYRQYIEKDAAFERRFQKILVEEPDIEETISILRGLQKKYEVHHGVEITDPAIVAASELSYRYISDRFMPDKAIDLIDEAAAKIKIEIDSKPEIxxxxxxxxxxxxxxxxxxxxxxxxxxxxRxxxxxxxxxxxxxxxxxxxxxWKYEKTLIKDxxxxxxxxxxxxxxxxxxxxxSDWQTVSKLKYGELNKLERILKEKSQKDIQLPNNANKFTLLKTKVGSEEIAEIVSRTTGIPVSKIVQVEREKLLNIENLLCKRVVGQDEAISAVSNAIRRSRSGLSDAKRPYGSFMFLGPTGVGKTELCKTLSACIFNNEESIIRIDMSEFIEKHSISRLIGAPPGYIGYEEGGYLTEIVRRKPYSLILLDEIEKANSDVFNILLQILDDGRLTDNRGRTINFRNTIIVMTSNLGSDKIKEMEKGDKEIIKLAVMNEVKIYFRPEFINRIDDIIVFRYLNRKNILSIANIQLNILKNKLLKMNMDLKISKAALKKISNIGFDLIYGARDVHGCKKSLSILLKKIHKKSPEANFIFLGDLINKGPQSLDTLRMVYSMRNYAKIVLGNHEIHLLDVLININKKSKLDTFDDILDAPDKKKLVSWLRTQPLAIYYKKYLMIHAGVAKQWTAQQTIKLSHQVEKILRTSYWKNLFFKLYNHNSINWDNHLHTIHLNTIDKLQFIINTLTRTRFCKIDGTIEFIKKNIKNNNFQNNYIPWFDLPNRKTIDITVLFGHWSTLGLIMKPNIICLDTGCVWGNKLTALCLEDRSIIQVNNF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query951 2.2.26 [Sep-21-2011]
Q82SD8863 Chaperone protein ClpB OS yes N/A 0.709 0.782 0.661 0.0
Q7NWN7859 Chaperone protein ClpB OS yes N/A 0.708 0.784 0.662 0.0
Q8XZR0862 Chaperone protein ClpB OS yes N/A 0.708 0.781 0.659 0.0
Q9JTP9859 Chaperone protein ClpB OS yes N/A 0.705 0.781 0.638 0.0
Q9JYQ8859 Chaperone protein ClpB OS yes N/A 0.705 0.781 0.637 0.0
Q7WHB6865 Chaperone protein ClpB OS yes N/A 0.710 0.781 0.639 0.0
Q7W9E6865 Chaperone protein ClpB OS yes N/A 0.710 0.781 0.639 0.0
Q7VYV6865 Chaperone protein ClpB OS yes N/A 0.710 0.781 0.639 0.0
Q87AX8861 Chaperone protein ClpB OS yes N/A 0.747 0.825 0.588 0.0
Q9HVN5854 Chaperone protein ClpB OS yes N/A 0.712 0.793 0.610 0.0
>sp|Q82SD8|CLPB_NITEU Chaperone protein ClpB OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=clpB PE=3 SV=1 Back     alignment and function desciption
 Score =  949 bits (2452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/676 (66%), Positives = 567/676 (83%), Gaps = 1/676 (0%)

Query: 11  NGKNILSQQDEEHIGYLKKYTIDLTEKARLGKLDPVIGRDDEIRRAIQVLQRRSKNNPVL 70
            G+ +   + E     LKKYT+DLTE+AR GKLDPVIGRDDEIRR IQVLQRR+KNNPVL
Sbjct: 145 GGEKVTDAEAEGSREALKKYTLDLTERARSGKLDPVIGRDDEIRRTIQVLQRRTKNNPVL 204

Query: 71  IGEPGVGKTAIVEGLAQRIINGEVPNSLLSKKILLLDIALLLAGTKYRGEFEDRLKKILK 130
           IGEPGVGKTAIVEGLAQRI+NGEVP +L +K++L LD+A LLAG KYRGEFE+RLK +LK
Sbjct: 205 IGEPGVGKTAIVEGLAQRIVNGEVPETLKNKRVLSLDMAALLAGAKYRGEFEERLKAVLK 264

Query: 131 EISNNQKDIIIFIDELHTMIGTGKVEGSIDAGNMLKPELSRGELHCIGATTLNEYRQYIE 190
           E++ ++   I+FIDELHTM+G GK EG++DAGNMLKP L+RGELHC+GATTL+EYR+Y+E
Sbjct: 265 ELAQDEGRTIVFIDELHTMVGAGKAEGAMDAGNMLKPALARGELHCVGATTLDEYRKYVE 324

Query: 191 KDAAFERRFQKILVEEPDIEETISILRGLQKKYEVHHGVEITDPAIVAASELSYRYISDR 250
           KDAA ERRFQK+LV+EP +E TI+ILRGLQ+KYE+HHGVEITDPAIVAA+ELS+RYI+DR
Sbjct: 325 KDAALERRFQKVLVDEPGVEATIAILRGLQEKYELHHGVEITDPAIVAAAELSHRYITDR 384

Query: 251 FMPDKAIDLIDEAAAKIKIEIDSKPEIMDKLERRLIQLKIEHEAIKREYDESSKKRLLLI 310
           F+PDKAIDLIDEAAA+I++E DSKPE+MDKL+RRLIQLKIE EA+++E D++SKKRL L+
Sbjct: 385 FLPDKAIDLIDEAAARIRMEQDSKPEVMDKLDRRLIQLKIEREAVRKEKDDASKKRLALL 444

Query: 311 KKEINKLEIKYANLEKIWKYEKTLIKDSQQIKEEIEKVRLKINKATRKSDWQTVSKLKYG 370
           ++EI+KLE +YA+L++I K EK+  K SQ+IKEE++K+R +   A RK D Q  S+L YG
Sbjct: 445 EEEISKLEREYADLDEILKAEKSRAKGSQEIKEELDKLRREEEAARRKGDLQRASELLYG 504

Query: 371 ELNKLERILKEKSQKDIQLPNNANKFTLLKTKVGSEEIAEIVSRTTGIPVSKIVQVEREK 430
            + +LE  L E+     +    A +  L +T+VG+EEIAE+VSR TGIPVSK++Q EREK
Sbjct: 505 RIPQLEAQLAEQLHH-AESAEEAVQPKLFRTQVGAEEIAEVVSRATGIPVSKMMQGEREK 563

Query: 431 LLNIENLLCKRVVGQDEAISAVSNAIRRSRSGLSDAKRPYGSFMFLGPTGVGKTELCKTL 490
           LL +E+ L +RV+GQDEA+  VS+AIRRSRSGL+D  RPYGSF+FLGPTGVGKTELCK L
Sbjct: 564 LLFMEDKLHERVIGQDEAVRLVSDAIRRSRSGLADPNRPYGSFLFLGPTGVGKTELCKAL 623

Query: 491 SACIFNNEESIIRIDMSEFIEKHSISRLIGAPPGYIGYEEGGYLTEIVRRKPYSLILLDE 550
           +  +F++EE +IR+DMSEF+EKHS++RLIGAPPGY+GYEEGGYLTE VRRKPYS+ILLDE
Sbjct: 624 AGFLFDSEEHLIRVDMSEFMEKHSVARLIGAPPGYVGYEEGGYLTEQVRRKPYSVILLDE 683

Query: 551 IEKANSDVFNILLQILDDGRLTDNRGRTINFRNTIIVMTSNLGSDKIKEMEKGDKEIIKL 610
           +EKA+ DVFN+LLQ+LDDGR+TD +GRT++F+NT+IVMTSNLGS  I++M   D ++IKL
Sbjct: 684 VEKAHPDVFNVLLQVLDDGRMTDGQGRTVDFKNTVIVMTSNLGSQMIQQMSGDDYQVIKL 743

Query: 611 AVMNEVKIYFRPEFINRIDDIIVFRYLNRKNILSIANIQLNILKNKLLKMNMDLKISKAA 670
           AVM EVK YFRPEFINRID+++VF  L   +I SIA IQL+ L  +L +M M L +S+ A
Sbjct: 744 AVMGEVKTYFRPEFINRIDEVVVFHALGEAHIKSIARIQLSNLGKRLAQMEMKLVVSEPA 803

Query: 671 LKKISNIGFDLIYGAR 686
           L K++ +GFD ++GAR
Sbjct: 804 LTKLAEVGFDPVFGAR 819




Part of a stress-induced multi-chaperone system, it is involved in the recovery of the cell from heat-induced damage, in cooperation with DnaK, DnaJ and GrpE. Acts before DnaK, in the processing of protein aggregates. Protein binding stimulates the ATPase activity; ATP hydrolysis unfolds the denatured protein aggregates, which probably helps expose new hydrophobic binding sites on the surface of ClpB-bound aggregates, contributing to the solubilization and refolding of denatured protein aggregates by DnaK.
Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) (taxid: 228410)
>sp|Q7NWN7|CLPB_CHRVO Chaperone protein ClpB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=clpB PE=3 SV=1 Back     alignment and function description
>sp|Q8XZR0|CLPB_RALSO Chaperone protein ClpB OS=Ralstonia solanacearum (strain GMI1000) GN=clpB PE=3 SV=1 Back     alignment and function description
>sp|Q9JTP9|CLPB_NEIMA Chaperone protein ClpB OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=clpB PE=3 SV=1 Back     alignment and function description
>sp|Q9JYQ8|CLPB_NEIMB Chaperone protein ClpB OS=Neisseria meningitidis serogroup B (strain MC58) GN=clpB PE=3 SV=1 Back     alignment and function description
>sp|Q7WHB6|CLPB_BORBR Chaperone protein ClpB OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=clpB PE=3 SV=1 Back     alignment and function description
>sp|Q7W9E6|CLPB_BORPA Chaperone protein ClpB OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=clpB PE=3 SV=1 Back     alignment and function description
>sp|Q7VYV6|CLPB_BORPE Chaperone protein ClpB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=clpB PE=3 SV=1 Back     alignment and function description
>sp|Q87AX8|CLPB_XYLFT Chaperone protein ClpB OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=clpB PE=3 SV=1 Back     alignment and function description
>sp|Q9HVN5|CLPB_PSEAE Chaperone protein ClpB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=clpB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query951
399020377863 ATP-dependent chaperone ClpB [Herbaspiri 0.710 0.783 0.704 0.0
398835100794 ATP-dependent chaperone ClpB, partial [H 0.709 0.850 0.707 0.0
340787492867 ClpB protein [Collimonas fungivorans Ter 0.710 0.779 0.703 0.0
409405922862 ATP-dependent Clp protease subunit [Herb 0.709 0.783 0.714 0.0
300311426861 ATP-dependent Clp protease subunit [Herb 0.709 0.783 0.713 0.0
415902608852 Heat-shock protein, ATP-dependent Clp pr 0.709 0.792 0.708 0.0
124483534861 ATP-dependent Clp protease subunit (heat 0.709 0.783 0.710 0.0
329912608867 ClpB protein [Oxalobacteraceae bacterium 0.710 0.779 0.687 0.0
253995931863 ATP-dependent chaperone ClpB [Methyloten 0.747 0.823 0.651 0.0
82702670869 ATPase with chaperone activity [Nitrosos 0.710 0.777 0.677 0.0
>gi|399020377|ref|ZP_10722510.1| ATP-dependent chaperone ClpB [Herbaspirillum sp. CF444] gi|398095138|gb|EJL85485.1| ATP-dependent chaperone ClpB [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
 Score = 1020 bits (2637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/676 (70%), Positives = 594/676 (87%)

Query: 11  NGKNILSQQDEEHIGYLKKYTIDLTEKARLGKLDPVIGRDDEIRRAIQVLQRRSKNNPVL 70
            G ++ SQ+ E     LKKYT+DLTE+AR GKLDPVIGRDDEIRRAIQVLQRRSKNNPVL
Sbjct: 145 GGASVSSQEGEGQRESLKKYTLDLTERARNGKLDPVIGRDDEIRRAIQVLQRRSKNNPVL 204

Query: 71  IGEPGVGKTAIVEGLAQRIINGEVPNSLLSKKILLLDIALLLAGTKYRGEFEDRLKKILK 130
           IGEPGVGKTAIVEGLAQRI++GEVP+SL SK++L LD+A LLAG KYRGEFE+RLK +LK
Sbjct: 205 IGEPGVGKTAIVEGLAQRIVSGEVPDSLKSKRVLSLDMAALLAGAKYRGEFEERLKAVLK 264

Query: 131 EISNNQKDIIIFIDELHTMIGTGKVEGSIDAGNMLKPELSRGELHCIGATTLNEYRQYIE 190
           EI+ ++   I+FIDELHTM+G GK EG++DAGNMLKP L+RGELHC+GATTL+EYR+YIE
Sbjct: 265 EIAQDEGQTIVFIDELHTMVGAGKAEGAMDAGNMLKPALARGELHCVGATTLDEYRKYIE 324

Query: 191 KDAAFERRFQKILVEEPDIEETISILRGLQKKYEVHHGVEITDPAIVAASELSYRYISDR 250
           KDAA ERRFQKI+V+EP +E TI+ILRGLQ+KYEVHHGV+ITDPAIVAA+ELS+RYI+DR
Sbjct: 325 KDAALERRFQKIIVDEPSVEATIAILRGLQEKYEVHHGVDITDPAIVAAAELSHRYITDR 384

Query: 251 FMPDKAIDLIDEAAAKIKIEIDSKPEIMDKLERRLIQLKIEHEAIKREYDESSKKRLLLI 310
           F+PDKAIDLIDEAAAKIKIEIDSKPE+MDKL+RRLIQLKIE EA+KRE DE+S+KRL LI
Sbjct: 385 FLPDKAIDLIDEAAAKIKIEIDSKPEVMDKLDRRLIQLKIEREAVKREKDEASQKRLTLI 444

Query: 311 KKEINKLEIKYANLEKIWKYEKTLIKDSQQIKEEIEKVRLKINKATRKSDWQTVSKLKYG 370
           ++EI KLE +YA+LE+IWK EK  ++ SQ +KEEIE++RL++++ATRKSDWQ VS+LKYG
Sbjct: 445 EEEIVKLEREYADLEEIWKSEKATVQGSQHLKEEIERIRLQMDEATRKSDWQKVSELKYG 504

Query: 371 ELNKLERILKEKSQKDIQLPNNANKFTLLKTKVGSEEIAEIVSRTTGIPVSKIVQVEREK 430
           +L +LE+ L+ +S++D     N +K  L++T+VG+EEIAEIV+R TGIPVS+++Q EREK
Sbjct: 505 KLAELEKALETQSKQDAASEQNVSKPRLVRTQVGAEEIAEIVARATGIPVSRMMQGEREK 564

Query: 431 LLNIENLLCKRVVGQDEAISAVSNAIRRSRSGLSDAKRPYGSFMFLGPTGVGKTELCKTL 490
           LL++E +L +RVVGQDEAI AVS+AIRRSR+GL D  +PYGSFMFLGPTGVGKTELCK L
Sbjct: 565 LLHMEEVLHQRVVGQDEAIVAVSDAIRRSRAGLGDPSKPYGSFMFLGPTGVGKTELCKAL 624

Query: 491 SACIFNNEESIIRIDMSEFIEKHSISRLIGAPPGYIGYEEGGYLTEIVRRKPYSLILLDE 550
           ++ +F+ EE++IRIDMSEF+EKHS++RLIGAPPGY+GYEEGGYLTE VRRKPYS+ILLDE
Sbjct: 625 ASYLFDTEEAMIRIDMSEFMEKHSVARLIGAPPGYVGYEEGGYLTEAVRRKPYSVILLDE 684

Query: 551 IEKANSDVFNILLQILDDGRLTDNRGRTINFRNTIIVMTSNLGSDKIKEMEKGDKEIIKL 610
           IEKA+ DVFN+LLQ+LDDGR+TD +GRT++F+NT+IVMTSNLGS KI+ ME  D  ++K+
Sbjct: 685 IEKAHPDVFNVLLQVLDDGRMTDGQGRTVDFKNTVIVMTSNLGSHKIQAMEDSDPAVVKM 744

Query: 611 AVMNEVKIYFRPEFINRIDDIIVFRYLNRKNILSIANIQLNILKNKLLKMNMDLKISKAA 670
           AVM EV+++FRPEFINR+D+I+VF  L+ KNI +IA IQL+IL+ +L +M++ L IS A 
Sbjct: 745 AVMAEVRLHFRPEFINRVDEIVVFHALDEKNIGAIAKIQLHILEERLARMDIGLVISDAG 804

Query: 671 LKKISNIGFDLIYGAR 686
           L+KI+  GFD +YGAR
Sbjct: 805 LQKIAEAGFDPVYGAR 820




Source: Herbaspirillum sp. CF444

Species: Herbaspirillum sp. CF444

Genus: Herbaspirillum

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria

>gi|398835100|ref|ZP_10592480.1| ATP-dependent chaperone ClpB, partial [Herbaspirillum sp. YR522] gi|398218198|gb|EJN04711.1| ATP-dependent chaperone ClpB, partial [Herbaspirillum sp. YR522] Back     alignment and taxonomy information
>gi|340787492|ref|YP_004752957.1| ClpB protein [Collimonas fungivorans Ter331] gi|340552759|gb|AEK62134.1| ClpB protein [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
>gi|409405922|ref|ZP_11254384.1| ATP-dependent Clp protease subunit [Herbaspirillum sp. GW103] gi|386434471|gb|EIJ47296.1| ATP-dependent Clp protease subunit [Herbaspirillum sp. GW103] Back     alignment and taxonomy information
>gi|300311426|ref|YP_003775518.1| ATP-dependent Clp protease subunit [Herbaspirillum seropedicae SmR1] gi|300074211|gb|ADJ63610.1| ATP-dependent Clp protease subunit (heat-shock) protein [Herbaspirillum seropedicae SmR1] Back     alignment and taxonomy information
>gi|415902608|ref|ZP_11552111.1| Heat-shock protein, ATP-dependent Clp protease subunit [Herbaspirillum frisingense GSF30] gi|407763849|gb|EKF72441.1| Heat-shock protein, ATP-dependent Clp protease subunit [Herbaspirillum frisingense GSF30] Back     alignment and taxonomy information
>gi|124483534|emb|CAM32640.1| ATP-dependent Clp protease subunit (heat-shock) protein [Herbaspirillum seropedicae] Back     alignment and taxonomy information
>gi|329912608|ref|ZP_08275778.1| ClpB protein [Oxalobacteraceae bacterium IMCC9480] gi|327545580|gb|EGF30751.1| ClpB protein [Oxalobacteraceae bacterium IMCC9480] Back     alignment and taxonomy information
>gi|253995931|ref|YP_003047995.1| ATP-dependent chaperone ClpB [Methylotenera mobilis JLW8] gi|253982610|gb|ACT47468.1| ATP-dependent chaperone ClpB [Methylotenera mobilis JLW8] Back     alignment and taxonomy information
>gi|82702670|ref|YP_412236.1| ATPase with chaperone activity [Nitrosospira multiformis ATCC 25196] gi|82410735|gb|ABB74844.1| ATPase with chaperone activity [Nitrosospira multiformis ATCC 25196] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query951
TIGR_CMR|CBU_0094859 CBU_0094 "clpB protein" [Coxie 0.715 0.791 0.544 3.6e-192
UNIPROTKB|Q889C2854 clpB "Chaperone protein ClpB" 0.711 0.792 0.548 9.8e-190
UNIPROTKB|Q9KU18857 clpB "Chaperone protein ClpB" 0.703 0.780 0.535 1.7e-187
TIGR_CMR|VC_0711857 VC_0711 "clpB protein" [Vibrio 0.703 0.780 0.535 1.7e-187
UNIPROTKB|P63284857 clpB "ClpB chaperone" [Escheri 0.703 0.780 0.528 1.4e-185
TIGR_CMR|SO_3577857 SO_3577 "clpB protein" [Shewan 0.703 0.780 0.531 1.8e-183
TIGR_CMR|CPS_3913861 CPS_3913 "ATP-dependent chaper 0.702 0.775 0.519 1.6e-180
UNIPROTKB|Q75GT3978 CLPB2 "Chaperone protein ClpB2 0.712 0.693 0.496 1.3e-169
TAIR|locus:2180922968 CLPB3 "casein lytic proteinase 0.719 0.706 0.485 8.5e-168
TIGR_CMR|BA_1177866 BA_1177 "ATP-dependent Clp pro 0.710 0.780 0.478 6.2e-165
TIGR_CMR|CBU_0094 CBU_0094 "clpB protein" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
 Score = 1862 (660.5 bits), Expect = 3.6e-192, P = 3.6e-192
 Identities = 373/685 (54%), Positives = 485/685 (70%)

Query:     3 IKNNSLNVN-GKNILSQQDEEHIGYLKKYTIDLTEKARLGKLDPVIGRDDEIRRAIQVLQ 61
             I+ N +N+  G+ +  Q  E+    L KYTIDLTEKA  GKLDPVIGRD+EIRR +QVLQ
Sbjct:   136 IEKNIMNLRKGERVTEQSAEDQRQALAKYTIDLTEKAETGKLDPVIGRDEEIRRTVQVLQ 195

Query:    62 RRSKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPNXXXXXXXXXXXXXXXXXGTKYRGEF 121
             RR+KNNPVLIGEPGVGKTAIVEGLAQRI+NGEVP                  G K+RGEF
Sbjct:   196 RRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGEVPEGLKQKRLLALDMGALIAGAKFRGEF 255

Query:   122 EDRLKKILKEISNNQKDIIIFIDELHTMIGTGKVEGSIDAGNMLKPELSRGELHCIGATT 181
             E+RLK +LK+I+  +  +I+FIDELHTM+G GK EG++DAGNMLKP L+RGELHC+GATT
Sbjct:   256 EERLKAVLKDIAKEEGRVILFIDELHTMVGAGKAEGAMDAGNMLKPALARGELHCVGATT 315

Query:   182 LNEYRQYIEKDAAFERRFQKILVEEPDIEETISILRGLQKKYEVHHGVEITDPAIVAASE 241
             L+EYR+YIEKDAA ERRFQK+LVEEP  E+ I+ILRGL+++YEVHHGVEITDPAI+AA+ 
Sbjct:   316 LDEYRKYIEKDAALERRFQKVLVEEPSTEDAIAILRGLKERYEVHHGVEITDPAIIAAAT 375

Query:   242 LSYRYISDRFMPXXXXXXXXXXXXXXXXXXXXXPEIMDKLERRLIQLKIEHEAIKREYDX 301
             LS RYI+DR +P                     P  +D+LERRLIQLKIE EA+K+E D 
Sbjct:   376 LSQRYITDRNLPDKAIDLIDEAASQIRMEMDSKPVELDRLERRLIQLKIEREALKKETDE 435

Query:   302 XXXXXXXXXXXXXXXXXXXYANLEKIWKYEKTLIKDSQQIKEEIEKVRLKINKATRKSDW 361
                                Y++LE++WK EK  +  +QQIKEE+E+ R+++  A R  D 
Sbjct:   436 ASKKRLSDLETEIKNVEKEYSDLEEVWKSEKASLHGTQQIKEELEQARIELEAAGRAGDL 495

Query:   362 QTVSKLKYGELNKLERILKEKSQKDIQLPNNANKFTLLKTKVGSEEIAEIVSRTTGIPVS 421
               +S+L+YG + +L++ LK  SQK+ Q  ++     LL+++V  EE+AE+VS+ T IPVS
Sbjct:   496 ARMSELQYGIIPELDKKLKAASQKEEQFHDHK----LLRSRVTEEEVAEVVSKWTHIPVS 551

Query:   422 KIVQVEREKLLNIENLLCKRVVGQDEAISAVSNAIRRSRSGLSDAKRPYGSFMFLGPTGV 481
             K+++ EREKLL++E  L KRV+GQDEA++AV+NAIRRSR+GLSD  RP GSF+FLGPTGV
Sbjct:   552 KMLEGEREKLLHMETELHKRVIGQDEAVNAVANAIRRSRAGLSDPNRPVGSFLFLGPTGV 611

Query:   482 GKTELCKTLSACIFNNEESIIRIDMSEFIEKHSISRLIXXXXXXXXXXXXXXLTEIVRRK 541
             GKTELCK L+  +F+ E++++RIDMSEF+EKHS++RLI              LTE +RR+
Sbjct:   612 GKTELCKALAVFLFDTEDAMVRIDMSEFMEKHSVARLIGAPPGYVGYEEGGYLTEAIRRR 671

Query:   542 PYSLILLDEIEKANSDVFNILLQILDDGRLTDNRGRTINFRNTIIVMTSNLGSDKIKEME 601
             PYS+ILLDEIEKA++DVFN+LLQ+LDDGRLTD +GRT++FRNT+IVMTSNLGSD I+E  
Sbjct:   672 PYSVILLDEIEKAHNDVFNVLLQVLDDGRLTDGQGRTVDFRNTVIVMTSNLGSDLIREFS 731

Query:   602 KGDKEIIKLAVMNEVKIYFRPEFINRIDDIIVFRYLNRKNILSXXXXXXXXXXXXXXXXX 661
               + + +K AVM  V  +FRPEFINRID+ +VF  L ++ I +                 
Sbjct:   732 GENYDKMKDAVMEVVAQHFRPEFINRIDEAVVFHSLKKEQIRNIAIIQIDRIKKRLKEKD 791

Query:   662 XXXXXSKAALKKISNIGFDLIYGAR 686
                  S  AL  +S +G+D +YGAR
Sbjct:   792 YQLTISDDALDYLSELGYDPVYGAR 816




GO:0006508 "proteolysis" evidence=ISS
GO:0016887 "ATPase activity" evidence=ISS
UNIPROTKB|Q889C2 clpB "Chaperone protein ClpB" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KU18 clpB "Chaperone protein ClpB" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0711 VC_0711 "clpB protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|P63284 clpB "ClpB chaperone" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|SO_3577 SO_3577 "clpB protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3913 CPS_3913 "ATP-dependent chaperone protein ClpB" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q75GT3 CLPB2 "Chaperone protein ClpB2, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2180922 CLPB3 "casein lytic proteinase B3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|BA_1177 BA_1177 "ATP-dependent Clp protease, ATP-binding subunit ClpB" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q98G96CLPB_RHILONo assigned EC number0.51920.73600.8064yesN/A
Q7W9E6CLPB_BORPANo assigned EC number0.63950.71080.7815yesN/A
Q6LMY0CLPB_PHOPRNo assigned EC number0.61150.70450.7817yesN/A
Q8DEV2CLPB_VIBVUNo assigned EC number0.61440.70450.7817yesN/A
Q87AX8CLPB_XYLFTNo assigned EC number0.58870.74760.8257yesN/A
Q7UBW5CLPB_SHIFLNo assigned EC number0.59670.70450.7817yesN/A
Q9LF37CLPB3_ARATHNo assigned EC number0.55680.71290.7004yesN/A
Q83F55CLPB_COXBUNo assigned EC number0.60380.75070.8311yesN/A
Q8EBE6CLPB_SHEONNo assigned EC number0.58340.73390.8144yesN/A
Q7VQF3CLPB_BLOFLNo assigned EC number0.60570.68660.7488yesN/A
Q9HVN5CLPB_PSEAENo assigned EC number0.61070.71290.7939yesN/A
Q88Q71CLPB_PSEPKNo assigned EC number0.62760.69290.7716yesN/A
Q8YJ91CLPB_BRUMENo assigned EC number0.53170.72870.7929yesN/A
Q7WHB6CLPB_BORBRNo assigned EC number0.63950.71080.7815yesN/A
Q6MIV0CLPB_BDEBANo assigned EC number0.54780.70970.7894yesN/A
Q7VNH1CLPB_HAEDUNo assigned EC number0.57220.73600.8177yesN/A
Q7NFE9CLPB_GLOVINo assigned EC number0.55760.70660.7706yesN/A
Q9CKC0CLPB_PASMUNo assigned EC number0.60500.70450.7836yesN/A
Q9PGC1CLPB_XYLFANo assigned EC number0.58450.74760.8257yesN/A
Q8P6A0CLPB_XANCPNo assigned EC number0.61870.70240.7758yesN/A
Q8YM56CLPB2_NOSS1No assigned EC number0.54360.71600.7809yesN/A
Q9JYQ8CLPB_NEIMBNo assigned EC number0.63710.70550.7811yesN/A
Q7NWN7CLPB_CHRVONo assigned EC number0.66270.70870.7846yesN/A
Q9JTP9CLPB_NEIMANo assigned EC number0.63860.70550.7811yesN/A
Q7VYV6CLPB_BORPENo assigned EC number0.63950.71080.7815yesN/A
Q889C2CLPB_PSESMNo assigned EC number0.63220.69920.7786yesN/A
Q7CEG6CLPB_BRUSUNo assigned EC number0.53310.72870.7929yesN/A
Q82SD8CLPB_NITEUNo assigned EC number0.66120.70970.7821yesN/A
Q9KU18CLPB_VIBCHNo assigned EC number0.60850.70450.7817yesN/A
Q74X11CLPB_YERPENo assigned EC number0.57740.73810.8191yesN/A
Q7X2S8CLPB_MEIRUNo assigned EC number0.55600.70240.7822yesN/A
P44403CLPB_HAEINNo assigned EC number0.60790.70450.7827yesN/A
Q9A9T4CLPB_CAUCRNo assigned EC number0.55200.71180.7881yesN/A
P53533CLPB1_SYNE7No assigned EC number0.56190.70870.7711yesN/A
P63286CLPB_ECOL6No assigned EC number0.60260.70450.7817yesN/A
Q9RVI3CLPB_DEIRANo assigned EC number0.55750.70030.7816yesN/A
P17422CLPB_DICNONo assigned EC number0.59460.70550.7802yesN/A
Q6N1H2CLPB_RHOPANo assigned EC number0.55180.70970.7679yesN/A
Q8PHQ4CLPB_XANACNo assigned EC number0.61290.70240.7758yesN/A
Q7MNK1CLPB_VIBVYNo assigned EC number0.61440.70450.7817yesN/A
Q8XZR0CLPB_RALSONo assigned EC number0.65970.70870.7819yesN/A
Q87S63CLPB_VIBPANo assigned EC number0.61290.70450.7817yesN/A
Q7CQ01CLPB_SALTYNo assigned EC number0.60110.70450.7817yesN/A
Q7N788CLPB_PHOLLNo assigned EC number0.57380.73920.8203yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.10.691
3rd Layer3.6.1.41LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query951
TIGR03346852 TIGR03346, chaperone_ClpB, ATP-dependent chaperone 0.0
PRK10865857 PRK10865, PRK10865, protein disaggregation chapero 0.0
COG0542786 COG0542, clpA, ATP-binding subunits of Clp proteas 0.0
CHL00095821 CHL00095, clpC, Clp protease ATP binding subunit 0.0
TIGR03345852 TIGR03345, VI_ClpV1, type VI secretion ATPase, Clp 0.0
TIGR02639730 TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi 1e-111
PRK00166275 PRK00166, apaH, diadenosine tetraphosphatase; Revi 1e-107
cd07422257 cd07422, MPP_ApaH, Escherichia coli ApaH and relat 1e-103
TIGR02639730 TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi 2e-94
PRK11034758 PRK11034, clpA, ATP-dependent Clp protease ATP-bin 6e-88
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 5e-81
PRK11034758 PRK11034, clpA, ATP-dependent Clp protease ATP-bin 2e-70
TIGR00668279 TIGR00668, apaH, bis(5'-nucleosyl)-tetraphosphatas 7e-59
cd00144225 cd00144, MPP_PPP_family, phosphoprotein phosphatas 4e-23
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 2e-18
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 4e-17
cd07413222 cd07413, MPP_PA3087, Pseudomonas aeruginosa PA3087 2e-12
smart00382148 smart00382, AAA, ATPases associated with a variety 4e-12
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 8e-12
pfam00004131 pfam00004, AAA, ATPase family associated with vari 2e-10
cd07423234 cd07423, MPP_PrpE, Bacillus subtilis PrpE and rela 3e-10
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 6e-10
pfam1043181 pfam10431, ClpB_D2-small, C-terminal, D2-small dom 2e-08
TIGR04075 851 TIGR04075, bacter_Pnkp, polynucleotide kinase-phos 3e-08
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 5e-07
smart00382148 smart00382, AAA, ATPases associated with a variety 1e-06
smart0108690 smart01086, ClpB_D2-small, C-terminal, D2-small do 3e-06
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 6e-06
cd07424207 cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophos 6e-06
pfam00149185 pfam00149, Metallophos, Calcineurin-like phosphoes 9e-06
PRK11439218 PRK11439, pphA, serine/threonine protein phosphata 2e-05
cd00838131 cd00838, MPP_superfamily, metallophosphatase super 2e-05
pfam13401124 pfam13401, AAA_22, AAA domain 2e-05
PRK13625245 PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphospha 3e-05
PHA02239235 PHA02239, PHA02239, putative protein phosphatase 4e-05
PRK09968218 PRK09968, PRK09968, serine/threonine-specific prot 4e-05
pfam13401124 pfam13401, AAA_22, AAA domain 6e-05
pfam00004131 pfam00004, AAA, ATPase family associated with vari 9e-05
TIGR04075 851 TIGR04075, bacter_Pnkp, polynucleotide kinase-phos 9e-05
cd07423234 cd07423, MPP_PrpE, Bacillus subtilis PrpE and rela 3e-04
smart00156271 smart00156, PP2Ac, Protein phosphatase 2A homologu 5e-04
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 6e-04
COG3899849 COG3899, COG3899, Predicted ATPase [General functi 0.001
COG5271 4600 COG5271, MDN1, AAA ATPase containing von Willebran 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.003
cd07414293 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-li 0.003
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 0.003
TIGR03922557 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas 0.004
>gnl|CDD|234173 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB Back     alignment and domain information
 Score = 1127 bits (2917), Expect = 0.0
 Identities = 421/676 (62%), Positives = 553/676 (81%), Gaps = 5/676 (0%)

Query: 12  GKNILSQQDEEHIGYLKKYTIDLTEKARLGKLDPVIGRDDEIRRAIQVLQRRSKNNPVLI 71
           G+ + S   E+    L+KY  DLTE+AR GKLDPVIGRD+EIRR IQVL RR+KNNPVLI
Sbjct: 141 GQKVTSANAEDQYEALEKYARDLTERAREGKLDPVIGRDEEIRRTIQVLSRRTKNNPVLI 200

Query: 72  GEPGVGKTAIVEGLAQRIINGEVPNSLLSKKILLLDIALLLAGTKYRGEFEDRLKKILKE 131
           GEPGVGKTAIVEGLAQRI+NG+VP SL +K++L LD+  L+AG KYRGEFE+RLK +L E
Sbjct: 201 GEPGVGKTAIVEGLAQRIVNGDVPESLKNKRLLALDMGALIAGAKYRGEFEERLKAVLNE 260

Query: 132 ISNNQKDIIIFIDELHTMIGTGKVEGSIDAGNMLKPELSRGELHCIGATTLNEYRQYIEK 191
           ++ ++  II+FIDELHT++G GK EG++DAGNMLKP L+RGELHCIGATTL+EYR+YIEK
Sbjct: 261 VTKSEGQIILFIDELHTLVGAGKAEGAMDAGNMLKPALARGELHCIGATTLDEYRKYIEK 320

Query: 192 DAAFERRFQKILVEEPDIEETISILRGLQKKYEVHHGVEITDPAIVAASELSYRYISDRF 251
           DAA ERRFQ + V+EP +E+TISILRGL+++YEVHHGV ITDPAIVAA+ LS+RYI+DRF
Sbjct: 321 DAALERRFQPVFVDEPTVEDTISILRGLKERYEVHHGVRITDPAIVAAATLSHRYITDRF 380

Query: 252 MPDKAIDLIDEAAAKIKIEIDSKPEIMDKLERRLIQLKIEHEAIKREYDESSKKRLLLIK 311
           +PDKAIDLIDEAAA+I++EIDSKPE +D+L+RR+IQL+IE EA+K+E DE+SK+RL  ++
Sbjct: 381 LPDKAIDLIDEAAARIRMEIDSKPEELDELDRRIIQLEIEREALKKEKDEASKERLEDLE 440

Query: 312 KEINKLEIKYANLEKIWKYEKTLIKDSQQIKEEIEKVRLKINKATRKSDWQTVSKLKYGE 371
           KE+ +LE +YA+LE+ WK EK  I+  QQIKEEIE+VRL++ +A R+ D    ++L+YG+
Sbjct: 441 KELAELEEEYADLEEQWKAEKAAIQGIQQIKEEIEQVRLELEQAEREGDLAKAAELQYGK 500

Query: 372 LNKLERILKEKSQKDIQLPNNANKFTLLKTKVGSEEIAEIVSRTTGIPVSKIVQVEREKL 431
           L +LE+ L+    K  +         LL+ +V +EEIAE+VSR TGIPVSK+++ EREKL
Sbjct: 501 LPELEKRLQAAEAKLGEETKPR----LLREEVTAEEIAEVVSRWTGIPVSKMLEGEREKL 556

Query: 432 LNIENLLCKRVVGQDEAISAVSNAIRRSRSGLSDAKRPYGSFMFLGPTGVGKTELCKTLS 491
           L++E +L +RVVGQDEA+ AVS+AIRRSR+GLSD  RP GSF+FLGPTGVGKTEL K L+
Sbjct: 557 LHMEEVLHERVVGQDEAVEAVSDAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELAKALA 616

Query: 492 ACIFNNEESIIRIDMSEFIEKHSISRLIGAPPGYIGYEEGGYLTEIVRRKPYSLILLDEI 551
             +F++E++++RIDMSE++EKHS++RLIGAPPGY+GYEEGG LTE VRRKPYS++L DE+
Sbjct: 617 EFLFDDEDAMVRIDMSEYMEKHSVARLIGAPPGYVGYEEGGQLTEAVRRKPYSVVLFDEV 676

Query: 552 EKANSDVFNILLQILDDGRLTDNRGRTINFRNTIIVMTSNLGSDKIKEM-EKGDKEIIKL 610
           EKA+ DVFN+LLQ+LDDGRLTD +GRT++FRNT+I+MTSNLGS  I+E+    D E ++ 
Sbjct: 677 EKAHPDVFNVLLQVLDDGRLTDGQGRTVDFRNTVIIMTSNLGSQFIQELAGGDDYEEMRE 736

Query: 611 AVMNEVKIYFRPEFINRIDDIIVFRYLNRKNILSIANIQLNILKNKLLKMNMDLKISKAA 670
           AVM  ++ +FRPEF+NRID+I+VF  L R+ I  I  IQL  L+ +L +  + L++S AA
Sbjct: 737 AVMEVLRAHFRPEFLNRIDEIVVFHPLGREQIARIVEIQLGRLRKRLAERKITLELSDAA 796

Query: 671 LKKISNIGFDLIYGAR 686
           L  ++  G+D +YGAR
Sbjct: 797 LDFLAEAGYDPVYGAR 812


Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins [Protein fate, Protein folding and stabilization]. Length = 852

>gnl|CDD|182791 PRK10865, PRK10865, protein disaggregation chaperone; Provisional Back     alignment and domain information
>gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214361 CHL00095, clpC, Clp protease ATP binding subunit Back     alignment and domain information
>gnl|CDD|234172 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>gnl|CDD|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>gnl|CDD|234673 PRK00166, apaH, diadenosine tetraphosphatase; Reviewed Back     alignment and domain information
>gnl|CDD|163665 cd07422, MPP_ApaH, Escherichia coli ApaH and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>gnl|CDD|236828 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|236828 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|233082 TIGR00668, apaH, bis(5'-nucleosyl)-tetraphosphatase (symmetrical) Back     alignment and domain information
>gnl|CDD|163613 cd00144, MPP_PPP_family, phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|163656 cd07413, MPP_PA3087, Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|163666 cd07423, MPP_PrpE, Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|204486 pfam10431, ClpB_D2-small, C-terminal, D2-small domain, of ClpB protein Back     alignment and domain information
>gnl|CDD|234457 TIGR04075, bacter_Pnkp, polynucleotide kinase-phosphatase Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|198154 smart01086, ClpB_D2-small, C-terminal, D2-small domain, of ClpB protein Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|163667 cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|215750 pfam00149, Metallophos, Calcineurin-like phosphoesterase Back     alignment and domain information
>gnl|CDD|236911 PRK11439, pphA, serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>gnl|CDD|163614 cd00838, MPP_superfamily, metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|184187 PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>gnl|CDD|107154 PHA02239, PHA02239, putative protein phosphatase Back     alignment and domain information
>gnl|CDD|182173 PRK09968, PRK09968, serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|234457 TIGR04075, bacter_Pnkp, polynucleotide kinase-phosphatase Back     alignment and domain information
>gnl|CDD|163666 cd07423, MPP_PrpE, Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|197547 smart00156, PP2Ac, Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|226415 COG3899, COG3899, Predicted ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|163657 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 951
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 100.0
PRK10865857 protein disaggregation chaperone; Provisional 100.0
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 100.0
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 100.0
CHL00095821 clpC Clp protease ATP binding subunit 100.0
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 100.0
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 100.0
KOG1051|consensus898 100.0
TIGR00668279 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric 100.0
cd07422257 MPP_ApaH Escherichia coli ApaH and related protein 100.0
PRK00166275 apaH diadenosine tetraphosphatase; Reviewed 100.0
KOG0733|consensus802 100.0
KOG0730|consensus693 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
KOG0736|consensus953 100.0
KOG0735|consensus952 100.0
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 100.0
PRK13625245 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision 100.0
cd07413222 MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat 99.97
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.96
cd07423234 MPP_PrpE Bacillus subtilis PrpE and related protei 99.96
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.96
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.96
KOG0741|consensus744 99.95
PRK11439218 pphA serine/threonine protein phosphatase 1; Provi 99.95
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.95
KOG2004|consensus906 99.94
cd07421304 MPP_Rhilphs Rhilph phosphatases, metallophosphatas 99.94
PHA02239235 putative protein phosphatase 99.93
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.93
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.93
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.93
PRK09968218 serine/threonine-specific protein phosphatase 2; P 99.92
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.92
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.92
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.91
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.91
cd07424207 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do 99.91
KOG0730|consensus693 99.9
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.9
KOG0738|consensus491 99.9
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.89
cd00144225 MPP_PPP_family phosphoprotein phosphatases of the 99.89
KOG0989|consensus346 99.89
KOG0733|consensus802 99.88
KOG0734|consensus752 99.88
KOG0745|consensus564 99.87
KOG0736|consensus953 99.87
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 99.87
KOG2028|consensus554 99.86
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.86
COG2204464 AtoC Response regulator containing CheY-like recei 99.86
CHL00195489 ycf46 Ycf46; Provisional 99.85
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 99.85
CHL00195489 ycf46 Ycf46; Provisional 99.85
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.85
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 99.84
KOG0739|consensus439 99.84
CHL00181287 cbbX CbbX; Provisional 99.84
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 99.84
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.84
PRK13342413 recombination factor protein RarA; Reviewed 99.84
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.83
PRK03992389 proteasome-activating nucleotidase; Provisional 99.83
PLN03025319 replication factor C subunit; Provisional 99.83
KOG0737|consensus386 99.83
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.83
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.83
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 99.83
PRK14949944 DNA polymerase III subunits gamma and tau; Provisi 99.82
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.82
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 99.82
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.82
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 99.82
KOG0735|consensus952 99.82
KOG0991|consensus333 99.82
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.82
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.82
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 99.82
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.81
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 99.81
cd07425208 MPP_Shelphs Shewanella-like phosphatases, metallop 99.81
PRK13341725 recombination factor protein RarA/unknown domain f 99.81
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.81
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.81
KOG0740|consensus428 99.81
CHL00181287 cbbX CbbX; Provisional 99.81
KOG0731|consensus774 99.8
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.8
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.8
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 99.8
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.8
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.8
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.8
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 99.8
KOG0728|consensus404 99.79
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 99.79
CHL00176638 ftsH cell division protein; Validated 99.79
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 99.79
PRK07764824 DNA polymerase III subunits gamma and tau; Validat 99.79
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 99.79
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 99.78
KOG0727|consensus408 99.78
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 99.78
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.78
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.77
PRK11608326 pspF phage shock protein operon transcriptional ac 99.77
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 99.77
KOG0652|consensus424 99.77
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 99.77
PHA02544316 44 clamp loader, small subunit; Provisional 99.77
PRK15424538 propionate catabolism operon regulatory protein Pr 99.77
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.77
KOG0729|consensus435 99.76
COG1221403 PspF Transcriptional regulators containing an AAA- 99.76
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 99.76
PRK04195482 replication factor C large subunit; Provisional 99.76
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.76
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.76
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 99.76
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.76
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 99.76
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.76
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.76
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 99.76
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.75
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 99.75
KOG0726|consensus440 99.75
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 99.75
KOG0732|consensus1080 99.75
CHL002062281 ycf2 Ycf2; Provisional 99.75
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.74
COG3283511 TyrR Transcriptional regulator of aromatic amino a 99.74
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.74
KOG0989|consensus346 99.73
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 99.73
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.73
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 99.73
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 99.73
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 99.73
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.72
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.72
PRK12402337 replication factor C small subunit 2; Reviewed 99.72
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.72
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 99.71
PRK15429686 formate hydrogenlyase transcriptional activator Fh 99.71
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.71
PRK00440319 rfc replication factor C small subunit; Reviewed 99.71
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.71
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 99.71
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.71
KOG0734|consensus752 99.71
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 99.7
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 99.69
KOG2035|consensus351 99.69
PRK04132846 replication factor C small subunit; Provisional 99.68
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.68
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 99.68
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.67
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.67
KOG0727|consensus408 99.67
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 99.67
KOG0651|consensus388 99.65
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 99.65
KOG0738|consensus491 99.64
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 99.64
PF00004132 AAA: ATPase family associated with various cellula 99.64
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.63
PLN03025319 replication factor C subunit; Provisional 99.63
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.63
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 99.63
KOG0742|consensus630 99.63
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 99.63
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 99.62
KOG2170|consensus344 99.62
KOG0728|consensus404 99.62
KOG0990|consensus360 99.62
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 99.62
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.62
KOG2028|consensus554 99.62
PRK15115444 response regulator GlrR; Provisional 99.62
cd07420321 MPP_RdgC Drosophila melanogaster RdgC and related 99.62
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.61
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.61
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 99.61
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.61
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.61
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.61
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.61
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.6
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.6
KOG0739|consensus439 99.59
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 99.59
PRK08084235 DNA replication initiation factor; Provisional 99.59
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.59
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.59
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.59
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.59
PRK07940394 DNA polymerase III subunit delta'; Validated 99.58
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.58
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 99.58
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 99.58
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.58
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 99.58
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 99.58
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 99.57
KOG0731|consensus774 99.57
PRK13531498 regulatory ATPase RavA; Provisional 99.57
PRK03992389 proteasome-activating nucleotidase; Provisional 99.56
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.56
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 99.56
KOG0726|consensus440 99.56
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.56
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.55
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 99.55
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 99.55
PRK13342413 recombination factor protein RarA; Reviewed 99.55
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 99.54
PRK13341 725 recombination factor protein RarA/unknown domain f 99.54
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 99.54
PRK06893229 DNA replication initiation factor; Validated 99.54
PRK07940394 DNA polymerase III subunit delta'; Validated 99.54
KOG0729|consensus435 99.54
KOG0652|consensus424 99.54
CHL00176638 ftsH cell division protein; Validated 99.53
smart00156271 PP2Ac Protein phosphatase 2A homologues, catalytic 99.53
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.52
PRK10365441 transcriptional regulatory protein ZraR; Provision 99.52
KOG2004|consensus906 99.52
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 99.52
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.52
cd07418377 MPP_PP7 PP7, metallophosphatase domain. PP7 is a p 99.51
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.51
PHA02544316 44 clamp loader, small subunit; Provisional 99.51
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.51
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 99.51
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.51
PTZ00244294 serine/threonine-protein phosphatase PP1; Provisio 99.51
PRK09112351 DNA polymerase III subunit delta'; Validated 99.51
PRK07471365 DNA polymerase III subunit delta'; Validated 99.51
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 99.51
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.5
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.5
PTZ001121164 origin recognition complex 1 protein; Provisional 99.5
cd07414293 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme 99.5
cd07419311 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a 99.5
cd07417316 MPP_PP5_C PP5, C-terminal metallophosphatase domai 99.49
PRK12402337 replication factor C small subunit 2; Reviewed 99.49
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.49
KOG0744|consensus423 99.49
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.49
cd07416305 MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca 99.49
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.48
PRK04195482 replication factor C large subunit; Provisional 99.48
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.48
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 99.47
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.47
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.47
KOG1969|consensus877 99.47
CHL00206 2281 ycf2 Ycf2; Provisional 99.47
PRK08727233 hypothetical protein; Validated 99.47
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.46
PRK05642234 DNA replication initiation factor; Validated 99.46
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.46
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.46
PHA02244383 ATPase-like protein 99.45
PTZ00239303 serine/threonine protein phosphatase 2A; Provision 99.45
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.45
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.45
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.44
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.44
PF00004132 AAA: ATPase family associated with various cellula 99.44
PRK12422445 chromosomal replication initiation protein; Provis 99.44
PRK00149450 dnaA chromosomal replication initiation protein; R 99.44
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.43
PRK06620214 hypothetical protein; Validated 99.43
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.43
cd07415285 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein 99.43
PRK08727233 hypothetical protein; Validated 99.43
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.43
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.43
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.42
PRK14088440 dnaA chromosomal replication initiation protein; P 99.41
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 99.41
KOG0743|consensus457 99.41
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.4
PRK00440319 rfc replication factor C small subunit; Reviewed 99.4
KOG0737|consensus386 99.4
PTZ00480320 serine/threonine-protein phosphatase; Provisional 99.4
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.4
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.4
PRK14086617 dnaA chromosomal replication initiation protein; P 99.4
PRK07399314 DNA polymerase III subunit delta'; Validated 99.4
PRK08084235 DNA replication initiation factor; Provisional 99.39
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.39
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.38
KOG0742|consensus630 99.38
PRK06893229 DNA replication initiation factor; Validated 99.38
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.38
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.38
COG0714329 MoxR-like ATPases [General function prediction onl 99.38
PRK09087226 hypothetical protein; Validated 99.37
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.37
KOG0991|consensus333 99.37
PRK05564313 DNA polymerase III subunit delta'; Validated 99.37
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.37
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 99.36
PRK09112351 DNA polymerase III subunit delta'; Validated 99.36
PRK07399314 DNA polymerase III subunit delta'; Validated 99.36
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 99.36
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.36
COG0606490 Predicted ATPase with chaperone activity [Posttran 99.34
TIGR02442633 Cob-chelat-sub cobaltochelatase subunit. A number 99.34
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.34
KOG0371|consensus319 99.34
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 99.33
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 99.33
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.33
KOG0651|consensus388 99.33
PRK07471365 DNA polymerase III subunit delta'; Validated 99.33
COG0470325 HolB ATPase involved in DNA replication [DNA repli 99.32
PRK14087450 dnaA chromosomal replication initiation protein; P 99.32
PTZ001121164 origin recognition complex 1 protein; Provisional 99.32
PRK05564313 DNA polymerase III subunit delta'; Validated 99.32
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.32
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.32
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 99.32
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.31
PRK08058329 DNA polymerase III subunit delta'; Validated 99.31
PRK04132846 replication factor C small subunit; Provisional 99.31
PRK13531498 regulatory ATPase RavA; Provisional 99.31
PRK05642234 DNA replication initiation factor; Validated 99.31
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.3
PRK08058329 DNA polymerase III subunit delta'; Validated 99.3
PF07726131 AAA_3: ATPase family associated with various cellu 99.29
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 99.29
PRK12422445 chromosomal replication initiation protein; Provis 99.29
KOG0740|consensus428 99.28
PRK11331459 5-methylcytosine-specific restriction enzyme subun 99.28
KOG0732|consensus 1080 99.28
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.27
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.27
KOG1942|consensus456 99.27
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.27
PRK00149450 dnaA chromosomal replication initiation protein; R 99.27
KOG0744|consensus423 99.27
TIGR00764608 lon_rel lon-related putative ATP-dependent proteas 99.26
KOG0375|consensus 517 99.26
KOG0374|consensus331 99.26
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 99.25
KOG0743|consensus457 99.24
KOG0372|consensus303 99.24
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.23
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.23
PRK14086617 dnaA chromosomal replication initiation protein; P 99.23
KOG2035|consensus351 99.23
PRK06871325 DNA polymerase III subunit delta'; Validated 99.22
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 99.22
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.22
PRK13765637 ATP-dependent protease Lon; Provisional 99.21
PRK05707328 DNA polymerase III subunit delta'; Validated 99.2
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 99.2
COG4650531 RtcR Sigma54-dependent transcription regulator con 99.2
PTZ00111915 DNA replication licensing factor MCM4; Provisional 99.2
PRK14087450 dnaA chromosomal replication initiation protein; P 99.2
COG0593408 DnaA ATPase involved in DNA replication initiation 99.2
PRK08769319 DNA polymerase III subunit delta'; Validated 99.2
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.2
PRK08769319 DNA polymerase III subunit delta'; Validated 99.2
CHL00095 821 clpC Clp protease ATP binding subunit 99.19
COG0714329 MoxR-like ATPases [General function prediction onl 99.18
PRK05707328 DNA polymerase III subunit delta'; Validated 99.18
PRK14088440 dnaA chromosomal replication initiation protein; P 99.18
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.17
PRK11331459 5-methylcytosine-specific restriction enzyme subun 99.17
COG0470325 HolB ATPase involved in DNA replication [DNA repli 99.17
PRK07993334 DNA polymerase III subunit delta'; Validated 99.16
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 99.16
PRK06090319 DNA polymerase III subunit delta'; Validated 99.16
PRK06964342 DNA polymerase III subunit delta'; Validated 99.16
PRK09862506 putative ATP-dependent protease; Provisional 99.15
PRK10865857 protein disaggregation chaperone; Provisional 99.14
PHA02244383 ATPase-like protein 99.14
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.14
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 99.14
PRK11608326 pspF phage shock protein operon transcriptional ac 99.13
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.13
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 99.13
TIGR02442633 Cob-chelat-sub cobaltochelatase subunit. A number 99.13
smart00350509 MCM minichromosome maintenance proteins. 99.13
PRK07993334 DNA polymerase III subunit delta'; Validated 99.12
PRK09087226 hypothetical protein; Validated 99.11
PRK06871325 DNA polymerase III subunit delta'; Validated 99.1
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.1
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.1
PRK06620214 hypothetical protein; Validated 99.1
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.1
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 99.09
COG2204464 AtoC Response regulator containing CheY-like recei 99.09
KOG0373|consensus306 99.09
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.09
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.08
PRK15424538 propionate catabolism operon regulatory protein Pr 99.07
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.07
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.07
KOG0745|consensus564 99.05
KOG2680|consensus454 99.05
COG1221403 PspF Transcriptional regulators containing an AAA- 99.05
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.05
PRK06964342 DNA polymerase III subunit delta'; Validated 99.03
PRK15429686 formate hydrogenlyase transcriptional activator Fh 99.03
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 99.03
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.03
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.02
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.01
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.01
PRK12377248 putative replication protein; Provisional 99.01
PRK06090319 DNA polymerase III subunit delta'; Validated 99.01
PRK08116268 hypothetical protein; Validated 99.01
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 99.0
PRK05917290 DNA polymerase III subunit delta'; Validated 99.0
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.98
KOG0741|consensus744 98.98
TIGR00764608 lon_rel lon-related putative ATP-dependent proteas 98.97
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.97
KOG1969|consensus 877 98.97
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 98.96
smart00350509 MCM minichromosome maintenance proteins. 98.96
PF07726131 AAA_3: ATPase family associated with various cellu 98.95
KOG0990|consensus360 98.95
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 98.93
COG0593408 DnaA ATPase involved in DNA replication initiation 98.93
PRK08699325 DNA polymerase III subunit delta'; Validated 98.93
PRK07276290 DNA polymerase III subunit delta'; Validated 98.91
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 98.9
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.9
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.89
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.88
PRK08181269 transposase; Validated 98.87
TIGR02031589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.87
PRK08699325 DNA polymerase III subunit delta'; Validated 98.87
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 98.86
PRK05818261 DNA polymerase III subunit delta'; Validated 98.86
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.84
PRK06526254 transposase; Provisional 98.83
PTZ00111915 DNA replication licensing factor MCM4; Provisional 98.83
COG0606490 Predicted ATPase with chaperone activity [Posttran 98.81
PRK13765637 ATP-dependent protease Lon; Provisional 98.78
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.77
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 98.77
PRK06835329 DNA replication protein DnaC; Validated 98.76
KOG1970|consensus634 98.75
PRK07132299 DNA polymerase III subunit delta'; Validated 98.74
smart00382148 AAA ATPases associated with a variety of cellular 98.74
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.73
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.73
PRK12377248 putative replication protein; Provisional 98.72
PRK05917290 DNA polymerase III subunit delta'; Validated 98.72
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.71
KOG0478|consensus804 98.71
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 98.7
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 98.7
PRK08116268 hypothetical protein; Validated 98.7
PF13173128 AAA_14: AAA domain 98.7
smart00382148 AAA ATPases associated with a variety of cellular 98.7
PRK09183259 transposase/IS protein; Provisional 98.69
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 98.69
PRK07952244 DNA replication protein DnaC; Validated 98.68
PRK07952244 DNA replication protein DnaC; Validated 98.66
KOG0377|consensus 631 98.66
KOG1942|consensus456 98.66
PRK09862506 putative ATP-dependent protease; Provisional 98.63
PRK15455644 PrkA family serine protein kinase; Provisional 98.63
PRK07132299 DNA polymerase III subunit delta'; Validated 98.63
PRK15115444 response regulator GlrR; Provisional 98.62
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.61
PRK08939306 primosomal protein DnaI; Reviewed 98.61
PRK07276290 DNA polymerase III subunit delta'; Validated 98.59
KOG2227|consensus529 98.58
TIGR00040158 yfcE phosphoesterase, MJ0936 family. Members of th 98.54
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 98.53
COG1241682 MCM2 Predicted ATPase involved in replication cont 98.52
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 98.5
KOG2227|consensus529 98.49
PRK06921266 hypothetical protein; Provisional 98.49
PRK05818261 DNA polymerase III subunit delta'; Validated 98.49
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 98.45
PHA00729226 NTP-binding motif containing protein 98.45
PF13173128 AAA_14: AAA domain 98.44
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 98.43
KOG1514|consensus767 98.42
PF05729166 NACHT: NACHT domain 98.42
KOG0480|consensus764 98.41
PRK08181269 transposase; Validated 98.4
KOG2680|consensus454 98.39
PRK10365441 transcriptional regulatory protein ZraR; Provision 98.38
PRK06835329 DNA replication protein DnaC; Validated 98.35
KOG1051|consensus898 98.35
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 98.34
COG1618179 Predicted nucleotide kinase [Nucleotide transport 98.34
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=9e-100  Score=871.23  Aligned_cols=634  Identities=61%  Similarity=0.981  Sum_probs=584.9

Q ss_pred             CCcccCCCCchhhhhHHHHhhcchHHHHhcCCCCCccccHHHHHHHHHHHHcCCCCCcEEEcCCCCcHHHHHHHHHHHHH
Q psy14504         11 NGKNILSQQDEEHIGYLKKYTIDLTEKARLGKLDPVIGRDDEIRRAIQVLQRRSKNNPVLIGEPGVGKTAIVEGLAQRII   90 (951)
Q Consensus        11 ~~~~~~~~~~~~~~~~l~~~~~~l~e~~rp~~l~~lvG~~~~i~~l~~~l~~~~~~~iLL~GppGtGKTtla~~la~~l~   90 (951)
                      .+....++.++...++|++|+++|++.+|.+.+|++||+++++++++++|++++++|.+|+|+||+|||.+|..+|.++.
T Consensus       137 ~~~~~~~~~~~~~~~~L~~y~~dlt~~Ar~gklDPvIGRd~EI~r~iqIL~RR~KNNPvLiGEpGVGKTAIvEGLA~rIv  216 (786)
T COG0542         137 GGNEVDSKNAEEDQDALEKYTRDLTELAREGKLDPVIGRDEEIRRTIQILSRRTKNNPVLVGEPGVGKTAIVEGLAQRIV  216 (786)
T ss_pred             cccccCCcccccchhhHHHHhhhhHHHHhcCCCCCCcChHHHHHHHHHHHhccCCCCCeEecCCCCCHHHHHHHHHHHHh
Confidence            34466677778888999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCcCCCeEEEEehhhhhcCccccccHHHHHHHHHHHHHhcCCCeEEEEecccccccCCCCCC-chhHHhhhhhhc
Q psy14504         91 NGEVPNSLLSKKILLLDIALLLAGTKYRGEFEDRLKKILKEISNNQKDIIIFIDELHTMIGTGKVEG-SIDAGNMLKPEL  169 (951)
Q Consensus        91 ~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~~l~~~~~~a~~~~~~~iL~iDEid~l~~~~~~~~-~~~~~~~L~~~l  169 (951)
                      .+++|..+.+..++++|++.+.+|.+|.|+++++++.+++++.... +.||||||+|.+.+++..+| +.++.|.|++.|
T Consensus       217 ~g~VP~~L~~~~i~sLD~g~LvAGakyRGeFEeRlk~vl~ev~~~~-~vILFIDEiHtiVGAG~~~G~a~DAaNiLKPaL  295 (786)
T COG0542         217 NGDVPESLKDKRIYSLDLGSLVAGAKYRGEFEERLKAVLKEVEKSK-NVILFIDEIHTIVGAGATEGGAMDAANLLKPAL  295 (786)
T ss_pred             cCCCCHHHcCCEEEEecHHHHhccccccCcHHHHHHHHHHHHhcCC-CeEEEEechhhhcCCCcccccccchhhhhHHHH
Confidence            9999999999999999999999999999999999999999999766 99999999999999988766 589999999999


Q ss_pred             cCCcEEEEEeecchHHHHhhhcCHHHhhcceEEEeeCCCHHHHHHHHHHHHHhhhhhcCCCCChHHHHHHHHHhhhhccc
Q psy14504        170 SRGELHCIGATTLNEYRQYIEKDAAFERRFQKILVEEPDIEETISILRGLQKKYEVHHGVEITDPAIVAASELSYRYISD  249 (951)
Q Consensus       170 e~~~i~vI~at~~~~~~~~~~~~~~l~~Rf~~i~~~~p~~~er~~il~~~~~~~~~~~~~~i~~~~l~~~~~~s~~~~~~  249 (951)
                      .+|.+.+|||||..+|+++++.|++|.|||+.|.+..|+.++...||+.+..+|+.+|++.++++++.+++.+|.+|+++
T Consensus       296 ARGeL~~IGATT~~EYRk~iEKD~AL~RRFQ~V~V~EPs~e~ti~ILrGlk~~yE~hH~V~i~D~Al~aAv~LS~RYI~d  375 (786)
T COG0542         296 ARGELRCIGATTLDEYRKYIEKDAALERRFQKVLVDEPSVEDTIAILRGLKERYEAHHGVRITDEALVAAVTLSDRYIPD  375 (786)
T ss_pred             hcCCeEEEEeccHHHHHHHhhhchHHHhcCceeeCCCCCHHHHHHHHHHHHHHHHHccCceecHHHHHHHHHHHHhhccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCchhHHHHHHHHHHHhHHhhcCCchHHHHHHHHHHHHHHHHHHHHhhcchhhHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy14504        250 RFMPDKAIDLIDEAAAKIKIEIDSKPEIMDKLERRLIQLKIEHEAIKREYDESSKKRLLLIKKEINKLEIKYANLEKIWK  329 (951)
Q Consensus       250 ~~~p~~a~~ll~~a~~~~~~~~~~~~~~l~~l~~~~~~~~~e~~~l~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~  329 (951)
                      |++|++|++++|+||+..++... .|..+..+++++.++..|.+++..+.+..                           
T Consensus       376 R~LPDKAIDLiDeA~a~~~l~~~-~p~~l~~~~~~~~~l~~e~~~~~~e~~~~---------------------------  427 (786)
T COG0542         376 RFLPDKAIDLLDEAGARVRLEID-KPEELDELERELAQLEIEKEALEREQDEK---------------------------  427 (786)
T ss_pred             CCCCchHHHHHHHHHHHHHhccc-CCcchhHHHHHHHHHHHHHHHHhhhhhHH---------------------------
Confidence            99999999999999999999988 99999999999999999988877765400                           


Q ss_pred             HHHHHhHhHHHHHHHHHHHHHHHHHhhhcCchHhhhhhhhhchHHHHHHHHHhhhhhccCCCccccccccccccChhHHH
Q psy14504        330 YEKTLIKDSQQIKEEIEKVRLKINKATRKSDWQTVSKLKYGELNKLERILKEKSQKDIQLPNNANKFTLLKTKVGSEEIA  409 (951)
Q Consensus       330 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~i~  409 (951)
                       ++....       .+..+                   ....++.+++.+.                   . .|+.++|+
T Consensus       428 -~k~~~~-------~~~~~-------------------~~~~~~~~~~~~~-------------------~-~v~~~~Ia  460 (786)
T COG0542         428 -EKKLID-------EIIKL-------------------KEGRIPELEKELE-------------------A-EVDEDDIA  460 (786)
T ss_pred             -HHHHHH-------HHHHH-------------------hhhhhhhHHHHHh-------------------h-ccCHHHHH
Confidence             000000       00000                   0022333333221                   1 28999999


Q ss_pred             HHHHHhhCCCCcccchHHHHHHHHHHHHhhccCCChHHHHHHHHHHHHhhhcCCCCCCCCceEEEEeCCCCCcHHHHHHH
Q psy14504        410 EIVSRTTGIPVSKIVQVEREKLLNIENLLCKRVVGQDEAISAVSNAIRRSRSGLSDAKRPYGSFMFLGPTGVGKTELCKT  489 (951)
Q Consensus       410 ~~~~~~~~~p~~~~~~~~~~~l~~l~~~l~~~v~Gq~~~~~~l~~~~~~~~~~~~~~~~p~~~~Ll~GppGtGKT~lA~~  489 (951)
                      ++++.|+|+|+.++...+...+.++++.|.+.|+||++|+..+..++++.+.|+.+|.+|.+++||.||+|||||++|++
T Consensus       461 ~vv~~~TgIPv~~l~~~e~~kll~le~~L~~rViGQd~AV~avs~aIrraRaGL~dp~rPigsFlF~GPTGVGKTELAka  540 (786)
T COG0542         461 EVVARWTGIPVAKLLEDEKEKLLNLERRLKKRVIGQDEAVEAVSDAIRRARAGLGDPNRPIGSFLFLGPTGVGKTELAKA  540 (786)
T ss_pred             HHHHHHHCCChhhhchhhHHHHHHHHHHHhcceeChHHHHHHHHHHHHHHhcCCCCCCCCceEEEeeCCCcccHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhccCCCceEEeccccccchhchhcccCCCCCCccccccchhHHHHHhCCCeEEEEccccccCHHHHHHHHHHhhcc
Q psy14504        490 LSACIFNNEESIIRIDMSEFIEKHSISRLIGAPPGYIGYEEGGYLTEIVRRKPYSLILLDEIEKANSDVFNILLQILDDG  569 (951)
Q Consensus       490 la~~l~~~~~~~~~~~~~~~~~~~~~~~l~g~~~~~~g~~~~~~l~~~~~~~~~~vl~iDEid~~~~~~~~~Ll~~le~g  569 (951)
                      ||..+|+....++++|||+|.+++++++|+|+||||+||++++.+++++++.|++||+||||+|+||+++|.|||+||+|
T Consensus       541 LA~~Lfg~e~aliR~DMSEy~EkHsVSrLIGaPPGYVGyeeGG~LTEaVRr~PySViLlDEIEKAHpdV~nilLQVlDdG  620 (786)
T COG0542         541 LAEALFGDEQALIRIDMSEYMEKHSVSRLIGAPPGYVGYEEGGQLTEAVRRKPYSVILLDEIEKAHPDVFNLLLQVLDDG  620 (786)
T ss_pred             HHHHhcCCCccceeechHHHHHHHHHHHHhCCCCCCceeccccchhHhhhcCCCeEEEechhhhcCHHHHHHHHHHhcCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeecCCCeEeecCCeEEEEecCCCchhhhhhccc----cHHHHHHHHHHHHHhccChhHhhccCcEEEecCCChhhHHHH
Q psy14504        570 RLTDNRGRTINFRNTIIVMTSNLGSDKIKEMEKG----DKEIIKLAVMNEVKIYFRPEFINRIDDIIVFRYLNRKNILSI  645 (951)
Q Consensus       570 ~~~~~~g~~~~~~~~iiI~ttn~~~~~~~~~~~~----~~~~~~~~~~~~~~~~f~p~l~~R~~~~i~f~~l~~~~~~~i  645 (951)
                      +++|+.|++++|+|++||||||.|+..+.+....    ....+.+.+++.++..|+|+|++|+|.+|+|.||+++++.+|
T Consensus       621 rLTD~~Gr~VdFrNtiIImTSN~Gs~~i~~~~~~~~~~~~~~~~~~v~~~l~~~F~PEFLNRid~II~F~~L~~~~l~~I  700 (786)
T COG0542         621 RLTDGQGRTVDFRNTIIIMTSNAGSEEILRDADGDDFADKEALKEAVMEELKKHFRPEFLNRIDEIIPFNPLSKEVLERI  700 (786)
T ss_pred             eeecCCCCEEecceeEEEEecccchHHHHhhccccccchhhhHHHHHHHHHHhhCCHHHHhhcccEEeccCCCHHHHHHH
Confidence            9999999999999999999999999988776542    356778889999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhcCCccccchHHHHHHHHhcccccccccccccchHHHHHHHHhhcccCCccceeecccccCCcceEe
Q psy14504        646 ANIQLNILKNKLLKMNMDLKISKAALKKISNIGFDLIYGARDVHGCKKSLSILLKKIHKKSPEANFIFLGDLINKGPQSL  725 (951)
Q Consensus       646 ~~~~l~~~~~~~~~~~~~l~~~~~~~~~L~~~~~~~~~g~~dlhg~~~~l~~~l~~~~~~~~~~~li~~gd~~~~g~~~~  725 (951)
                      +...+.++..++..+++.+.+++++.++|++.+|++.||+|.+.+.   +++.+     .++.+..++.|.+.+.+...+
T Consensus       701 v~~~L~~l~~~L~~~~i~l~~s~~a~~~l~~~gyd~~~GARpL~R~---Iq~~i-----~~~La~~iL~g~~~~~~~v~v  772 (786)
T COG0542         701 VDLQLNRLAKRLAERGITLELSDEAKDFLAEKGYDPEYGARPLRRA---IQQEI-----EDPLADEILFGKIEDGGTVKV  772 (786)
T ss_pred             HHHHHHHHHHHHHhCCceEEECHHHHHHHHHhccCCCcCchHHHHH---HHHHH-----HHHHHHHHHhcccCCCcEEEE
Confidence            9999999999999889999999999999999999999999999999   88888     578888999999999777766


Q ss_pred             hhH
Q psy14504        726 DTL  728 (951)
Q Consensus       726 ~~l  728 (951)
                      .+-
T Consensus       773 ~~~  775 (786)
T COG0542         773 DVD  775 (786)
T ss_pred             Eec
Confidence            554



>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG1051|consensus Back     alignment and domain information
>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) Back     alignment and domain information
>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK00166 apaH diadenosine tetraphosphatase; Reviewed Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain Back     alignment and domain information
>PHA02239 putative protein phosphatase Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>KOG2035|consensus Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>KOG2170|consensus Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>KOG0990|consensus Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd07418 MPP_PP7 PP7, metallophosphatase domain Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>cd07416 MPP_PP2B PP2B, metallophosphatase domain Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>KOG1969|consensus Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PTZ00239 serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>PTZ00480 serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>KOG0371|consensus Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG1942|consensus Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>KOG0375|consensus Back     alignment and domain information
>KOG0374|consensus Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>KOG0372|consensus Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG2035|consensus Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0373|consensus Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>KOG2680|consensus Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>KOG1969|consensus Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>KOG0990|consensus Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG1970|consensus Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>KOG0478|consensus Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>KOG1942|consensus Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2227|consensus Back     alignment and domain information
>TIGR00040 yfcE phosphoesterase, MJ0936 family Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>KOG2227|consensus Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>KOG1514|consensus Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG0480|consensus Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>KOG2680|consensus Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG1051|consensus Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query951
1qvr_A854 Crystal Structure Analysis Of Clpb Length = 854 0.0
3pxi_A758 Structure Of Meca108:clpc Length = 758 1e-140
4hse_A397 Crystal Structure Of Clpb Nbd1 In Complex With Guan 1e-100
1jbk_A195 Crystal Structure Of The First Nucelotide Binding D 1e-76
3pxg_A468 Structure Of Meca121 And Clpc1-485 Complex Length = 4e-68
4fct_A308 Crystal Structure Of The C-Terminal Domain Of Clpb 2e-67
4fcv_A311 Crystal Structure Of The C-Terminal Domain Of Clpb 3e-65
2p65_A187 Crystal Structure Of The First Nucleotide Binding D 2e-62
1ksf_X758 Crystal Structure Of Clpa, An Hsp100 Chaperone And 1e-60
1ksf_X758 Crystal Structure Of Clpa, An Hsp100 Chaperone And 1e-49
2dfj_A280 Crystal Structure Of The Diadenosine Tetraphosphate 4e-38
>pdb|1QVR|A Chain A, Crystal Structure Analysis Of Clpb Length = 854 Back     alignment and structure

Iteration: 1

Score = 632 bits (1631), Expect = 0.0, Method: Compositional matrix adjust. Identities = 342/678 (50%), Positives = 456/678 (67%), Gaps = 10/678 (1%) Query: 11 NGKNILSQQDEEHIGYLKKYTIDLTEKARLGKLDPVIGRDDEIRRAIQVLQRRSKNNPVL 70 G+ + ++ E L++Y IDLT A GKLDPVIGRD+EIRR IQ+L RR+KNNPVL Sbjct: 137 GGRTVQTEHAESTYNALEQYGIDLTRLAAEGKLDPVIGRDEEIRRVIQILLRRTKNNPVL 196 Query: 71 IGEPGVGKTAIVEGLAQRIINGEVPNXXXXXXXXXXXXXXXXXGTKYRGEFEDRLKKILK 130 IGEPGVGKTAIVEGLAQRI+ G+VP G KYRGEFE+RLK +++ Sbjct: 197 IGEPGVGKTAIVEGLAQRIVKGDVPEGLKGKRIVSLQMGSLLAGAKYRGEFEERLKAVIQ 256 Query: 131 EISNNQKDIIIFIDELHTMIGTGKVEGSIDAGNMLKPELSRGELHCIGATTLNEYRQYIE 190 E+ +Q ++I+FIDELHT++G GK EG++DAGNMLKP L+RGEL IGATTL+EYR+ IE Sbjct: 257 EVVQSQGEVILFIDELHTVVGAGKAEGAVDAGNMLKPALARGELRLIGATTLDEYRE-IE 315 Query: 191 KDAAFERRFQKILVEEPDIEETISILRGLQKKYEVHHGVEITDPAIVAASELSYRYISDR 250 KD A ERRFQ + V+EP +EETISILRGL++KYEVHHGV I+D AI+AA+ LS+RYI++R Sbjct: 316 KDPALERRFQPVYVDEPTVEETISILRGLKEKYEVHHGVRISDSAIIAAATLSHRYITER 375 Query: 251 FMPXXXXXXXXXXXXXXXXXXXXXPEIMDKLERRLIQLKIEHEAIKREYDXXXXXXXXXX 310 +P PE +D LER+ +QL+IE EA+K+E D Sbjct: 376 RLPDKAIDLIDEAAARLRMALESAPEEIDALERKKLQLEIEREALKKEKDPDSQERLKAI 435 Query: 311 XXXXXXXXXXYANLEKIWKYEKTLIKDSQQIKEEIEKVRLKINKATRKSDWQTVSKLKYG 370 A L W+ E+ +++ ++ + +++VR +I A R+ D ++L+YG Sbjct: 436 EAEIAKLTEEIAKLRAEWEREREILRKLREAQHRLDEVRREIELAERQYDLNRAAELRYG 495 Query: 371 ELNKLERILKEKSQKDIQLPNNANKFTLLKTKVGSEEIAEIVSRTTGIPVSKIVQVEREK 430 EL KLE ++ S+K +F L+ V E+IAEIVSR TGIPVSK+++ EREK Sbjct: 496 ELPKLEAEVEALSEK-----LRGARFVRLE--VTEEDIAEIVSRWTGIPVSKLLEGEREK 548 Query: 431 LLNIENLLCKRVVGQDEAISAVSNAIRRSRSGLSDAKRPYGSFMFLGPTGVGKTELCKTL 490 LL +E L KRVVGQDEAI AV++AIRR+R+GL D RP GSF+FLGPTGVGKTEL KTL Sbjct: 549 LLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTL 608 Query: 491 SACIFNNEESIIRIDMSEFIEKHSISRLIXXXXXXXXXXXXXXLTEIVRRKPYSLILLDE 550 +A +F+ EE++IRIDM+E++EKH++SRLI LTE VRR+PYS+IL DE Sbjct: 609 AATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGYVGYEEGGQLTEAVRRRPYSVILFDE 668 Query: 551 IEKANSDVFNILLQILDDGRLTDNRGRTINFRNTIIVMTSNLGSDKIKE-MEKG-DKEII 608 IEKA+ DVFNILLQILDDGRLTD+ GRT++FRNT+I++TSNLGS I E ++KG E I Sbjct: 669 IEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERI 728 Query: 609 KLAVMNEVKIYFRPEFINRIDDIIVFRYLNRKNILSXXXXXXXXXXXXXXXXXXXXXXSK 668 + V ++ +FRPEF+NR+D+I+VFR L ++ I ++ Sbjct: 729 RDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTE 788 Query: 669 AALKKISNIGFDLIYGAR 686 AA ++ G+D ++GAR Sbjct: 789 AAKDFLAERGYDPVFGAR 806
>pdb|3PXI|A Chain A, Structure Of Meca108:clpc Length = 758 Back     alignment and structure
>pdb|4HSE|A Chain A, Crystal Structure Of Clpb Nbd1 In Complex With Guanidinium Chloride And Adp Length = 397 Back     alignment and structure
>pdb|1JBK|A Chain A, Crystal Structure Of The First Nucelotide Binding Domain Of Clpb Length = 195 Back     alignment and structure
>pdb|3PXG|A Chain A, Structure Of Meca121 And Clpc1-485 Complex Length = 468 Back     alignment and structure
>pdb|4FCT|A Chain A, Crystal Structure Of The C-Terminal Domain Of Clpb Length = 308 Back     alignment and structure
>pdb|4FCV|A Chain A, Crystal Structure Of The C-Terminal Domain Of Clpb Length = 311 Back     alignment and structure
>pdb|2P65|A Chain A, Crystal Structure Of The First Nucleotide Binding Domain Of Chaperone Clpb1, Putative, (Pv089580) From Plasmodium Vivax Length = 187 Back     alignment and structure
>pdb|1KSF|X Chain X, Crystal Structure Of Clpa, An Hsp100 Chaperone And Regulator Of Clpap Protease: Structural Basis Of Differences In Function Of The Two Aaa+ Atpase Domains Length = 758 Back     alignment and structure
>pdb|1KSF|X Chain X, Crystal Structure Of Clpa, An Hsp100 Chaperone And Regulator Of Clpap Protease: Structural Basis Of Differences In Function Of The Two Aaa+ Atpase Domains Length = 758 Back     alignment and structure
>pdb|2DFJ|A Chain A, Crystal Structure Of The Diadenosine Tetraphosphate Hydrolase From Shigella Flexneri 2a Length = 280 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query951
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 0.0
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 0.0
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 1e-166
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 1e-160
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 1e-146
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 1e-139
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 1e-121
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 1e-112
2dfj_A280 Diadenosinetetraphosphatase; helices and strands m 2e-76
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 2e-73
2qjc_A262 Diadenosine tetraphosphatase, putative; putative d 3e-65
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 1e-36
2z72_A342 Protein-tyrosine-phosphatase; cold-active enzyme, 1e-26
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
3rqz_A246 Metallophosphoesterase; PSI-biology, midwest cente 2e-12
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 6e-12
1nnw_A252 Hypothetical protein; structural genomics, PSI, pr 6e-09
3qfm_A270 SAPH, putative uncharacterized protein; sandwich f 1e-07
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 7e-07
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 5e-06
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 3e-05
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 8e-05
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 9e-05
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 1e-04
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 2e-04
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 3e-04
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 3e-04
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 4e-04
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 4e-04
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 5e-04
2xkj_E767 Topoisomerase IV; type IIA topoisomerase; 2.20A {A 5e-04
1zvu_A716 Topoisomerase IV subunit A; beta-pinwheel, ATPase, 5e-04
2qgz_A308 Helicase loader, putative primosome component; str 6e-04
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 7e-04
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Length = 854 Back     alignment and structure
 Score = 1163 bits (3011), Expect = 0.0
 Identities = 385/677 (56%), Positives = 520/677 (76%), Gaps = 10/677 (1%)

Query: 12  GKNILSQQDEEHIGYLKKYTIDLTEKARLGKLDPVIGRDDEIRRAIQVLQRRSKNNPVLI 71
           G+ + ++  E     L++Y IDLT  A  GKLDPVIGRD+EIRR IQ+L RR+KNNPVLI
Sbjct: 138 GRTVQTEHAESTYNALEQYGIDLTRLAAEGKLDPVIGRDEEIRRVIQILLRRTKNNPVLI 197

Query: 72  GEPGVGKTAIVEGLAQRIINGEVPNSLLSKKILLLDIALLLAGTKYRGEFEDRLKKILKE 131
           GEPGVGKTAIVEGLAQRI+ G+VP  L  K+I+ L +  LLAG KYRGEFE+RLK +++E
Sbjct: 198 GEPGVGKTAIVEGLAQRIVKGDVPEGLKGKRIVSLQMGSLLAGAKYRGEFEERLKAVIQE 257

Query: 132 ISNNQKDIIIFIDELHTMIGTGKVEGSIDAGNMLKPELSRGELHCIGATTLNEYRQYIEK 191
           +  +Q ++I+FIDELHT++G GK EG++DAGNMLKP L+RGEL  IGATTL+EYR+ IEK
Sbjct: 258 VVQSQGEVILFIDELHTVVGAGKAEGAVDAGNMLKPALARGELRLIGATTLDEYRE-IEK 316

Query: 192 DAAFERRFQKILVEEPDIEETISILRGLQKKYEVHHGVEITDPAIVAASELSYRYISDRF 251
           D A ERRFQ + V+EP +EETISILRGL++KYEVHHGV I+D AI+AA+ LS+RYI++R 
Sbjct: 317 DPALERRFQPVYVDEPTVEETISILRGLKEKYEVHHGVRISDSAIIAAATLSHRYITERR 376

Query: 252 MPDKAIDLIDEAAAKIKIEIDSKPEIMDKLERRLIQLKIEHEAIKREYDESSKKRLLLIK 311
           +PDKAIDLIDEAAA++++ ++S PE +D LER+ +QL+IE EA+K+E D  S++RL  I+
Sbjct: 377 LPDKAIDLIDEAAARLRMALESAPEEIDALERKKLQLEIEREALKKEKDPDSQERLKAIE 436

Query: 312 KEINKLEIKYANLEKIWKYEKTLIKDSQQIKEEIEKVRLKINKATRKSDWQTVSKLKYGE 371
            EI KL  + A L   W+ E+ +++  ++ +  +++VR +I  A R+ D    ++L+YGE
Sbjct: 437 AEIAKLTEEIAKLRAEWEREREILRKLREAQHRLDEVRREIELAERQYDLNRAAELRYGE 496

Query: 372 LNKLERILKEKSQKDIQLPNNANKFTLLKTKVGSEEIAEIVSRTTGIPVSKIVQVEREKL 431
           L KLE  ++  S+K             ++ +V  E+IAEIVSR TGIPVSK+++ EREKL
Sbjct: 497 LPKLEAEVEALSEKL-------RGARFVRLEVTEEDIAEIVSRWTGIPVSKLLEGEREKL 549

Query: 432 LNIENLLCKRVVGQDEAISAVSNAIRRSRSGLSDAKRPYGSFMFLGPTGVGKTELCKTLS 491
           L +E  L KRVVGQDEAI AV++AIRR+R+GL D  RP GSF+FLGPTGVGKTEL KTL+
Sbjct: 550 LRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLA 609

Query: 492 ACIFNNEESIIRIDMSEFIEKHSISRLIGAPPGYIGYEEGGYLTEIVRRKPYSLILLDEI 551
           A +F+ EE++IRIDM+E++EKH++SRLIGAPPGY+GYEEGG LTE VRR+PYS+IL DEI
Sbjct: 610 ATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGYVGYEEGGQLTEAVRRRPYSVILFDEI 669

Query: 552 EKANSDVFNILLQILDDGRLTDNRGRTINFRNTIIVMTSNLGSDKIKEM--EKGDKEIIK 609
           EKA+ DVFNILLQILDDGRLTD+ GRT++FRNT+I++TSNLGS  I E   +    E I+
Sbjct: 670 EKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIR 729

Query: 610 LAVMNEVKIYFRPEFINRIDDIIVFRYLNRKNILSIANIQLNILKNKLLKMNMDLKISKA 669
             V   ++ +FRPEF+NR+D+I+VFR L ++ I  I  IQL+ L+ +L +  + L++++A
Sbjct: 730 DEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEA 789

Query: 670 ALKKISNIGFDLIYGAR 686
           A   ++  G+D ++GAR
Sbjct: 790 AKDFLAERGYDPVFGAR 806


>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Length = 758 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Length = 468 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Length = 311 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Length = 758 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Length = 758 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Length = 195 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Length = 187 Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Length = 280 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Length = 359 Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Length = 262 Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Length = 221 Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Length = 342 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} Length = 246 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Length = 412 Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Length = 252 Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Length = 270 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Length = 500 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Length = 180 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Length = 309 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Length = 202 Back     alignment and structure
>2xkj_E Topoisomerase IV; type IIA topoisomerase; 2.20A {Acinetobacter baumannii} PDB: 2xkk_A* Length = 767 Back     alignment and structure
>1zvu_A Topoisomerase IV subunit A; beta-pinwheel, ATPase, supercoiling, decatenation, DNA bindi topology; 3.00A {Escherichia coli} Length = 716 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Length = 308 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query951
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 100.0
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 100.0
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 100.0
2dfj_A280 Diadenosinetetraphosphatase; helices and strands m 100.0
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 100.0
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 100.0
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.97
2qjc_A262 Diadenosine tetraphosphatase, putative; putative d 99.94
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.93
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.92
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.92
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.92
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.91
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.91
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.91
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.9
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.9
2z72_A342 Protein-tyrosine-phosphatase; cold-active enzyme, 99.9
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.88
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.88
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.88
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.87
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.86
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.85
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.85
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.85
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.85
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.85
3pvs_A447 Replication-associated recombination protein A; ma 99.84
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.84
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.84
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 99.84
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.83
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.82
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.82
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.82
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.81
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 99.81
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.81
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.81
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.8
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.8
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.8
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.8
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 99.8
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.79
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 99.79
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.78
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.78
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.77
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.76
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.76
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.76
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.76
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.75
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.75
1fjm_A330 Protein serine/threonine phosphatase-1 (alpha ISO 99.75
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.75
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.74
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.74
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.73
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 99.73
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 99.73
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 99.72
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 99.71
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.71
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.71
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.71
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.71
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.71
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.71
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.71
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.7
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.7
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.7
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.69
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.69
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.68
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 99.68
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.67
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.67
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.67
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.66
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.65
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.65
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.64
3pvs_A447 Replication-associated recombination protein A; ma 99.63
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.63
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.63
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.62
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.62
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.62
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.61
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.61
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.6
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.6
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.59
3bos_A242 Putative DNA replication factor; P-loop containing 99.59
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 99.58
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.58
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.58
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.58
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 99.58
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.57
3co5_A143 Putative two-component system transcriptional RES 99.57
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.57
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.57
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.57
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 99.57
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.57
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.57
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.57
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.56
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.56
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.56
3e7a_A299 PP-1A, serine/threonine-protein phosphatase PP1-al 99.55
3icf_A335 PPT, serine/threonine-protein phosphatase T; IRO m 99.55
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.54
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.54
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.54
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 99.54
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.54
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.53
3ll8_A357 Serine/threonine-protein phosphatase 2B catalytic 99.53
3h63_A315 Serine/threonine-protein phosphatase 5; metalloenz 99.53
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.53
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.53
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.52
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.52
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.51
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.5
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.49
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 99.49
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.47
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.47
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.47
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.46
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 99.46
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.46
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.45
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 99.45
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 99.45
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.44
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 99.44
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.43
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.43
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.42
2gno_A305 DNA polymerase III, gamma subunit-related protein; 99.42
2gno_A305 DNA polymerase III, gamma subunit-related protein; 99.42
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.41
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 99.41
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 99.4
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 99.39
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.39
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.38
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.38
3bos_A242 Putative DNA replication factor; P-loop containing 99.38
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.37
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.36
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.35
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.35
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.34
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.33
3co5_A143 Putative two-component system transcriptional RES 99.33
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 99.32
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.3
1nnw_A252 Hypothetical protein; structural genomics, PSI, pr 99.27
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.24
3f8t_A506 Predicted ATPase involved in replication control, 99.24
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.22
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.2
3qfm_A270 SAPH, putative uncharacterized protein; sandwich f 99.09
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.09
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 99.09
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.04
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 99.01
3rqz_A246 Metallophosphoesterase; PSI-biology, midwest cente 98.97
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 98.95
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 98.94
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 98.93
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.91
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 98.9
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 98.89
2fna_A357 Conserved hypothetical protein; structural genomic 98.87
3f8t_A506 Predicted ATPase involved in replication control, 98.8
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.77
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.76
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.72
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.71
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 98.67
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 98.61
2qgz_A308 Helicase loader, putative primosome component; str 98.55
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 98.54
2qgz_A308 Helicase loader, putative primosome component; str 98.5
1tue_A212 Replication protein E1; helicase, replication, E1E 98.49
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.49
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 98.43
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.42
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 98.38
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 98.35
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 98.33
1tue_A212 Replication protein E1; helicase, replication, E1E 98.26
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 98.26
2fna_A357 Conserved hypothetical protein; structural genomic 98.22
1uf3_A228 Hypothetical protein TT1561; metallo-dependent pho 98.2
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.18
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 98.15
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 98.05
2a22_A215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 98.03
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, 97.99
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 97.98
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.93
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 97.93
3ck2_A176 Conserved uncharacterized protein (predicted phosp 97.91
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.87
1z2w_A192 Vacuolar protein sorting 29; VPS29, retromer, phos 97.86
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 97.71
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.71
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 97.69
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.58
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.53
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.5
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.38
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 97.28
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 97.19
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 97.16
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 97.15
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 97.08
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.06
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 97.06
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 97.06
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.06
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.0
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 96.92
1xp8_A366 RECA protein, recombinase A; recombination, radior 96.91
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 96.89
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.89
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.87
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 96.87
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 96.84
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 96.84
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.83
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.82
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.78
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 96.78
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.78
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 96.73
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 96.71
3vaa_A199 Shikimate kinase, SK; structural genomics, center 96.67
1u94_A356 RECA protein, recombinase A; homologous recombinat 96.63
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 96.59
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.59
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.58
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.58
4a74_A231 DNA repair and recombination protein RADA; hydrola 96.57
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 96.55
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.55
1via_A175 Shikimate kinase; structural genomics, transferase 96.54
2eyu_A261 Twitching motility protein PILT; pilus retraction 96.52
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.52
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.5
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 96.49
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 96.49
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 96.48
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.47
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 96.46
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 96.46
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 96.46
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.45
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.45
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 96.44
2cvh_A220 DNA repair and recombination protein RADB; filamen 96.42
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.41
1xp8_A366 RECA protein, recombinase A; recombination, radior 96.4
1u94_A356 RECA protein, recombinase A; homologous recombinat 96.37
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 96.36
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 96.35
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 96.33
3vaa_A199 Shikimate kinase, SK; structural genomics, center 96.32
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 96.31
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.31
1kag_A173 SKI, shikimate kinase I; transferase, structural g 96.3
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 96.3
4a74_A231 DNA repair and recombination protein RADA; hydrola 96.29
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 96.27
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.26
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.26
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 96.26
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.25
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.24
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 96.22
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.21
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 96.21
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.19
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.16
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 96.15
2ewv_A372 Twitching motility protein PILT; pilus retraction 96.14
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.13
1via_A175 Shikimate kinase; structural genomics, transferase 96.12
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 96.12
1xm7_A195 Hypothetical protein AQ_1665; structural genomics, 96.11
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 96.11
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 96.07
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 96.07
3tlx_A243 Adenylate kinase 2; structural genomics, structura 96.06
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 96.05
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 96.04
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.04
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.02
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 96.01
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.01
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.0
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 96.0
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 96.0
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 95.99
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 95.98
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 95.98
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 95.97
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 95.97
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 95.97
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 95.96
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 95.95
2r6a_A454 DNAB helicase, replicative helicase; replication, 95.95
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 95.94
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 95.93
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 95.93
1kag_A173 SKI, shikimate kinase I; transferase, structural g 95.93
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 95.93
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 95.93
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 95.92
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 95.92
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 95.92
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 95.91
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 95.91
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 95.9
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 95.9
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 95.88
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 95.86
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 95.84
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 95.84
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 95.82
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 95.82
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 95.82
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 95.81
1vma_A306 Cell division protein FTSY; TM0570, structural gen 95.79
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 95.78
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 95.78
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 95.77
2z43_A324 DNA repair and recombination protein RADA; archaea 95.77
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 95.76
2vli_A183 Antibiotic resistance protein; transferase, tunica 95.76
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 95.76
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 95.75
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 95.75
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 95.74
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 95.72
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 95.71
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 95.7
2vli_A183 Antibiotic resistance protein; transferase, tunica 95.68
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 95.68
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 95.68
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 95.68
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 95.67
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 95.66
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 95.65
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 95.65
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 95.64
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 95.62
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 95.62
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 95.61
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 95.6
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 95.58
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 95.55
3io5_A333 Recombination and repair protein; storage dimer, i 95.55
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 95.54
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 95.5
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.5
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 95.49
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 95.46
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 95.45
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 95.43
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 95.43
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 95.42
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 95.41
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 95.4
3io5_A333 Recombination and repair protein; storage dimer, i 95.4
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 95.4
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 95.39
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 95.39
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 95.38
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 95.38
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 95.38
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 95.38
3tlx_A243 Adenylate kinase 2; structural genomics, structura 95.36
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 95.35
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 95.33
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 95.33
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 95.32
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 95.3
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 95.29
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 95.29
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 95.28
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 95.28
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 95.28
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 95.27
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 95.26
2xxa_A433 Signal recognition particle protein; protein trans 95.25
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 95.24
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 95.23
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 95.22
3r20_A233 Cytidylate kinase; structural genomics, seattle st 95.21
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 95.21
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 95.2
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 95.19
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 95.19
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 95.17
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 95.11
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 95.11
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 95.11
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 95.09
3lxw_A247 GTPase IMAP family member 1; immunity, structural 95.06
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 95.04
3d03_A274 Phosphohydrolase; glycerophosphodiesterase, metall 95.04
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 95.04
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 95.02
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 95.0
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 95.0
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 95.0
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 94.99
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 94.94
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 94.92
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 94.91
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 94.87
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 94.87
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 94.85
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 94.85
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 94.83
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 94.82
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 94.82
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 94.81
1p9r_A418 General secretion pathway protein E; bacterial typ 94.8
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 94.8
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 94.78
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 94.77
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 94.77
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 94.76
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 94.76
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 94.75
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 94.75
3r20_A233 Cytidylate kinase; structural genomics, seattle st 94.74
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 94.74
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 94.74
2oap_1511 GSPE-2, type II secretion system protein; hexameri 94.73
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 94.73
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 94.7
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 94.69
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 94.68
2ewv_A372 Twitching motility protein PILT; pilus retraction 94.67
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 94.66
2z43_A324 DNA repair and recombination protein RADA; archaea 94.66
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 94.65
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 94.62
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 94.6
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 94.59
1vma_A306 Cell division protein FTSY; TM0570, structural gen 94.56
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 94.52
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 94.52
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 94.51
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 94.51
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 94.49
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 94.48
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 94.46
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 94.43
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 94.42
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 94.42
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 94.42
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 94.42
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 94.4
2r6a_A454 DNAB helicase, replicative helicase; replication, 94.39
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 94.38
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 94.37
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 94.36
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 94.36
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 94.34
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 94.33
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 94.31
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 94.31
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 94.28
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 94.27
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 94.25
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 94.25
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 94.24
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 94.23
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 94.23
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 94.17
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 94.16
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 94.15
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 94.15
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 94.14
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
Probab=100.00  E-value=4.2e-75  Score=722.46  Aligned_cols=700  Identities=56%  Similarity=0.898  Sum_probs=599.8

Q ss_pred             CcccCCCCchhhhhHHHHhhcchHHHHhcCCCCCccccHHHHHHHHHHHHcCCCCCcEEEcCCCCcHHHHHHHHHHHHHc
Q psy14504         12 GKNILSQQDEEHIGYLKKYTIDLTEKARLGKLDPVIGRDDEIRRAIQVLQRRSKNNPVLIGEPGVGKTAIVEGLAQRIIN   91 (951)
Q Consensus        12 ~~~~~~~~~~~~~~~l~~~~~~l~e~~rp~~l~~lvG~~~~i~~l~~~l~~~~~~~iLL~GppGtGKTtla~~la~~l~~   91 (951)
                      +.++.++.++...+.|++|+.+|++++||.+|+++||+++++++++.++.++.++++||+||||||||++|+++|+.+..
T Consensus       138 ~~~~~~~~~~~~~~~l~~~~~~l~~~~r~~~ld~viGr~~~i~~l~~~l~~~~~~~vlL~G~pG~GKT~la~~la~~l~~  217 (854)
T 1qvr_A          138 GRTVQTEHAESTYNALEQYGIDLTRLAAEGKLDPVIGRDEEIRRVIQILLRRTKNNPVLIGEPGVGKTAIVEGLAQRIVK  217 (854)
T ss_dssp             CCSSCSSCCCCCCSHHHHHEEEHHHHHHTTCSCCCCSCHHHHHHHHHHHHCSSCCCCEEEECTTSCHHHHHHHHHHHHHH
T ss_pred             ccccccccccccchhHHHHHHhHHHHHhcCCCcccCCcHHHHHHHHHHHhcCCCCceEEEcCCCCCHHHHHHHHHHHHhc
Confidence            34455555666788999999999999999999999999999999999999999999999999999999999999999988


Q ss_pred             CCCCCCcCCCeEEEEehhhhhcCccccccHHHHHHHHHHHHHhcCCCeEEEEecccccccCCCCCCchhHHhhhhhhccC
Q psy14504         92 GEVPNSLLSKKILLLDIALLLAGTKYRGEFEDRLKKILKEISNNQKDIIIFIDELHTMIGTGKVEGSIDAGNMLKPELSR  171 (951)
Q Consensus        92 ~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~~l~~~~~~a~~~~~~~iL~iDEid~l~~~~~~~~~~~~~~~L~~~le~  171 (951)
                      +.+|..+.+.+++.++++.+..+.++.|+++..++.++..+....+++||||||+|.+.+.+...++.++.+.|++++++
T Consensus       218 ~~~p~~l~~~~~~~l~~~~l~~g~~~~g~~~~~l~~~~~~~~~~~~~~iL~IDEi~~l~~~~~~~g~~~~~~~L~~~l~~  297 (854)
T 1qvr_A          218 GDVPEGLKGKRIVSLQMGSLLAGAKYRGEFEERLKAVIQEVVQSQGEVILFIDELHTVVGAGKAEGAVDAGNMLKPALAR  297 (854)
T ss_dssp             TCSCTTSTTCEEEEECC-----------CHHHHHHHHHHHHHTTCSSEEEEECCC-------------------HHHHHT
T ss_pred             CCCchhhcCCeEEEeehHHhhccCccchHHHHHHHHHHHHHHhcCCCeEEEEecHHHHhccCCccchHHHHHHHHHHHhC
Confidence            88898888999999999999888889999999999999999866678999999999998776666667788899999999


Q ss_pred             CcEEEEEeecchHHHHhhhcCHHHhhcceEEEeeCCCHHHHHHHHHHHHHhhhhhcCCCCChHHHHHHHHHhhhhcccCC
Q psy14504        172 GELHCIGATTLNEYRQYIEKDAAFERRFQKILVEEPDIEETISILRGLQKKYEVHHGVEITDPAIVAASELSYRYISDRF  251 (951)
Q Consensus       172 ~~i~vI~at~~~~~~~~~~~~~~l~~Rf~~i~~~~p~~~er~~il~~~~~~~~~~~~~~i~~~~l~~~~~~s~~~~~~~~  251 (951)
                      +.+.+|++||.+++.+ +.++++|.+||+.|.|++|+.+++..||+.++..++..+++.++++++..++.++.+|+++++
T Consensus       298 ~~i~~I~at~~~~~~~-~~~d~aL~rRf~~i~l~~p~~~e~~~iL~~~~~~~~~~~~~~i~~~al~~~~~ls~r~i~~~~  376 (854)
T 1qvr_A          298 GELRLIGATTLDEYRE-IEKDPALERRFQPVYVDEPTVEETISILRGLKEKYEVHHGVRISDSAIIAAATLSHRYITERR  376 (854)
T ss_dssp             TCCCEEEEECHHHHHH-HTTCTTTCSCCCCEEECCCCHHHHHHHHHHHHHHHHHHTTCEECHHHHHHHHHHHHHHCCSSC
T ss_pred             CCeEEEEecCchHHhh-hccCHHHHhCCceEEeCCCCHHHHHHHHHhhhhhhhhhcCCCCCHHHHHHHHHHHhhhccccc
Confidence            9999999999999777 778999999999999999999999999999999888889999999999999999999999999


Q ss_pred             CchhHHHHHHHHHHHhHHhhcCCchHHHHHHHHHHHHHHHHHHHHhhcchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy14504        252 MPDKAIDLIDEAAAKIKIEIDSKPEIMDKLERRLIQLKIEHEAIKREYDESSKKRLLLIKKEINKLEIKYANLEKIWKYE  331 (951)
Q Consensus       252 ~p~~a~~ll~~a~~~~~~~~~~~~~~l~~l~~~~~~~~~e~~~l~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~  331 (951)
                      +|++++++++++++..+....+.|..+..+++.+..+..+...+..+.+..+.+|+..++.++..++.++..+...|..+
T Consensus       377 lp~kai~lldea~a~~~~~~~~~p~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  456 (854)
T 1qvr_A          377 LPDKAIDLIDEAAARLRMALESAPEEIDALERKKLQLEIEREALKKEKDPDSQERLKAIEAEIAKLTEEIAKLRAEWERE  456 (854)
T ss_dssp             THHHHHHHHHHHHHHHHHTTTTHHHHHHHHHHHHHHHHHHHHHHSSCSSHHHHSCTHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ChHHHHHHHHHHHHHHHhhccCCchhHHHHHHHHHHHHHHHHHHHhccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999888899999999999999999999999999999


Q ss_pred             HHHhHhHHHHHHHHHHHHHHHHHhhhcCchHhhhhhhhhchHHHHHHHHHhhhhhccCCCccccccccccccChhHHHHH
Q psy14504        332 KTLIKDSQQIKEEIEKVRLKINKATRKSDWQTVSKLKYGELNKLERILKEKSQKDIQLPNNANKFTLLKTKVGSEEIAEI  411 (951)
Q Consensus       332 ~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~i~~~  411 (951)
                      +..+..+...+.++++++..++.+.+.+++++++++.+..++.+++.+....+. .      .+...+...++.+++..+
T Consensus       457 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~------~~~~~~~~~v~~~~l~~~  529 (854)
T 1qvr_A          457 REILRKLREAQHRLDEVRREIELAERQYDLNRAAELRYGELPKLEAEVEALSEK-L------RGARFVRLEVTEEDIAEI  529 (854)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHTTTTCHHHHHHHHTTHHHHHHHHHHHHHHH-S------SSCSSCCSEECHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHhhhHHHHHhcccHHHHHHHhhhhhHHHHHHHHHHHhh-h------cccccccCCcCHHHHHHH
Confidence            999999999999999999999999999999999999999999999998877543 0      133456678999999999


Q ss_pred             HHHhhCCCCcccchHHHHHHHHHHHHhhccCCChHHHHHHHHHHHHhhhcCCCCCCCCceEEEEeCCCCCcHHHHHHHHH
Q psy14504        412 VSRTTGIPVSKIVQVEREKLLNIENLLCKRVVGQDEAISAVSNAIRRSRSGLSDAKRPYGSFMFLGPTGVGKTELCKTLS  491 (951)
Q Consensus       412 ~~~~~~~p~~~~~~~~~~~l~~l~~~l~~~v~Gq~~~~~~l~~~~~~~~~~~~~~~~p~~~~Ll~GppGtGKT~lA~~la  491 (951)
                      ++.++++|..++...+...+.++...+.+.|+||+.+++.+...+...+.|+.+|.+|.+++||+||||||||++|++||
T Consensus       530 v~~~~~ip~~~~~~~~~~~l~~l~~~l~~~viG~~~a~~~l~~~i~~~~~g~~~~~~p~~~vLl~Gp~GtGKT~lA~~la  609 (854)
T 1qvr_A          530 VSRWTGIPVSKLLEGEREKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLA  609 (854)
T ss_dssp             HHTTSSCHHHHTTCCHHHHHHSHHHHHHHHSCSCHHHHHHHHHHHHHHGGGCSCSSSCSEEEEEBSCSSSSHHHHHHHHH
T ss_pred             HHHHhCCChHhhcHHHHHHHHHHHHHHhcccCCcHHHHHHHHHHHHHHhcccCCCCCCceEEEEECCCCCCHHHHHHHHH
Confidence            99999999888877777777788889999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhccCCCceEEeccccccchhchhcccCCCCCCccccccchhHHHHHhCCCeEEEEccccccCHHHHHHHHHHhhccee
Q psy14504        492 ACIFNNEESIIRIDMSEFIEKHSISRLIGAPPGYIGYEEGGYLTEIVRRKPYSLILLDEIEKANSDVFNILLQILDDGRL  571 (951)
Q Consensus       492 ~~l~~~~~~~~~~~~~~~~~~~~~~~l~g~~~~~~g~~~~~~l~~~~~~~~~~vl~iDEid~~~~~~~~~Ll~~le~g~~  571 (951)
                      +.+++.+.+++.++|+++......+.++|.+++|+|+..++.+++.++..+++|||||||+++++++++.|+++|++|.+
T Consensus       610 ~~~~~~~~~~i~i~~~~~~~~~~~s~l~g~~~~~~G~~~~g~l~~~~~~~~~~vl~lDEi~~l~~~~~~~Ll~~l~~~~~  689 (854)
T 1qvr_A          610 ATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGYVGYEEGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRL  689 (854)
T ss_dssp             HHHHSSGGGEEEECTTTCCSSGGGGGC--------------CHHHHHHHCSSEEEEESSGGGSCHHHHHHHHHHHTTTEE
T ss_pred             HHhcCCCCcEEEEechhccchhHHHHHcCCCCCCcCccccchHHHHHHhCCCeEEEEecccccCHHHHHHHHHHhccCce
Confidence            99988888999999999999999999999999999999888899999999999999999999999999999999999999


Q ss_pred             ecCCCeEeecCCeEEEEecCCCchhhhhhc--cccHHHHHHHHHHHHHhccChhHhhccCcEEEecCCChhhHHHHHHHH
Q psy14504        572 TDNRGRTINFRNTIIVMTSNLGSDKIKEME--KGDKEIIKLAVMNEVKIYFRPEFINRIDDIIVFRYLNRKNILSIANIQ  649 (951)
Q Consensus       572 ~~~~g~~~~~~~~iiI~ttn~~~~~~~~~~--~~~~~~~~~~~~~~~~~~f~p~l~~R~~~~i~f~~l~~~~~~~i~~~~  649 (951)
                      ++..|+.+++++++||+|||.+...+.+..  +.....+...+.+.+.+.|+|+|++||+.++.|.|++.+++..|+...
T Consensus       690 ~~~~g~~vd~~~~iiI~tsn~~~~~~~~~~~~~~~~~~l~~~v~~~~~~~f~~~l~~Rl~~~i~~~pl~~edi~~i~~~~  769 (854)
T 1qvr_A          690 TDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQ  769 (854)
T ss_dssp             CCSSSCCEECTTEEEEEECCTTHHHHHHHHHTTCCHHHHHHHHHHHHHTTSCHHHHHTCSBCCBCCCCCHHHHHHHHHHH
T ss_pred             ECCCCCEeccCCeEEEEecCcChHHHhhhcccccchHHHHHHHHHHHHhhCCHHHHHhcCeEEeCCCCCHHHHHHHHHHH
Confidence            999999999999999999999877664421  112455667777778999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhcCCccccchHHHHHHHHhcccccccccccccchHHHHHHHHhhcccCCccceeecccccCCcceEehh
Q psy14504        650 LNILKNKLLKMNMDLKISKAALKKISNIGFDLIYGARDVHGCKKSLSILLKKIHKKSPEANFIFLGDLINKGPQSLDT  727 (951)
Q Consensus       650 l~~~~~~~~~~~~~l~~~~~~~~~L~~~~~~~~~g~~dlhg~~~~l~~~l~~~~~~~~~~~li~~gd~~~~g~~~~~~  727 (951)
                      +.++..++...++.+.++++++++|+.++|++.+|+|.+.+.   +++.+     ..+....++.|++.++++..+.+
T Consensus       770 l~~~~~~~~~~~~~~~~~~~a~~~L~~~~~~~~gn~R~L~~~---i~~~~-----~~~~~~~i~~~~~~~~~~~~~~~  839 (854)
T 1qvr_A          770 LSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRV---IQREL-----ETPLAQKILAGEVKEGDRVQVDV  839 (854)
T ss_dssp             HHHHHHHHHTTTCEEEECHHHHHHHHHHHCBTTTBTSTHHHH---HHHHT-----HHHHHHHHHHTSSCSSCEEEEEC
T ss_pred             HHHHHHHHHhCCceEEECHHHHHHHHHcCCCCCCChHHHHHH---HHHHH-----HHHHHHHHHhCcCCCCCEEEEEE
Confidence            999999888877789999999999999999999999999998   77776     34556778889988888776654



>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 951
d1qvra2387 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus 1e-138
d1r6bx2268 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, A 2e-94
d1qvra3315 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus 2e-84
d1jbka_195 c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia col 3e-81
d1r6bx3315 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, A 4e-67
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 2e-40
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 0.002
d1um8a_364 c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 9e-36
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 7e-30
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 4e-28
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 8e-05
d1g5ba_219 d.159.1.3 (A:) lambda ser/thr protein phosphatase 2e-26
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 2e-17
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 2e-04
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 1e-13
d1nnwa_251 d.159.1.5 (A:) Hypothetical protein PF1291 {Archae 9e-09
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 2e-08
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 3e-08
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 4e-05
d1g41a_443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 4e-08
d1sxjd2237 c.37.1.20 (D:26-262) Replication factor C2 {Baker' 2e-07
d1sxjd2237 c.37.1.20 (D:26-262) Replication factor C2 {Baker' 4e-04
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 8e-07
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 5e-04
d1njfa_239 c.37.1.20 (A:) delta prime subunit of DNA polymera 8e-05
d1njfa_239 c.37.1.20 (A:) delta prime subunit of DNA polymera 0.002
d1uf3a_228 d.159.1.6 (A:) Hypothetical protein TT1561 {Thermu 1e-04
d1auia_ 473 d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calc 1e-04
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 2e-04
d2fnaa2283 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo 5e-04
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 0.001
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 0.002
d1k6ka_142 a.174.1.1 (A:) N-terminal, ClpS-binding domain of 0.004
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 387 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]
 Score =  417 bits (1073), Expect = e-138
 Identities = 218/391 (55%), Positives = 295/391 (75%), Gaps = 8/391 (2%)

Query: 27  LKKYTIDLTEKARLGKLDPVIGRDDEIRRAIQVLQRRSKNNPVLIGEPGVGKTAIVEGLA 86
           L++Y IDLT  A  GKLDPVIGRD+EIRR IQ+L RR+KNNPVLIGEPGVGKTAIVEGLA
Sbjct: 5   LEQYGIDLTRLAAEGKLDPVIGRDEEIRRVIQILLRRTKNNPVLIGEPGVGKTAIVEGLA 64

Query: 87  QRIINGEVPNSLLSKKILLLDIALLLAGTKYRGEFEDRLKKILKEISNNQKDIIIFIDEL 146
           QRI+ G+VP  L  K+I+ L +  LLAG KYRGEFE+RLK +++E+  +Q ++I+FIDEL
Sbjct: 65  QRIVKGDVPEGLKGKRIVSLQMGSLLAGAKYRGEFEERLKAVIQEVVQSQGEVILFIDEL 124

Query: 147 HTMIGTGKVEGSIDAGNMLKPELSRGELHCIGATTLNEYRQYIEKDAAFERRFQKILVEE 206
           HT++G GK EG++DAGNMLKP L+RGEL  IGATTL+EYR+   KD A ERRFQ + V+E
Sbjct: 125 HTVVGAGKAEGAVDAGNMLKPALARGELRLIGATTLDEYREIE-KDPALERRFQPVYVDE 183

Query: 207 PDIEETISILRGLQKKYEVHHGVEITDPAIVAASELSYRYISDRFMPDKAIDLIDEAAAK 266
           P +EETISILRGL++KYEVHHGV I+D AI+AA+ LS+RYI++R +PDKAIDLIDEAAA+
Sbjct: 184 PTVEETISILRGLKEKYEVHHGVRISDSAIIAAATLSHRYITERRLPDKAIDLIDEAAAR 243

Query: 267 IKIEIDSKPEIMDKLERRLIQLKIEHEAIKREYDESSKKRLLLIKKEINKLEIKYANLEK 326
           +++ ++S PE +D LER+ +QL+IE EA+K+E D  S++RL  I+ EI KL  + A L  
Sbjct: 244 LRMALESAPEEIDALERKKLQLEIEREALKKEKDPDSQERLKAIEAEIAKLTEEIAKLRA 303

Query: 327 IWKYEKTLIKDSQQIKEEIEKVRLKINKATRKSDWQTVSKLKYGELNKLERILKEKSQKD 386
            W+ E+ +++  ++ +  +++VR +I  A R+ D    ++L+YGEL KLE  ++  S+K 
Sbjct: 304 EWEREREILRKLREAQHRLDEVRREIELAERQYDLNRAAELRYGELPKLEAEVEALSEK- 362

Query: 387 IQLPNNANKFTLLKTKVGSEEIAEIVSRTTG 417
                       ++ +V  E+IAEIVSR TG
Sbjct: 363 ------LRGARFVRLEVTEEDIAEIVSRWTG 387


>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 268 Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 315 Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 195 Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Length = 219 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 251 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 239 Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 239 Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Length = 228 Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 473 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} Length = 142 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query951
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 100.0
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 100.0
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 100.0
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 100.0
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 100.0
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.98
d1g5ba_219 lambda ser/thr protein phosphatase {Bacteriophage 99.94
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.93
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.92
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.92
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.9
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.88
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.87
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.87
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.86
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.85
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.85
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.84
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.84
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.83
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.79
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.78
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.78
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.76
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.75
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.74
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.73
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.7
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.69
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.68
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.67
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.66
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.64
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.64
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.63
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.63
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.61
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.6
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.6
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.58
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.57
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.55
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.54
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.5
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.47
d1jk7a_294 Protein phosphatase-1 (PP-1) {Human (Homo sapiens) 99.45
d1nnwa_251 Hypothetical protein PF1291 {Archaeon Pyrococcus f 99.44
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.44
d1auia_ 473 Protein phosphatase-2B (PP-2B, calcineurin A subun 99.44
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.42
d3c5wc1288 Protein phosphatase 2A catalytic subunit alpha iso 99.41
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.4
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.39
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.36
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.36
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.35
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 99.33
d1s95a_324 Serine/threonine protein phosphatase 5, PP5 {Human 99.33
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.32
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.32
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 99.29
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.26
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.22
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.19
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.16
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.09
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.95
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.9
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.79
d1uf3a_228 Hypothetical protein TT1561 {Thermus thermophilus 98.79
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.26
d1su1a_184 Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 98.24
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.17
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 98.15
d2a22a1193 Vacuolar protein sorting 29, VPS29 {Cryptosporidiu 97.99
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.98
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.92
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.84
d1s3la_165 Putative phosphodiesterase MJ0936 {Methanococcus j 97.84
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.71
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.64
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.6
d1z2wa1182 Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus 97.51
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.49
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.38
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.38
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 97.31
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.3
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.3
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.29
d3ck2a1173 Uncharacterized protein SP1879 {Streptococcus pneu 97.26
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.22
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.19
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.17
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.17
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.13
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.13
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.1
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.07
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.06
d1okkd2207 GTPase domain of the signal recognition particle r 97.05
d1vmaa2213 GTPase domain of the signal recognition particle r 97.04
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.03
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.03
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.0
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.99
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.99
d2qy9a2211 GTPase domain of the signal recognition particle r 96.98
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.97
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.95
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.91
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.91
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.9
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.89
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.83
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.83
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.82
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.81
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.8
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.79
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.78
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.78
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.77
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.76
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.75
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.72
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.72
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.7
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.64
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.59
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.59
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.59
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.58
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.56
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.56
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.55
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.54
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.53
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.52
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.49
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.48
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 96.48
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.48
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.48
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.45
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.44
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.44
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.4
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.38
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.37
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 96.35
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.35
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.33
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.3
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.29
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 96.25
d2qy9a2211 GTPase domain of the signal recognition particle r 96.23
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.23
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.2
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.18
d2yvta1257 Uncharacterized protein Aq_1956 {Aquifex aeolicus 96.17
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.16
d1okkd2207 GTPase domain of the signal recognition particle r 96.14
d2hyda1255 Putative multidrug export ATP-binding/permease pro 96.11
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.1
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.09
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 96.08
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.08
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 96.08
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.04
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.03
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.0
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 95.99
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 95.99
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 95.95
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 95.93
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.92
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 95.9
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.88
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.87
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.86
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.86
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.85
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 95.8
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 95.8
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.78
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 95.77
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.72
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 95.71
d1vmaa2213 GTPase domain of the signal recognition particle r 95.68
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.65
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 95.6
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.56
d2awna2232 Maltose transport protein MalK, N-terminal domain 95.55
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 95.42
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.33
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.21
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 95.21
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.17
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 95.09
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 94.99
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 94.94
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 94.9
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 94.89
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 94.88
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 94.83
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.81
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 94.81
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.71
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 94.66
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 94.6
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 94.59
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.58
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 94.57
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.52
d2fh5b1207 Signal recognition particle receptor beta-subunit 94.41
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 94.39
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 94.31
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 94.26
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 94.21
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 94.18
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 94.16
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.14
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 94.11
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 94.11
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 94.02
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.96
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 93.86
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 93.84
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 93.74
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.74
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 93.67
d1ii7a_333 Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 93.4
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 93.37
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 93.36
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 93.32
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 93.22
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 93.15
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 93.02
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 92.93
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 92.9
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 92.85
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 92.85
d1xm7a_188 Hypothetical protein aq_1666 {Aquifex aeolicus [Ta 92.83
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.76
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 92.74
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 92.7
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.58
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 92.57
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 92.56
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 92.52
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 92.45
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 92.42
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 92.38
d3d03a1271 Glycerophosphodiesterase GpdQ {Enterobacter aeroge 92.28
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 92.27
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 92.2
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 92.19
d2awna2232 Maltose transport protein MalK, N-terminal domain 91.95
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 91.94
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 91.93
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 91.91
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 91.9
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.87
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 91.83
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 91.81
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.8
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 91.78
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 91.76
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 91.75
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 91.74
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 91.65
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 91.6
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 91.57
d1g2912240 Maltose transport protein MalK, N-terminal domain 91.57
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 91.56
d1nrjb_209 Signal recognition particle receptor beta-subunit 91.53
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.52
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 91.48
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 91.44
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 91.42
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 91.42
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 91.42
d1g2912240 Maltose transport protein MalK, N-terminal domain 91.41
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 91.41
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 91.4
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 91.37
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 91.29
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 91.26
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 91.25
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 91.24
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.2
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 91.16
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 91.15
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 91.13
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 91.13
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.1
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 91.05
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 90.99
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 90.99
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 90.93
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 90.93
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.91
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 90.87
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 90.86
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 90.78
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 90.76
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 90.74
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 90.74
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 90.72
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.72
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 90.69
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 90.67
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 90.66
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 90.66
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 90.61
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 90.61
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 90.59
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 90.54
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 90.52
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 90.51
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 90.48
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 90.43
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.35
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 90.34
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 90.33
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 90.28
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 90.28
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 90.28
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 90.28
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 90.21
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 90.15
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 90.11
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 90.11
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 90.07
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 90.05
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.05
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 90.03
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 89.99
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 89.96
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 89.93
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 89.87
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 89.85
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 89.84
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 89.8
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 89.66
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 89.65
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 89.6
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 89.57
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 89.54
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 89.48
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 89.46
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 89.46
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 89.44
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 89.43
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 89.34
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 89.31
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 89.31
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 89.29
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 89.27
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 89.26
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 89.24
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 89.23
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 89.2
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 89.14
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 89.11
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 89.09
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 89.07
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 89.05
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 88.92
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 88.89
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 88.84
d1nrjb_209 Signal recognition particle receptor beta-subunit 88.77
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 88.67
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 88.52
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 88.42
d1qzma_94 ATPase domain of protease Lon (La) {Escherichia co 88.34
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 88.32
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 88.27
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 88.21
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 88.07
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 88.02
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.97
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 87.95
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 87.93
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 87.9
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 87.88
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 87.87
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 87.87
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 87.8
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 87.76
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 87.71
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 87.62
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 87.56
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 87.48
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 87.47
d2hyda1255 Putative multidrug export ATP-binding/permease pro 87.45
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 87.44
d2fh5b1207 Signal recognition particle receptor beta-subunit 87.43
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 87.39
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 87.37
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 87.35
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 87.25
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 87.25
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 87.25
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 87.17
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 87.16
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.03
d2hy1a1256 Rv0805 cyclic nucleotide phosphodiesterase {Mycoba 87.02
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 87.0
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 86.97
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 86.89
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 86.88
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 86.86
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 86.81
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 86.76
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 86.73
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 86.63
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 86.6
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 86.49
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 86.34
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 86.3
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 86.27
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 86.22
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 86.1
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 86.03
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 85.92
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 85.87
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 85.86
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 85.84
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 85.75
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 85.75
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 85.74
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 85.74
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 85.71
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 85.7
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 85.67
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 85.64
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 85.62
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 85.6
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 85.58
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 85.58
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 85.54
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 85.4
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 85.36
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 85.36
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 85.25
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 85.24
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 85.21
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 85.17
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 85.1
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 85.08
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 85.03
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 85.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 84.97
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 84.96
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 84.91
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 84.78
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 84.77
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 84.72
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 84.68
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 84.67
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 84.62
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 84.53
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 84.37
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 84.28
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 84.24
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 84.16
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 84.13
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 84.13
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 84.08
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 84.05
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 83.99
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 83.99
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 83.68
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 83.66
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 83.4
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 83.34
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 83.08
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 82.94
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 82.66
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 82.4
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 82.37
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 82.28
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 82.23
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 82.19
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 82.09
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 82.01
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 81.98
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 81.86
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 81.84
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 81.69
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 81.61
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 81.56
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 81.45
d2nxfa1320 Uncharacterized C17orf48 homolog zgc:64213 {Zebraf 81.0
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 80.7
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 80.53
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 80.22
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 80.2
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]
Probab=100.00  E-value=1.8e-51  Score=452.80  Aligned_cols=386  Identities=57%  Similarity=0.899  Sum_probs=341.6

Q ss_pred             hhHHHHhhcchHHHHhcCCCCCccccHHHHHHHHHHHHcCCCCCcEEEcCCCCcHHHHHHHHHHHHHcCCCCCCcCCCeE
Q psy14504         24 IGYLKKYTIDLTEKARLGKLDPVIGRDDEIRRAIQVLQRRSKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPNSLLSKKI  103 (951)
Q Consensus        24 ~~~l~~~~~~l~e~~rp~~l~~lvG~~~~i~~l~~~l~~~~~~~iLL~GppGtGKTtla~~la~~l~~~~~~~~~~~~~~  103 (951)
                      ++.|++||++|+++++.+.++++||+++++++++.+|+++.++|+||+||||||||++++.+|+.+..+.+|..+.+.++
T Consensus         2 ~~~l~~~~~~l~~~a~~g~ld~~~gr~~ei~~~~~~L~r~~k~n~llvG~~GvGKtaiv~~la~~i~~~~vp~~l~~~~i   81 (387)
T d1qvra2           2 YNALEQYGIDLTRLAAEGKLDPVIGRDEEIRRVIQILLRRTKNNPVLIGEPGVGKTAIVEGLAQRIVKGDVPEGLKGKRI   81 (387)
T ss_dssp             CSHHHHHEEEHHHHHHTTCSCCCCSCHHHHHHHHHHHHCSSCCCCEEEECTTSCHHHHHHHHHHHHHHTCSCTTSTTCEE
T ss_pred             cHHHHHHHHHHHHHHHcCCCCCCcCcHHHHHHHHHHHhcCCCCCCeEECCCCCCHHHHHHHHHHHHHhCCCCHHHcCceE
Confidence            35799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEehhhhhcCccccccHHHHHHHHHHHHHhcCCCeEEEEecccccccCCCCCCchhHHhhhhhhccCCcEEEEEeecch
Q psy14504        104 LLLDIALLLAGTKYRGEFEDRLKKILKEISNNQKDIIIFIDELHTMIGTGKVEGSIDAGNMLKPELSRGELHCIGATTLN  183 (951)
Q Consensus       104 ~~~~~~~l~~~~~~~g~~~~~l~~~~~~a~~~~~~~iL~iDEid~l~~~~~~~~~~~~~~~L~~~le~~~i~vI~at~~~  183 (951)
                      +.+|++.+.+|.+|.|+++.++..++.++....+++||||||+|.|++.+.+.++.++.+.|+++|++|.+.||++|++.
T Consensus        82 ~~ld~~~l~ag~~~~g~~e~r~~~i~~~~~~~~~~~ilfide~h~l~~~g~~~g~~d~a~~Lkp~L~rg~~~~I~~tT~~  161 (387)
T d1qvra2          82 VSLQMGSLLAGAKYRGEFEERLKAVIQEVVQSQGEVILFIDELHTVVGAGKAEGAVDAGNMLKPALARGELRLIGATTLD  161 (387)
T ss_dssp             EEECC-----------CHHHHHHHHHHHHHTTCSSEEEEECCC-------------------HHHHHTTCCCEEEEECHH
T ss_pred             EEeeHhhhhcccCcchhHHHHHHHHHHHhccCCCceEEEeccHHHHhcCCCCCCcccHHHHHHHHHhCCCcceeeecCHH
Confidence            99999999999999999999999999999866678999999999999988777788999999999999999999999999


Q ss_pred             HHHHhhhcCHHHhhcceEEEeeCCCHHHHHHHHHHHHHhhhhhcCCCCChHHHHHHHHHhhhhcccCCCchhHHHHHHHH
Q psy14504        184 EYRQYIEKDAAFERRFQKILVEEPDIEETISILRGLQKKYEVHHGVEITDPAIVAASELSYRYISDRFMPDKAIDLIDEA  263 (951)
Q Consensus       184 ~~~~~~~~~~~l~~Rf~~i~~~~p~~~er~~il~~~~~~~~~~~~~~i~~~~l~~~~~~s~~~~~~~~~p~~a~~ll~~a  263 (951)
                      +|+.+ ..|++|.|||+.|.+++|+.++...||+.+...|+.+|++.++++++..++.+|.+|++++++|++|++++++|
T Consensus       162 ey~~~-e~d~al~rrF~~v~v~ep~~~~~~~il~~~~~~~e~~h~v~~~~~ai~~~v~ls~ryi~~r~~PdKAidlld~a  240 (387)
T d1qvra2         162 EYREI-EKDPALERRFQPVYVDEPTVEETISILRGLKEKYEVHHGVRISDSAIIAAATLSHRYITERRLPDKAIDLIDEA  240 (387)
T ss_dssp             HHHHH-TTCTTTCSCCCCEEECCCCHHHHHHHHHHHHHHHHHHTTCEECHHHHHHHHHHHHHHCCSSCTHHHHHHHHHHH
T ss_pred             HHHHh-cccHHHHHhcccccCCCCcHHHHHHHHHHHHHHHHhccCCcccHHHHHHHHHhcccccccccChhhHHHHHHHH
Confidence            99875 78999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhHHhhcCCchHHHHHHHHHHHHHHHHHHHHhhcchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHhHHHHHH
Q psy14504        264 AAKIKIEIDSKPEIMDKLERRLIQLKIEHEAIKREYDESSKKRLLLIKKEINKLEIKYANLEKIWKYEKTLIKDSQQIKE  343 (951)
Q Consensus       264 ~~~~~~~~~~~~~~l~~l~~~~~~~~~e~~~l~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  343 (951)
                      |+..++...+.|..++.+++.+.++..|.+++..+.+..+.+|+..++.++..++.+...+...|..++.....+..++.
T Consensus       241 ~a~~~i~~~s~P~el~~ler~I~qLe~E~~aL~ke~d~~s~~rl~~le~el~~lee~~~~L~~~w~~ek~~l~~i~~Lk~  320 (387)
T d1qvra2         241 AARLRMALESAPEEIDALERKKLQLEIEREALKKEKDPDSQERLKAIEAEIAKLTEEIAKLRAEWEREREILRKLREAQH  320 (387)
T ss_dssp             HHHHHHTTTTHHHHHHHHHHHHHHHHHHHHHHSSCSSHHHHSCTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHhhccCCcHHHHHHHHHHHHHHHHHHHHHhccchHHHHHHhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhhcCchHhhhhhhhhchHHHHHHHHHhhhhhccCCCccccccccccccChhHHHHHHHHhhC
Q psy14504        344 EIEKVRLKINKATRKSDWQTVSKLKYGELNKLERILKEKSQKDIQLPNNANKFTLLKTKVGSEEIAEIVSRTTG  417 (951)
Q Consensus       344 ~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~i~~~~~~~~~  417 (951)
                      +++.++..++.+.+.++++.++++.+..++.+++.+.......       .+..+++..|+.++|+.++++|||
T Consensus       321 ~Le~lr~~le~A~r~gd~e~AaeL~y~~ip~le~el~~l~~~~-------~~~~lvr~~VteedIA~VVSrWTG  387 (387)
T d1qvra2         321 RLDEVRREIELAERQYDLNRAAELRYGELPKLEAEVEALSEKL-------RGARFVRLEVTEEDIAEIVSRWTG  387 (387)
T ss_dssp             HHHHHHHHHHHHTTTTCHHHHHHHHTTHHHHHHHHHHHHHHHS-------SSCSSCCSEECHHHHHHHHHTTSS
T ss_pred             HHHHHHHHHHHHHHcccHHHHHHHhhchHHHHHHHHHHHHHHh-------cCCCCCcCccCHHHHHHHHHhhhC
Confidence            9999999999999999999999999999999999998776542       144677889999999999999997



>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qzma_ c.37.1.20 (A:) ATPase domain of protease Lon (La) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure