Psyllid ID: psy14571

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MRKRKKEKKKKKKKKKKKKKKKKKKKRITKVQIPSELSPLGVHPHPTSPSTDYTTPLTALKYPPSAALSQHQSLLNNSGRTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQTSFE
cHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
cccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHEEcc
mrkrkkekKKKKKKKKKKKKkkkkkkritkvqipselsplgvhphptspstdyttpltalkyppsaalsQHQSLLnnsgrtnftnkQLTELEKEFHFNKYLTRARRIEIASVLQLNETQTSFE
mrkrkkekkkkkkkkkkkkkkkkkkkritkvqipselsplgvhphptsPSTDYTTPLTALKYPPSAALSQHQSLLNNSGRTNFTNKQLTELEKEFHFNKYLTRARRIEIAsvlqlnetqtsfe
MrkrkkekkkkkkkkkkkkkkkkkkkrITKVQIPSELSPLGVHPHPTSPSTDYTTPLTALKYPPSAALSQHQSLLNNSGRTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQTSFE
***************************************************************************************LTELEKEFHFNKYLTRARRIEIASVLQ*********
**********************************************************************************FTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQT***
*****************************KVQIPSELSPLGVHPHPTSPSTDYTTPLTALKYPPSAALSQHQSLLNNSGRTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQTSFE
*****************************************************************************SGRTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQTSF*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxRITKVQIPSELSPLGVHPHPTSPSTDYTTPLTALKYPPSAALSQHQSLLNNSGRTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQTSFE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query123 2.2.26 [Sep-21-2011]
P10105635 Homeotic protein labial O yes N/A 0.333 0.064 0.902 4e-16
Q08820300 Homeobox protein Hox-D1 O N/A N/A 0.650 0.266 0.534 4e-16
Q08821240 Homeobox protein Hox-A1 ( N/A N/A 0.357 0.183 0.840 6e-16
Q28IU6301 Homeobox protein Hox-D1 O no N/A 0.634 0.259 0.522 7e-16
Q1KL10325 Homeobox protein Hox-A1a N/A N/A 0.357 0.135 0.840 1e-15
Q9IA19326 Homeobox protein Hox-A1 O N/A N/A 0.349 0.131 0.860 1e-15
P09022331 Homeobox protein Hox-A1 O yes N/A 0.357 0.132 0.840 2e-15
P49639335 Homeobox protein Hox-A1 O yes N/A 0.357 0.131 0.840 2e-15
P31259309 Homeobox protein Hox-B1 O no N/A 0.471 0.187 0.683 2e-15
Q01822327 Homeobox protein Hox-D1 O no N/A 0.333 0.125 0.853 2e-15
>sp|P10105|LAB_DROME Homeotic protein labial OS=Drosophila melanogaster GN=lab PE=1 SV=2 Back     alignment and function desciption
 Score = 83.2 bits (204), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%)

Query: 80  RTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQT 120
           RTNFTNKQLTELEKEFHFN+YLTRARRIEIA+ LQLNETQ 
Sbjct: 511 RTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQV 551
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Required for proper head development.
Drosophila melanogaster (taxid: 7227)
>sp|Q08820|HXD1_XENLA Homeobox protein Hox-D1 OS=Xenopus laevis GN=hoxd1 PE=2 SV=3 Back     alignment and function description
>sp|Q08821|HXA1_XENLA Homeobox protein Hox-A1 (Fragment) OS=Xenopus laevis GN=hoxa1 PE=2 SV=1 Back     alignment and function description
>sp|Q28IU6|HXD1_XENTR Homeobox protein Hox-D1 OS=Xenopus tropicalis GN=hoxd1 PE=2 SV=1 Back     alignment and function description
>sp|Q1KL10|HXA1A_TAKRU Homeobox protein Hox-A1a OS=Takifugu rubripes GN=hoxa1a PE=3 SV=1 Back     alignment and function description
>sp|Q9IA19|HXA1_HETFR Homeobox protein Hox-A1 OS=Heterodontus francisci GN=HOXA1 PE=3 SV=1 Back     alignment and function description
>sp|P09022|HXA1_MOUSE Homeobox protein Hox-A1 OS=Mus musculus GN=Hoxa1 PE=1 SV=2 Back     alignment and function description
>sp|P49639|HXA1_HUMAN Homeobox protein Hox-A1 OS=Homo sapiens GN=HOXA1 PE=1 SV=2 Back     alignment and function description
>sp|P31259|HXB1_CHICK Homeobox protein Hox-B1 OS=Gallus gallus GN=HOXB1 PE=3 SV=1 Back     alignment and function description
>sp|Q01822|HXD1_MOUSE Homeobox protein Hox-D1 OS=Mus musculus GN=Hoxd1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
350418159 474 PREDICTED: hypothetical protein LOC10074 0.544 0.141 0.671 2e-18
328778404 509 PREDICTED: hypothetical protein LOC72442 0.495 0.119 0.718 2e-18
340727752 477 PREDICTED: hypothetical protein LOC10064 0.495 0.127 0.718 3e-18
380028371 501 PREDICTED: uncharacterized protein LOC10 0.504 0.123 0.707 3e-18
307187176164 Homeotic protein labial [Camponotus flor 0.569 0.426 0.642 8e-18
383849613 468 PREDICTED: uncharacterized protein LOC10 0.495 0.130 0.703 1e-17
345489495189 PREDICTED: homeobox protein Hox-B1-like 0.373 0.243 0.913 2e-17
322799503160 hypothetical protein SINV_07039 [Solenop 0.455 0.35 0.767 2e-17
3777729767 Hox 1 [Bombyx mori] 0.373 0.686 0.934 3e-17
195498962 631 GE25839 [Drosophila yakuba] gi|194182848 0.365 0.071 0.911 4e-17
>gi|350418159|ref|XP_003491764.1| PREDICTED: hypothetical protein LOC100744978 [Bombus impatiens] Back     alignment and taxonomy information
 Score = 96.3 bits (238), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 53/70 (75%), Gaps = 3/70 (4%)

Query: 50  STDYTTPLTALKYPPSAALSQHQSLLNNSGRTNFTNKQLTELEKEFHFNKYLTRARRIEI 109
           +T  + P+  L   P A ++      NN+GRTNFTNKQLTELEKEFHFNKYLTRARRIEI
Sbjct: 336 ATTTSGPVNCLTGGPMAGIA---GSFNNTGRTNFTNKQLTELEKEFHFNKYLTRARRIEI 392

Query: 110 ASVLQLNETQ 119
           AS LQLNETQ
Sbjct: 393 ASALQLNETQ 402

Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328778404|ref|XP_001120278.2| PREDICTED: hypothetical protein LOC724422 [Apis mellifera] Back     alignment and taxonomy information
>gi|340727752|ref|XP_003402200.1| PREDICTED: hypothetical protein LOC100643550 [Bombus terrestris] Back     alignment and taxonomy information
>gi|380028371|ref|XP_003697877.1| PREDICTED: uncharacterized protein LOC100865518 [Apis florea] Back     alignment and taxonomy information
>gi|307187176|gb|EFN72416.1| Homeotic protein labial [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383849613|ref|XP_003700439.1| PREDICTED: uncharacterized protein LOC100877608 [Megachile rotundata] Back     alignment and taxonomy information
>gi|345489495|ref|XP_001603839.2| PREDICTED: homeobox protein Hox-B1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|322799503|gb|EFZ20811.1| hypothetical protein SINV_07039 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|37777297|dbj|BAC99310.1| Hox 1 [Bombyx mori] Back     alignment and taxonomy information
>gi|195498962|ref|XP_002096747.1| GE25839 [Drosophila yakuba] gi|194182848|gb|EDW96459.1| GE25839 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
FB|FBgn0002522635 lab "labial" [Drosophila melan 0.357 0.069 0.931 4.5e-18
UNIPROTKB|Q08820300 hoxd1 "Homeobox protein Hox-D1 0.658 0.27 0.545 2.5e-17
UNIPROTKB|P14653301 HOXB1 "Homeobox protein Hox-B1 0.617 0.252 0.55 6e-16
UNIPROTKB|F1NH11307 HOXB1 "Homeobox protein Hox-B1 0.463 0.185 0.694 1.1e-15
UNIPROTKB|P31259309 HOXB1 "Homeobox protein Hox-B1 0.463 0.184 0.694 1.2e-15
UNIPROTKB|E2QT64305 HOXB1 "Uncharacterized protein 0.617 0.249 0.55 1.9e-15
UNIPROTKB|P49639335 HOXA1 "Homeobox protein Hox-A1 0.691 0.253 0.505 3.4e-15
MGI|MGI:96182297 Hoxb1 "homeobox B1" [Mus muscu 0.642 0.265 0.523 4.8e-15
MGI|MGI:96201327 Hoxd1 "homeobox D1" [Mus muscu 0.674 0.253 0.5 5.1e-15
RGD|1309179328 Hoxd1 "homeo box D1" [Rattus n 0.674 0.253 0.489 6.7e-15
FB|FBgn0002522 lab "labial" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 213 (80.0 bits), Expect = 4.5e-18, Sum P(2) = 4.5e-18
 Identities = 41/44 (93%), Positives = 43/44 (97%)

Query:    76 NNSGRTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQ 119
             NNSGRTNFTNKQLTELEKEFHFN+YLTRARRIEIA+ LQLNETQ
Sbjct:   507 NNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQ 550
GO:0005634 "nucleus" evidence=ISS;NAS;IDA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IMP
GO:0046982 "protein heterodimerization activity" evidence=IPI
GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=IPI
GO:0007420 "brain development" evidence=IGI;IMP
GO:0009790 "embryo development" evidence=IMP
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=ISS;NAS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;NAS;TAS
GO:0007494 "midgut development" evidence=TAS
GO:0030154 "cell differentiation" evidence=TAS
GO:0001709 "cell fate determination" evidence=TAS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0035284 "brain segmentation" evidence=IGI
UNIPROTKB|Q08820 hoxd1 "Homeobox protein Hox-D1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|P14653 HOXB1 "Homeobox protein Hox-B1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NH11 HOXB1 "Homeobox protein Hox-B1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P31259 HOXB1 "Homeobox protein Hox-B1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QT64 HOXB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P49639 HOXA1 "Homeobox protein Hox-A1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:96182 Hoxb1 "homeobox B1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:96201 Hoxd1 "homeobox D1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309179 Hoxd1 "homeo box D1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
pfam0004657 pfam00046, Homeobox, Homeobox domain 4e-10
smart0038957 smart00389, HOX, Homeodomain 3e-08
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 2e-07
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 4e-06
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-04
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 1e-04
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 1e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-04
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 2e-04
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 4e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 5e-04
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 0.001
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 0.001
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 0.001
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 0.002
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 0.002
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 0.002
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 0.003
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 51.3 bits (124), Expect = 4e-10
 Identities = 21/40 (52%), Positives = 25/40 (62%)

Query: 80  RTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQ 119
           RT FT +QL ELEKEF  N+Y +   R E+A  L L E Q
Sbjct: 4   RTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQ 43

Length = 57
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 123
KOG0850|consensus245 99.47
KOG0842|consensus 307 99.4
KOG0488|consensus309 99.39
KOG0489|consensus261 99.36
KOG0484|consensus125 99.32
KOG2251|consensus 228 99.27
KOG0843|consensus197 99.26
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.26
KOG0487|consensus308 99.2
KOG0492|consensus246 99.19
KOG0485|consensus 268 99.19
KOG0848|consensus317 99.02
PF0004657 Homeobox: Homeobox domain not present here.; Inter 98.9
KOG0493|consensus342 98.89
KOG0494|consensus 332 98.88
KOG0486|consensus 351 98.83
KOG0491|consensus194 98.78
KOG0844|consensus 408 98.72
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 98.68
cd0008659 homeodomain Homeodomain; DNA binding domains invol 98.58
KOG0490|consensus 235 98.4
KOG0849|consensus 354 98.34
COG5576156 Homeodomain-containing transcription factor [Trans 98.18
KOG0847|consensus288 98.07
KOG0483|consensus 198 97.83
KOG3802|consensus398 97.22
KOG4577|consensus 383 96.78
KOG2252|consensus558 96.56
KOG0490|consensus235 95.41
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 93.36
KOG0774|consensus334 92.22
KOG0775|consensus304 91.94
KOG1168|consensus385 89.26
>KOG0850|consensus Back     alignment and domain information 
Probab=99.47  E-value=8.3e-14  Score=104.97  Aligned_cols=56  Identities=27%  Similarity=0.373  Sum_probs=52.3

Q ss_pred             cccccccCCCCCCCcccCHHHHHHHHHhhhhCCCCCHHHHHHHHHHhCCCCCCccc
Q psy14571         67 ALSQHQSLLNNSGRTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQTSF  122 (123)
Q Consensus        67 ~~~~~~~~k~rr~Rt~ft~~Ql~~LE~~F~~~~Yp~~~~R~~LA~~L~Lte~qVKI  122 (123)
                      ...++.+.|.|+.||+|+..||..|.++|+.++|+...+|++||+.||||.+||||
T Consensus       113 ~~~Ngk~KK~RKPRTIYSS~QLqaL~rRFQkTQYLALPERAeLAAsLGLTQTQVKI  168 (245)
T KOG0850|consen  113 RRPNGKGKKVRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKI  168 (245)
T ss_pred             eccCCCcccccCCcccccHHHHHHHHHHHhhcchhcCcHHHHHHHHhCCchhHhhh
Confidence            35566778889999999999999999999999999999999999999999999998

>KOG0842|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
1b72_A97 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 4e-16
2r5y_A88 Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HO 2e-09
1hom_A68 Determination Of The Three-Dimensional Structure Of 3e-09
9ant_A62 Antennapedia Homeodomain-Dna Complex Length = 62 5e-09
1ahd_P68 Determination Of The Nmr Solution Structure Of An A 6e-09
1ftz_A70 Nuclear Magnetic Resonance Solution Structure Of Th 5e-08
1san_A62 The Des(1-6)antennapedia Homeodomain: Comparison Of 8e-08
1b8i_A81 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 1e-07
2h1k_A63 Crystal Structure Of The Pdx1 Homeodomain In Comple 4e-07
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 3e-06
2lp0_A60 The Solution Structure Of Homeodomain-Protein Compl 5e-06
1puf_A77 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 1e-05
2hos_A63 Phage-selected Homeodomain Bound To Unmodified Dna 6e-05
2hdd_A61 Engrailed Homeodomain Q50k Variant Dna Complex Leng 1e-04
1p7i_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 1e-04
1hdd_C61 Crystal Structure Of An Engrailed Homeodomain-Dna C 1e-04
1du0_A57 Engrailed Homeodomain Q50a Variant Dna Complex Leng 1e-04
3hdd_A60 Engrailed Homeodomain Dna Complex Length = 60 1e-04
1p7j_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 1e-04
1enh_A54 Structural Studies Of The Engrailed Homeodomain Len 1e-04
1ztr_A61 Solution Structure Of Engrailed Homeodomain L16a Mu 4e-04
3a01_A93 Crystal Structure Of Aristaless And Clawless Homeod 5e-04
1jgg_A60 Even-Skipped Homeodomain Complexed To At-Rich Dna L 7e-04
>pdb|1B72|A Chain A, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 97 Back     alignment and structure 
Iteration: 1

 Score = 79.7 bits (195), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 53/75 (70%), Gaps = 4/75 (5%)
Query: 46  PTSPSTDYTTPLTALKYPPSAALSQHQSLLNNSG-RTNFTNKQLTELEKEFHFNKYLTRA 104
           PT+ + D+   +   + PP  A      L + SG RTNFT +QLTELEKEFHFNKYL+RA
Sbjct: 6   PTARTFDW---MKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEKEFHFNKYLSRA 62
Query: 105 RRIEIASVLQLNETQ 119
           RR+EIA+ L+LNETQ
Sbjct: 63  RRVEIAATLELNETQ 77
>pdb|2R5Y|A Chain A, Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HOX-Exd Site Length = 88 Back     alignment and structure
>pdb|1HOM|A Chain A, Determination Of The Three-Dimensional Structure Of The Antennapedia Homeodomain From Drosophila In Solution By 1h Nuclear Magnetic Resonance Spectroscopy Length = 68 Back     alignment and structure
>pdb|9ANT|A Chain A, Antennapedia Homeodomain-Dna Complex Length = 62 Back     alignment and structure
>pdb|1AHD|P Chain P, Determination Of The Nmr Solution Structure Of An Antennapedia Homeodomain-Dna Complex Length = 68 Back     alignment and structure
>pdb|1FTZ|A Chain A, Nuclear Magnetic Resonance Solution Structure Of The Fushi Tarazu Homeodomain From Drosophila And Comparison With The Antennapedia Homeodomain Length = 70 Back     alignment and structure
>pdb|1SAN|A Chain A, The Des(1-6)antennapedia Homeodomain: Comparison Of The Nmr Solution Structure And The Dna Binding Affinity With The Intact Antennapedia Homeodomain Length = 62 Back     alignment and structure
>pdb|1B8I|A Chain A, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 81 Back     alignment and structure
>pdb|2H1K|A Chain A, Crystal Structure Of The Pdx1 Homeodomain In Complex With Dna Length = 63 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2LP0|A Chain A, The Solution Structure Of Homeodomain-Protein Complex Length = 60 Back     alignment and structure
>pdb|1PUF|A Chain A, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 77 Back     alignment and structure
>pdb|2HOS|A Chain A, Phage-selected Homeodomain Bound To Unmodified Dna Length = 63 Back     alignment and structure
>pdb|2HDD|A Chain A, Engrailed Homeodomain Q50k Variant Dna Complex Length = 61 Back     alignment and structure
>pdb|1P7I|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52a Length = 59 Back     alignment and structure
>pdb|1HDD|C Chain C, Crystal Structure Of An Engrailed Homeodomain-Dna Complex At 2.8 Angstroms Resolution: A Framework For Understanding Homeodomain-Dna Interactions Length = 61 Back     alignment and structure
>pdb|1DU0|A Chain A, Engrailed Homeodomain Q50a Variant Dna Complex Length = 57 Back     alignment and structure
>pdb|3HDD|A Chain A, Engrailed Homeodomain Dna Complex Length = 60 Back     alignment and structure
>pdb|1P7J|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52e Length = 59 Back     alignment and structure
>pdb|1ENH|A Chain A, Structural Studies Of The Engrailed Homeodomain Length = 54 Back     alignment and structure
>pdb|1ZTR|A Chain A, Solution Structure Of Engrailed Homeodomain L16a Mutant Length = 61 Back     alignment and structure
>pdb|3A01|A Chain A, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 93 Back     alignment and structure
>pdb|1JGG|A Chain A, Even-Skipped Homeodomain Complexed To At-Rich Dna Length = 60 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 2e-17
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 4e-16
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 6e-16
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 3e-15
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 6e-15
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 7e-15
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 1e-14
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 3e-14
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 5e-14
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 1e-13
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 6e-13
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 4e-12
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 5e-12
3a01_A93 Homeodomain-containing protein; homeodomain, prote 7e-12
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 2e-11
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 2e-11
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 2e-11
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 4e-11
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 6e-11
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 3e-10
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 5e-10
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 1e-09
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 1e-09
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 4e-09
1e3o_C160 Octamer-binding transcription factor 1; transcript 1e-06
3a02_A60 Homeobox protein aristaless; homeodomain, developm 2e-05
2xsd_C164 POU domain, class 3, transcription factor 1; trans 2e-05
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 3e-05
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 4e-05
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 4e-05
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 6e-05
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 1e-04
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 1e-04
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 1e-04
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 3e-04
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 4e-04
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 4e-04
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 6e-04
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 8e-04
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 8e-04
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 9e-04
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
 Score = 71.1 bits (174), Expect = 2e-17
 Identities = 36/57 (63%), Positives = 45/57 (78%)

Query: 63  PPSAALSQHQSLLNNSGRTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQ 119
           P +A +S+      +  RTNFT +QLTELEKEFHFNKYL+RARR+EIA+ L+LNETQ
Sbjct: 21  PKTAKVSEPGLGSPSGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQ 77
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.38
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.38
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.38
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.37
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.36
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.35
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.35
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.34
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.34
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.34
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.33
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.33
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.33
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.32
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.32
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.32
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.32
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.32
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.3
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.3
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.3
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.3
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.29
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.29
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.29
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.28
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.28
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.28
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.27
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.27
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.27
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.26
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.24
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.24
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.24
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.24
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.23
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.23
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.21
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.2
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.2
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.18
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.17
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.15
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.15
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.14
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.12
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.11
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.1
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.09
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.08
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.05
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.03
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.03
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.02
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.02
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.01
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.0
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.0
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.0
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 98.99
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 98.99
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 98.98
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 98.94
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 98.94
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 98.92
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 98.91
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 98.91
2e19_A64 Transcription factor 8; homeobox domain, structura 98.88
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 98.85
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 98.8
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 98.74
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 98.73
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 98.52
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 98.26
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 97.95
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 97.78
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 89.15
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 83.71
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.38  E-value=3.7e-13  Score=85.69  Aligned_cols=50  Identities=38%  Similarity=0.490  Sum_probs=47.3

Q ss_pred             cCCCCCCCcccCHHHHHHHHHhhhhCCCCCHHHHHHHHHHhCCCCCCccc
Q psy14571         73 SLLNNSGRTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQTSF  122 (123)
Q Consensus        73 ~~k~rr~Rt~ft~~Ql~~LE~~F~~~~Yp~~~~R~~LA~~L~Lte~qVKI  122 (123)
                      ..+.++.||.||..|+..||..|..++||+..+|.+||..|+|++.||+|
T Consensus        14 ~~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~L~~~qV~v   63 (80)
T 2dmt_A           14 AKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKT   63 (80)
T ss_dssp             CCCCCCSCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHCCCHHHHHH
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHhCCCHHHeee
Confidence            45678899999999999999999999999999999999999999999986
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 123
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 1e-09
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 7e-09
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 1e-08
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 6e-08
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 6e-08
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 9e-08
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 5e-07
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 1e-06
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 1e-06
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 2e-06
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 4e-06
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 6e-06
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 1e-05
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 1e-05
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 2e-05
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 4e-05
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6e-05
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 7e-05
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 8e-05
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 2e-04
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 2e-04
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 2e-04
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 3e-04
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 6e-04
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 8e-04
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 0.001
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 0.003
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Antennapedia Homeodomain
species: Drosophila melanogaster [TaxId: 7227]

 Score = 48.6 bits (116), Expect = 1e-09
 Identities = 26/40 (65%), Positives = 28/40 (70%)

Query: 80  RTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQ 119
           R  +T  Q  ELEKEFHFN+YLTR RRIEIA  L L E Q
Sbjct: 1   RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQ 40
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.43
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.43
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.43
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.41
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.39
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.38
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.38
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.37
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.36
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.35
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.33
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.33
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.32
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.27
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.25
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.25
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.25
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.2
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.2
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.15
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.14
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.14
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.1
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.02
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 98.88
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 98.84
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 98.82
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 98.78
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 98.56
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 98.53
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 98.5
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 98.49
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Engrailed Homeodomain
species: Drosophila melanogaster [TaxId: 7227]

Probab=99.43  E-value=2.7e-14  Score=83.41  Aligned_cols=45  Identities=44%  Similarity=0.677  Sum_probs=43.5

Q ss_pred             CCCcccCHHHHHHHHHhhhhCCCCCHHHHHHHHHHhCCCCCCccc
Q psy14571         78 SGRTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQTSF  122 (123)
Q Consensus        78 r~Rt~ft~~Ql~~LE~~F~~~~Yp~~~~R~~LA~~L~Lte~qVKI  122 (123)
                      |.||.||..|+..||..|..++||+..+|.+||..|||++.||+|
T Consensus         1 R~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~lgL~~~qV~v   45 (53)
T d1p7ia_           1 RPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKI   45 (53)
T ss_dssp             CCCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHTCCHHHHHH
T ss_pred             CCCccCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHhCCChHHhhh
Confidence            579999999999999999999999999999999999999999986
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure