Psyllid ID: psy14769


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MSDDERDYDIESAEKRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEKVASRAQILKKAADYIQFMRRKNASHQQDIDDLKRQNAILEAQ
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
ccccccccccccHcHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
MSDDERDYDIESAEKRAHHNALERKRRDHIKDSFSslrdsvpslqgekvASRAQILKKAADYIQFMRRKNASHQQDIDDLKRQNAILEAQ
msdderdydiesaekrahhnalerkrrdhikdsfsslrdsvpslqgekvasRAQILKKAADYIQFMRrknashqqdidDLKRQNAILEAQ
MSDDERDYDIESAEKRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEKVASRAQILKKAADYIQFMRRKNASHQQDIDDLKRQNAILEAQ
*******************************************************L*KAADYIQF*************************
*******************NALERKRRDHIKDSFSSLRDSVP***********QILKKAADYIQFMR****************NAIL***
**********ESAEKRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEKVASRAQILKKAADYIQFMRRKNASHQQDIDDLKRQNAILEAQ
******************HNALERKRRDHIKDSFSSLRDSVPSLQGEKVASRAQILKKAADYIQFMRRKNASHQQDIDDLKRQNAIL***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDDERDYDIESAEKRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEKVASRAQILKKAADYxxxxxxxxxxxxxxxxxxxxxxxxxxxx
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query90 2.2.26 [Sep-21-2011]
P61244160 Protein max OS=Homo sapie no N/A 0.977 0.55 0.786 1e-31
P61245160 Protein max OS=Felis catu N/A N/A 0.977 0.55 0.786 1e-31
P52164160 Protein max OS=Rattus nor yes N/A 0.977 0.55 0.786 1e-31
P52162160 Protein max OS=Gallus gal yes N/A 0.977 0.55 0.786 1e-31
P28574160 Protein max OS=Mus muscul no N/A 0.977 0.55 0.786 2e-31
Q07016163 Protein max OS=Xenopus la N/A N/A 0.866 0.478 0.848 3e-31
P52161165 Protein max OS=Danio reri yes N/A 0.866 0.472 0.804 4e-30
P91664161 Protein max OS=Drosophila yes N/A 0.988 0.552 0.548 7e-25
P24793437 N-myc protein OS=Xenopus N/A N/A 0.7 0.144 0.460 5e-10
P20389454 N-myc 2 proto-oncogene pr N/A N/A 0.922 0.182 0.369 3e-09
>sp|P61244|MAX_HUMAN Protein max OS=Homo sapiens GN=MAX PE=1 SV=1 Back     alignment and function desciption
 Score =  134 bits (338), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 70/89 (78%), Positives = 78/89 (87%), Gaps = 1/89 (1%)

Query: 2  SDDERDYDIESAEKRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEKVASRAQILKKAAD 61
          SD+E+     +A+KRAHHNALERKRRDHIKDSF SLRDSVPSLQGEK ASRAQIL KA +
Sbjct: 11 SDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEK-ASRAQILDKATE 69

Query: 62 YIQFMRRKNASHQQDIDDLKRQNAILEAQ 90
          YIQ+MRRKN +HQQDIDDLKRQNA+LE Q
Sbjct: 70 YIQYMRRKNHTHQQDIDDLKRQNALLEQQ 98




Transcription regulator. Forms a sequence-specific DNA-binding protein complex with MYC or MAD which recognizes the core sequence 5'-CAC[GA]TG-3'. The MYC-MAX complex is a transcriptional activator, whereas the MAD-MAX complex is a repressor. May repress transcription via the recruitment of a chromatin remodeling complex containing H3 'Lys-9' histone methyltransferase activity.
Homo sapiens (taxid: 9606)
>sp|P61245|MAX_FELCA Protein max OS=Felis catus GN=MAX PE=2 SV=1 Back     alignment and function description
>sp|P52164|MAX_RAT Protein max OS=Rattus norvegicus GN=Max PE=1 SV=1 Back     alignment and function description
>sp|P52162|MAX_CHICK Protein max OS=Gallus gallus GN=MAX PE=3 SV=1 Back     alignment and function description
>sp|P28574|MAX_MOUSE Protein max OS=Mus musculus GN=Max PE=1 SV=1 Back     alignment and function description
>sp|Q07016|MAX_XENLA Protein max OS=Xenopus laevis GN=max PE=2 SV=1 Back     alignment and function description
>sp|P52161|MAX_DANRE Protein max OS=Danio rerio GN=max PE=2 SV=1 Back     alignment and function description
>sp|P91664|MAX_DROME Protein max OS=Drosophila melanogaster GN=Max PE=1 SV=1 Back     alignment and function description
>sp|P24793|MYCN_XENLA N-myc protein OS=Xenopus laevis GN=mycn PE=2 SV=1 Back     alignment and function description
>sp|P20389|MYC2_MARMO N-myc 2 proto-oncogene protein OS=Marmota monax GN=N-MYC2 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query90
240849031141 bhlhzip transcription factor max/bigmax- 1.0 0.638 0.9 6e-40
350421414171 PREDICTED: protein max-like [Bombus impa 1.0 0.526 0.738 2e-36
383861970171 PREDICTED: protein max-like [Megachile r 1.0 0.526 0.738 3e-36
380018849171 PREDICTED: protein max-like isoform 1 [A 1.0 0.526 0.738 3e-36
66514865171 PREDICTED: protein max isoform 2 [Apis m 1.0 0.526 0.738 3e-36
328789189156 PREDICTED: protein max isoform 1 [Apis m 1.0 0.576 0.738 4e-36
380018851156 PREDICTED: protein max-like isoform 2 [A 1.0 0.576 0.738 4e-36
340726944161 PREDICTED: protein max-like isoform 2 [B 1.0 0.559 0.738 4e-36
340726942171 PREDICTED: protein max-like isoform 1 [B 1.0 0.526 0.738 4e-36
156551283 198 PREDICTED: protein max-like [Nasonia vit 1.0 0.454 0.738 1e-35
>gi|240849031|ref|NP_001155631.1| bhlhzip transcription factor max/bigmax-like [Acyrthosiphon pisum] gi|239790453|dbj|BAH71787.1| ACYPI005523 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 87/90 (96%)

Query: 1  MSDDERDYDIESAEKRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEKVASRAQILKKAA 60
          MSDD+RD ++E+AEKRAHHNALERKRRDHIKDSF+SLRDSVPSLQGEKVASRAQILKKAA
Sbjct: 1  MSDDDRDVELETAEKRAHHNALERKRRDHIKDSFTSLRDSVPSLQGEKVASRAQILKKAA 60

Query: 61 DYIQFMRRKNASHQQDIDDLKRQNAILEAQ 90
          DYIQFMRRKN SHQQDIDDLKRQN ILE+Q
Sbjct: 61 DYIQFMRRKNVSHQQDIDDLKRQNNILESQ 90




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350421414|ref|XP_003492834.1| PREDICTED: protein max-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383861970|ref|XP_003706457.1| PREDICTED: protein max-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380018849|ref|XP_003693333.1| PREDICTED: protein max-like isoform 1 [Apis florea] Back     alignment and taxonomy information
>gi|66514865|ref|XP_623530.1| PREDICTED: protein max isoform 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|328789189|ref|XP_003251241.1| PREDICTED: protein max isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380018851|ref|XP_003693334.1| PREDICTED: protein max-like isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|340726944|ref|XP_003401811.1| PREDICTED: protein max-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|340726942|ref|XP_003401810.1| PREDICTED: protein max-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|156551283|ref|XP_001601193.1| PREDICTED: protein max-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query90
UNIPROTKB|G3V2R5125 MAX "Protein max" [Homo sapien 0.977 0.704 0.802 2.3e-32
UNIPROTKB|G3V563121 MAX "Protein max" [Homo sapien 0.977 0.727 0.802 2.3e-32
UNIPROTKB|Q6V3B194 MAX "MAX protein" [Homo sapien 0.977 0.936 0.802 2.3e-32
UNIPROTKB|F2Z5K0151 MAX "Uncharacterized protein" 0.977 0.582 0.802 2.3e-32
UNIPROTKB|P52162160 MAX "Protein max" [Gallus gall 0.977 0.55 0.786 2e-31
UNIPROTKB|E2QZS2160 MAX "Uncharacterized protein" 0.977 0.55 0.786 2e-31
UNIPROTKB|P61244160 MAX "Protein max" [Homo sapien 0.977 0.55 0.786 2e-31
UNIPROTKB|P61245160 MAX "Protein max" [Felis catus 0.977 0.55 0.786 2e-31
RGD|621101160 Max "MYC associated factor X" 0.977 0.55 0.786 2e-31
MGI|MGI:96921160 Max "Max protein" [Mus musculu 0.977 0.55 0.786 2.6e-31
UNIPROTKB|G3V2R5 MAX "Protein max" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 354 (129.7 bits), Expect = 2.3e-32, P = 2.3e-32
 Identities = 73/91 (80%), Positives = 82/91 (90%)

Query:     1 MSDDERDYDIES-AEKRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEKVASRAQILKKA 59
             MSD++ D ++ES A+KRAHHNALERKRRDHIKDSF SLRDSVPSLQGEK ASRAQIL KA
Sbjct:     1 MSDND-DIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEK-ASRAQILDKA 58

Query:    60 ADYIQFMRRKNASHQQDIDDLKRQNAILEAQ 90
              +YIQ+MRRKN +HQQDIDDLKRQNA+LE Q
Sbjct:    59 TEYIQYMRRKNHTHQQDIDDLKRQNALLEQQ 89




GO:0046983 "protein dimerization activity" evidence=IEA
UNIPROTKB|G3V563 MAX "Protein max" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6V3B1 MAX "MAX protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5K0 MAX "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P52162 MAX "Protein max" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZS2 MAX "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P61244 MAX "Protein max" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P61245 MAX "Protein max" [Felis catus (taxid:9685)] Back     alignment and assigned GO terms
RGD|621101 Max "MYC associated factor X" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:96921 Max "Max protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P52162MAX_CHICKNo assigned EC number0.78650.97770.55yesN/A
P52161MAX_DANRENo assigned EC number0.80480.86660.4727yesN/A
P52164MAX_RATNo assigned EC number0.78650.97770.55yesN/A
P91664MAX_DROMENo assigned EC number0.54860.98880.5527yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query90
pfam0001052 pfam00010, HLH, Helix-loop-helix DNA-binding domai 9e-14
cd0008360 cd00083, HLH, Helix-loop-helix domain, found in sp 3e-12
smart0035353 smart00353, HLH, helix loop helix domain 6e-10
>gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain Back     alignment and domain information
 Score = 59.4 bits (145), Expect = 9e-14
 Identities = 22/53 (41%), Positives = 37/53 (69%), Gaps = 1/53 (1%)

Query: 15 KRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEKVASRAQILKKAADYIQFMR 67
          +R  HN  ER+RRD I D+F  LR+ +P+   +K+ S+A+IL+ A +YI+ ++
Sbjct: 1  RRKAHNERERRRRDRINDAFEELRELLPTPPNKKL-SKAEILRLAIEYIKHLQ 52


Length = 52

>gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>gnl|CDD|197674 smart00353, HLH, helix loop helix domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 90
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 99.77
KOG1319|consensus229 99.72
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 99.71
KOG1318|consensus411 99.7
smart0035353 HLH helix loop helix domain. 99.61
KOG2483|consensus232 99.58
KOG0561|consensus 373 99.22
KOG3561|consensus 803 99.14
KOG4304|consensus 250 99.1
KOG3960|consensus284 99.07
KOG4029|consensus228 98.93
KOG2588|consensus 953 98.91
PLN0321793 transcription factor ATBS1; Provisional 98.39
KOG4447|consensus173 98.13
KOG3898|consensus 254 98.08
KOG3910|consensus632 98.05
KOG4395|consensus285 98.03
KOG3582|consensus 856 96.02
KOG4447|consensus173 93.79
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 93.42
COG307479 Uncharacterized protein conserved in bacteria [Fun 91.61
smart0033865 BRLZ basic region leucin zipper. 91.51
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 90.3
PRK1542279 septal ring assembly protein ZapB; Provisional 90.21
KOG3560|consensus 712 89.99
PF1477560 NYD-SP28_assoc: Sperm tail C-terminal domain 89.87
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 89.82
PHA0338694 P10 fibrous body protein; Provisional 89.13
KOG3558|consensus 768 88.41
KOG3559|consensus 598 87.39
KOG4343|consensus 655 84.44
smart0034044 HALZ homeobox associated leucin zipper. 83.71
PRK14127109 cell division protein GpsB; Provisional 83.61
>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information
Probab=99.77  E-value=2.3e-18  Score=95.61  Aligned_cols=53  Identities=45%  Similarity=0.747  Sum_probs=48.9

Q ss_pred             HHHHHHHHHhHHHHHHHHHHHHHhhcCCCC--CCcccccHHHHHHHHHHHHHHHH
Q psy14769         15 KRAHHNALERKRRDHIKDSFSSLRDSVPSL--QGEKVASRAQILKKAADYIQFMR   67 (90)
Q Consensus        15 ~R~~hn~~Er~RR~~i~~~~~~L~~llP~~--~~~~k~sK~~iL~~ai~yIk~L~   67 (90)
                      +|..||..|++||..||.+|+.|+.+||.+  ....+++|++||..||+||++||
T Consensus         1 rR~~h~~~Er~RR~~i~~~~~~L~~llp~~~~~~~~k~~K~~iL~~ai~yI~~Lq   55 (55)
T PF00010_consen    1 RRQKHNERERRRRDRINDCFDELRELLPSCSAGSSRKLSKASILQKAIDYIKQLQ   55 (55)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHCCSSHHCCTTSSSSHHHHHHHHHHHHHHHH
T ss_pred             CCchHHHHHHHHHHHHHHHHHHHHHhccchhccccccCCHHHHHHHHHHHHHHhC
Confidence            589999999999999999999999999997  24456999999999999999996



; InterPro: IPR011598 The helix-loop-helix (HLH) DNA-binding domain consists of a closed bundle of four helices in a left-handed twist with two crossover connections. The HLH domain directs dimerisation, and is juxtaposed to basic regions to create a DNA interaction interface surface that recognises specific DNA sequences. Basic region/HLH (bHLH) proteins regulate diverse biological pathways []. bHLH proteins include MyoD [], SREBPs (sterol regulatory element binding proteins) [], and yeast Pho4 (phosphatase system) []. In certain proteins the bHLH domain contains a leucine-zipper motif. The bHLH/leucine zipper (bHLHZip) domain specifies dimerisation within a network of proteins and determines sequence-specific DNA binding []. bHLHZip domains occur in the transcription factors Myc, Mad, Max and Usf [, ]. This entry is bHLHZip, which covers the bHLH domain and the leucine zipper motif, when present.; PDB: 1NLW_A 1NKP_D 1A93_A 2A93_A 1AM9_C 3U5V_A 1A0A_B 2QL2_C 1UKL_C 1AN4_B ....

>KOG1319|consensus Back     alignment and domain information
>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>KOG1318|consensus Back     alignment and domain information
>smart00353 HLH helix loop helix domain Back     alignment and domain information
>KOG2483|consensus Back     alignment and domain information
>KOG0561|consensus Back     alignment and domain information
>KOG3561|consensus Back     alignment and domain information
>KOG4304|consensus Back     alignment and domain information
>KOG3960|consensus Back     alignment and domain information
>KOG4029|consensus Back     alignment and domain information
>KOG2588|consensus Back     alignment and domain information
>PLN03217 transcription factor ATBS1; Provisional Back     alignment and domain information
>KOG4447|consensus Back     alignment and domain information
>KOG3898|consensus Back     alignment and domain information
>KOG3910|consensus Back     alignment and domain information
>KOG4395|consensus Back     alignment and domain information
>KOG3582|consensus Back     alignment and domain information
>KOG4447|consensus Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>KOG3560|consensus Back     alignment and domain information
>PF14775 NYD-SP28_assoc: Sperm tail C-terminal domain Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>PHA03386 P10 fibrous body protein; Provisional Back     alignment and domain information
>KOG3558|consensus Back     alignment and domain information
>KOG3559|consensus Back     alignment and domain information
>KOG4343|consensus Back     alignment and domain information
>smart00340 HALZ homeobox associated leucin zipper Back     alignment and domain information
>PRK14127 cell division protein GpsB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query90
1an2_A86 Recognition By Max Of Its Cognate Dna Through A Dim 6e-32
1nlw_B76 Crystal Structure Of Mad-Max Recognizing Dna Length 2e-31
1nkp_B83 Crystal Structure Of Myc-Max Recognizing Dna Length 2e-31
1hlo_A80 The Crystal Structure Of An Intact Human Max-Dna Co 3e-30
1r05_A87 Solution Structure Of Max B-Hlh-Lz Length = 87 8e-30
1nkp_A88 Crystal Structure Of Myc-Max Recognizing Dna Length 4e-08
1a93_B34 Nmr Solution Structure Of The C-Myc-Max Heterodimer 7e-06
1an4_A65 Structure And Function Of The BHLHZ DOMAIN OF USF L 1e-05
1am9_A82 Human Srebp-1a Bound To Ldl Receptor Promoter Lengt 4e-05
3u5v_A76 Crystal Structure Of Max-E47 Length = 76 1e-04
>pdb|1AN2|A Chain A, Recognition By Max Of Its Cognate Dna Through A Dimeric BHLHZ DOMAIN Length = 86 Back     alignment and structure

Iteration: 1

Score = 132 bits (331), Expect = 6e-32, Method: Compositional matrix adjust. Identities = 67/78 (85%), Positives = 72/78 (92%), Gaps = 1/78 (1%) Query: 13 AEKRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEKVASRAQILKKAADYIQFMRRKNAS 72 A+KRAHHNALERKRRDHIKDSF SLRDSVPSLQGEK ASRAQIL KA +YIQ+MRRKN + Sbjct: 1 ADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEK-ASRAQILDKATEYIQYMRRKNHT 59 Query: 73 HQQDIDDLKRQNAILEAQ 90 HQQDIDDLKRQNA+LE Q Sbjct: 60 HQQDIDDLKRQNALLEQQ 77
>pdb|1NLW|B Chain B, Crystal Structure Of Mad-Max Recognizing Dna Length = 76 Back     alignment and structure
>pdb|1NKP|B Chain B, Crystal Structure Of Myc-Max Recognizing Dna Length = 83 Back     alignment and structure
>pdb|1HLO|A Chain A, The Crystal Structure Of An Intact Human Max-Dna Complex: New Insights Into Mechanisms Of Transcriptional Control Length = 80 Back     alignment and structure
>pdb|1R05|A Chain A, Solution Structure Of Max B-Hlh-Lz Length = 87 Back     alignment and structure
>pdb|1NKP|A Chain A, Crystal Structure Of Myc-Max Recognizing Dna Length = 88 Back     alignment and structure
>pdb|1A93|B Chain B, Nmr Solution Structure Of The C-Myc-Max Heterodimeric Leucine Zipper, Nmr, Minimized Average Structure Length = 34 Back     alignment and structure
>pdb|1AN4|A Chain A, Structure And Function Of The BHLHZ DOMAIN OF USF Length = 65 Back     alignment and structure
>pdb|1AM9|A Chain A, Human Srebp-1a Bound To Ldl Receptor Promoter Length = 82 Back     alignment and structure
>pdb|3U5V|A Chain A, Crystal Structure Of Max-E47 Length = 76 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query90
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 2e-23
1hlo_A80 Protein (transcription factor MAX); transcriptiona 1e-22
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 2e-22
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 1e-18
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 3e-16
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 5e-15
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 2e-07
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 2e-06
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 3e-05
1a93_B34 MAX protein, coiled coil, LZ; leucine zipper, 2D s 4e-05
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 3e-04
1a0a_A63 BHLH, protein (phosphate system positive regulator 5e-04
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 Back     alignment and structure
 Score = 84.7 bits (210), Expect = 2e-23
 Identities = 28/80 (35%), Positives = 45/80 (56%)

Query: 11 ESAEKRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEKVASRAQILKKAADYIQFMRRKN 70
              KR  HN LER+RR+ +K SF +LRD +P L+  + A +  ILKKA  YI  ++ + 
Sbjct: 2  HMNVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEE 61

Query: 71 ASHQQDIDDLKRQNAILEAQ 90
               + D L+++   L+ +
Sbjct: 62 QKLISEEDLLRKRREQLKHK 81


>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Length = 76 Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Length = 60 Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Length = 68 Back     alignment and structure
>1a93_B MAX protein, coiled coil, LZ; leucine zipper, 2D solution structure, H-bonds, buried salt bridge, proto-oncogene, nuclear protein; NMR {Mus musculus} SCOP: h.1.3.1 PDB: 2a93_B Length = 34 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Length = 63 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query90
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 99.92
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 99.91
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.9
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.89
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.88
4ati_A118 MITF, microphthalmia-associated transcription fact 99.85
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.8
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 99.79
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 99.76
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.74
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 99.74
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.73
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.69
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 99.52
4ath_A83 MITF, microphthalmia-associated transcription fact 99.51
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 99.34
4f3l_A 361 Mclock, circadian locomoter output cycles protein 99.32
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 99.28
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 93.81
3ra3_B28 P2F; coiled coil domain, fiber, KIH interactions, 93.37
3muj_A138 Transcription factor COE3; immunoglobulin like fol 93.37
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 93.28
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 93.15
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 92.52
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 91.98
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 91.68
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 91.57
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 91.35
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 91.16
1a93_B34 MAX protein, coiled coil, LZ; leucine zipper, 2D s 91.11
3m48_A33 General control protein GCN4; leucine zipper, synt 90.76
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 90.73
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 90.69
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 89.95
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 89.78
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 89.47
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 89.36
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 89.16
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 88.67
2hy6_A34 General control protein GCN4; protein design, para 87.39
1uo4_A34 General control protein GCN4; four helix bundle, c 86.75
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 86.57
1uii_A83 Geminin; human, DNA replication, cell cycle; 2.00A 86.52
4dzn_A33 Coiled-coil peptide CC-PIL; de novo protein; HET: 86.29
2bni_A34 General control protein GCN4; four helix bundle, a 86.18
3w03_C184 DNA repair protein XRCC4; coiled-coil, NHEJ, DSBS 83.76
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 83.56
2r2v_A34 GCN4 leucine zipper; coiled coils, anti-parallel t 83.21
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 83.14
1wlq_A83 Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2z 83.02
2wuj_A57 Septum site-determining protein diviva; bacterial 82.98
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 82.73
3ra3_A28 P1C; coiled coil domain, fiber, KIH interactions, 82.14
3v86_A27 De novo design helix; computational design of A pr 82.0
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
Probab=99.92  E-value=1.1e-24  Score=131.19  Aligned_cols=79  Identities=35%  Similarity=0.539  Sum_probs=72.7

Q ss_pred             hhHHHHHHHHHHHhHHHHHHHHHHHHHhhcCCCCCCcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q psy14769         11 ESAEKRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEKVASRAQILKKAADYIQFMRRKNASHQQDIDDLKRQNAILEA   89 (90)
Q Consensus        11 ~~~~~R~~hn~~Er~RR~~i~~~~~~L~~llP~~~~~~k~sK~~iL~~ai~yIk~L~~~~~~l~~~~~~L~~~~~~L~~   89 (90)
                      ++..+|.+||.+||+||..||++|..|+.+||.+++..|+||++||..||+||++|+..+..+..+++.|+.++..|++
T Consensus         2 ed~~~R~~Hn~~ER~RR~~ln~~f~~Lr~~vP~~~~~~K~sK~~iL~~A~~YI~~L~~~~~~l~~~~~~L~~~n~~L~~   80 (88)
T 1nkp_A            2 HMNVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKH   80 (88)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCGGGTTCTTCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CChhhhhhhhHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            5677999999999999999999999999999998766789999999999999999999999998888888888888765



>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
>3ra3_B P2F; coiled coil domain, fiber, KIH interactions, synthetic biolo helical reconstruction, de novo protein; HET: PHI; 2.31A {Synthetic} Back     alignment and structure
>3muj_A Transcription factor COE3; immunoglobulin like fold, helix-loop-helix, structural genom consortium, SGC, DNA binding protein; 1.92A {Homo sapiens} PDB: 3mqi_A Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>1a93_B MAX protein, coiled coil, LZ; leucine zipper, 2D solution structure, H-bonds, buried salt bridge, proto-oncogene, nuclear protein; NMR {Mus musculus} SCOP: h.1.3.1 PDB: 2a93_B Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1uii_A Geminin; human, DNA replication, cell cycle; 2.00A {Homo sapiens} SCOP: h.1.28.1 Back     alignment and structure
>4dzn_A Coiled-coil peptide CC-PIL; de novo protein; HET: PHI; 1.59A {Synthetic} PDB: 4dzm_A* 4dzl_A* 4dzk_A 1u0i_A 1u0i_B Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>3w03_C DNA repair protein XRCC4; coiled-coil, NHEJ, DSBS repair, KU70/80, DNA-PKCS, DNA ligas binding protein; HET: DNA; 8.49A {Homo sapiens} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>2r2v_A GCN4 leucine zipper; coiled coils, anti-parallel tetramer, protein design, de novo protein; HET: CIT; 1.90A {Saccharomyces cerevisiae} SCOP: h.1.3.1 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1wlq_A Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2zxx_A* Back     alignment and structure
>2wuj_A Septum site-determining protein diviva; bacterial cell division, septation, cell cycle, sporulation; 1.40A {Bacillus subtilis} PDB: 2wuk_A Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>3ra3_A P1C; coiled coil domain, fiber, KIH interactions, synthetic biolo helical reconstruction, de novo protein; HET: PHI; 2.31A {Synthetic} Back     alignment and structure
>3v86_A De novo design helix; computational design of A protein crystal, helical coil, DE designed helix, de novo protein; 2.91A {Synthetic} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 90
d1nkpa_88 a.38.1.1 (A:) Myc proto-oncogene protein {Human (H 4e-14
d1nkpb_83 a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T 5e-14
d1nlwa_79 a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T 2e-12
d1an4a_65 a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien 2e-10
d1a0aa_63 a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa 8e-10
d1mdya_68 a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul 5e-09
d1uklc_61 a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId 2e-07
d1am9a_80 a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI 3e-07
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Myc proto-oncogene protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 59.5 bits (144), Expect = 4e-14
 Identities = 28/76 (36%), Positives = 45/76 (59%)

Query: 15 KRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEKVASRAQILKKAADYIQFMRRKNASHQ 74
          KR  HN LER+RR+ +K SF +LRD +P L+  + A +  ILKKA  YI  ++ +     
Sbjct: 6  KRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLI 65

Query: 75 QDIDDLKRQNAILEAQ 90
           + D L+++   L+ +
Sbjct: 66 SEEDLLRKRREQLKHK 81


>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query90
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 99.89
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 99.8
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 99.74
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 99.72
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 99.64
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Mad protein
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90  E-value=1.4e-23  Score=122.51  Aligned_cols=75  Identities=27%  Similarity=0.401  Sum_probs=71.2

Q ss_pred             HHHHHHHHHhHHHHHHHHHHHHHhhcCCCCCCcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q psy14769         15 KRAHHNALERKRRDHIKDSFSSLRDSVPSLQGEKVASRAQILKKAADYIQFMRRKNASHQQDIDDLKRQNAILEA   89 (90)
Q Consensus        15 ~R~~hn~~Er~RR~~i~~~~~~L~~llP~~~~~~k~sK~~iL~~ai~yIk~L~~~~~~l~~~~~~L~~~~~~L~~   89 (90)
                      .|.+||.+||+||..||++|+.|+++||++++..|+||++||..||+||+.|+..+..+..+++.|..++..|+.
T Consensus         1 ~R~~Hn~~Er~RR~~in~~f~~L~~llP~~~~~~k~sK~~iL~~A~~yI~~L~~~~~~l~~~~~~L~~~~~~L~~   75 (79)
T d1nlwa_           1 SRSTHNEMEKNRRAHLRLSLEKLKGLVPLGPDSSRHTTLSLLTKAKLHIKKLEDSDRKAVHQIDQLQREQRHLKR   75 (79)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHSSCCCSSSCCCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ChHHHHHHHHHHHHHHHHHHHHHHHhCccCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            378999999999999999999999999998777779999999999999999999999999999999999999875



>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure