Psyllid ID: psy14872

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410----
MNIEAENEKNFCNKGPSVYNVVDKGNCHCRMYRVPHDDRCCASELKSNQDRTCQQCSTITHRTTKSLALPTSRLVPIQAHPQLALVLSYQALASHKSIFDKVVTSYKEVWKSPVKTYQSSSIIINIIKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYTHNPYPSPREKRELAEATGLTTTQVSNWFSSANITSSPNTSTSTASISPILPSFGFTQEQVACVCEVLQQSGNIERLGRFLWSLPACEKLHKNESVLKAKAMVAFHRGNFKDLYRILESHQFSPHNHPKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEQKDGSVHSFRVNIGGDSKTQY
cccccHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHcHHHHHcccccccccccccccccccc
ccccEccccccccccccEEEEEcccccccEEEEccccccccHHHHHHccccHHHHHHHHHHHHHHccHcHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcccccccccEEEEEcccEEEEEccccccEEEccccEEEEEcHHHHHHHHHHHHccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHccHHHHHHHHHHHHHHccHHHHHHHHHHccccHHcHHHHHHHHHHHHHHHHHHHccccccccccEEEEEccccccEEEcccccEEEccHHHHHHHHHHHHccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc
mnieaeneknfcnkgpsvynvvdkgnchcrmyrvphddrccaselksnqdrtcqqcstithrttkslalptsrlvpiqahpQLALVLSYQALASHKSIFDKVVTSYKEVwkspvktyqsssIIINIIKYRvrrkfplprtiwdgeetsycfkeksrsvlrdwythnpypsprekreLAEATGLTTTQVSNWfssanitsspntststasispilpsfgftqEQVACVCEVLQQSGNIERLGRFlwslpaceklhKNESVLKAKAMVAFHRGNFKDLYRILEshqfsphnhpkLQALWLKAHYVEAEklrgrplgavgkyrvrrkfplprtiwdgeetsycfkeksrsvlrdwythnpypsprekreLAEATGLTTTQVSNWFKNRRQRDRaaeqkdgsvhsfrvniggdsktqy
mnieaeneknfcnkgpsvYNVVDKGNCHCRMYRVPHDDRCCASElksnqdrtcqqcSTITHRTTKSLALPTSRLVPIQAHPQLALVLSYQALASHKSIFDKVVTSYKEVwkspvktyqsssiiiniikyrvrrkfplprtiwdgeetsycfkeksrsvlrdwythnpypsprekRELAEATGLTTTQVSNWFSSANITSSPNTSTSTASISPILPSFGFTQEQVACVCEVLQQSGNIERLGRFLWSLPACEKLHKNESVLKAKAMVAFHRGNFKDLYRILESHQFSPHNHPKLQALWLKAHYVEAEklrgrplgavgkyrvrrkfplprtiwdgeetsycfkeksrsvlrdwYTHNpypsprekrelaeatgltttqvsnwfknrRQRDRaaeqkdgsvhsfrvniggdsktqy
MNIEAENEKNFCNKGPSVYNVVDKGNCHCRMYRVPHDDRCCASELKSNQDRTCQQCSTITHRTTKSLALPTSRLVPIQAHPQLALVLSYQALASHKSIFDKVVTSYKEVWKSPVKTYQSSSIIINIIKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYTHNPYPSPREKRELAEATGLTTTQVSNWFssanitsspntststasispILPSFGFTQEQVACVCEVLQQSGNIERLGRFLWSLPACEKLHKNESVLKAKAMVAFHRGNFKDLYRILESHQFSPHNHPKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEQKDGSVHSFRVNIGGDSKTQY
**********FCNKGPSVYNVVDKGNCHCRMYRVPHDDRCCASELK***DRTCQQCSTITHRTTKSLALPTSRLVPIQAHPQLALVLSYQALASHKSIFDKVVTSYKEVWKSPVKTYQSSSIIINIIKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYTHN***********************NWF*******************PILPSFGFTQEQVACVCEVLQQSGNIERLGRFLWSLPACEKLHKNESVLKAKAMVAFHRGNFKDLYRILESHQFSPHNHPKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYTHN**********************************************************
********KNFCNKGPSVYNVVDKGNCHCRMYRVPHD***********QDRTCQQCSTITHRTTKSLALPTSRLVPIQAHPQLALVLSYQALA*********VTSYKEVW**********************************************SVLRDWYTHNP*************TGLTTTQVSNWFSSAN*TSSPNTSTSTASISPILPSFGF***********************FLWSLPACEKLHKNESVLKAKAMVAFHRGNFKDLYRILESHQFSPHNHPKLQALWL************************************************SVLRDWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNR*****************************
********KNFCNKGPSVYNVVDKGNCHCRMYRVPHDDRCCASEL**********CSTITHRTTKSLALPTSRLVPIQAHPQLALVLSYQALASHKSIFDKVVTSYKEVWKSPVKTYQSSSIIINIIKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYTHNPYPSPREKRELAEATGLTTTQVSNWFSSAN************SISPILPSFGFTQEQVACVCEVLQQSGNIERLGRFLWSLPACEKLHKNESVLKAKAMVAFHRGNFKDLYRILESHQFSPHNHPKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYTHNPYPSPREKRELAEATGLTTTQVSNWFKN**************VHSFRVNIGGDSKTQY
*NI*AENEKNFCNKGPSVYNVVDKGNCHCRMYRVPHDDRCCASELKSNQDRTCQQCSTITHRTTKSLALPTSRLVPIQAHPQLALVLSYQALASHKSIFDKVVTSYKEVWKSPVKTYQSSSIIINIIKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYTHNPYPSPREKRELAEATGLTTTQVSNWFSSANITS**************LPSFGFTQEQVACVCEVLQQSGNIERLGRFLWSLPACEKLHKNESVLKAKAMVAFHRGNFKDLYRILESHQFSPHNHPKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDR************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNIEAENEKNFCNKGPSVYNVVDKGNCHCRMYRVPHDDRCCASELKSNQDRTCQQCSTITHRTTKSLALPTSRLVPIQAHPQLALVLSYQALASHKSIFDKVVTSYKEVWKSPVKTYQSSSIIINIIKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYTHNPYPSPREKRELAEATGLTTTQVSNWFSSANITSSPNTSTSTASISPILPSFGFTQEQVACVCEVLQQSGNIERLGRFLWSLPACEKLHKNESVLKAKAMVAFHRGNFKDLYRILESHQFSPHNHPKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEQKDGSVHSFRVNIGGDSKTQY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query414 2.2.26 [Sep-21-2011]
Q62231284 Homeobox protein SIX1 OS= yes N/A 0.444 0.647 0.918 1e-101
A2D5H2284 Homeobox protein SIX1 OS= N/A N/A 0.444 0.647 0.918 1e-101
Q15475284 Homeobox protein SIX1 OS= yes N/A 0.444 0.647 0.918 1e-101
A1YER0284 Homeobox protein SIX1 OS= N/A N/A 0.444 0.647 0.918 1e-101
Q62232296 Homeobox protein SIX2 OS= no N/A 0.442 0.618 0.918 1e-100
Q27350 416 Protein sine oculis OS=Dr yes N/A 0.483 0.480 0.845 1e-100
Q9NPC8291 Homeobox protein SIX2 OS= no N/A 0.442 0.628 0.918 1e-100
Q61321 775 Homeobox protein SIX4 OS= no N/A 0.425 0.227 0.687 8e-72
Q9UIU6 781 Homeobox protein SIX4 OS= no N/A 0.420 0.222 0.689 1e-71
O42406314 Homeobox protein SIX3 OS= no N/A 0.413 0.544 0.68 7e-71
>sp|Q62231|SIX1_MOUSE Homeobox protein SIX1 OS=Mus musculus GN=Six1 PE=1 SV=2 Back     alignment and function desciption
 Score =  370 bits (949), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 169/184 (91%), Positives = 178/184 (96%)

Query: 213 ILPSFGFTQEQVACVCEVLQQSGNIERLGRFLWSLPACEKLHKNESVLKAKAMVAFHRGN 272
           +LPSFGFTQEQVACVCEVLQQ GN+ERLGRFLWSLPAC+ LHKNESVLKAKA+VAFHRGN
Sbjct: 3   MLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGN 62

Query: 273 FKDLYRILESHQFSPHNHPKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIW 332
           F++LY+ILESHQFSPHNHPKLQ LWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIW
Sbjct: 63  FRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIW 122

Query: 333 DGEETSYCFKEKSRSVLRDWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAA 392
           DGEETSYCFKEKSR VLR+WY HNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAA
Sbjct: 123 DGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAA 182

Query: 393 EQKD 396
           E K+
Sbjct: 183 EAKE 186
Transcription factor that is involved in regulation of organogenesis. Seems to be required for development of kidney, muscle and inner ear. Seems to be involved in later steps of myogenic differentiation. May be involved in limb tendon and ligament development. Binds a 5'-TCA[AG][AG]TTNC-3' motif present in the MEF3 element in the myogenin promoter. Thought to be regulated by association with Dach and Eya proteins. Acts as activator of the IGFBP5 promoter, probably coactivated by EYA2. Repression of precursor cell proliferation in myoblasts is switched to activation through recruitment of EYA3 phosphatase to the SIX1-DACH1 complex. During myogenesis, seems to act together with EYA2 and DACH2.
Mus musculus (taxid: 10090)
>sp|A2D5H2|SIX1_LAGLA Homeobox protein SIX1 OS=Lagothrix lagotricha GN=SIX1 PE=3 SV=1 Back     alignment and function description
>sp|Q15475|SIX1_HUMAN Homeobox protein SIX1 OS=Homo sapiens GN=SIX1 PE=1 SV=1 Back     alignment and function description
>sp|A1YER0|SIX1_GORGO Homeobox protein SIX1 OS=Gorilla gorilla gorilla GN=SIX1 PE=3 SV=1 Back     alignment and function description
>sp|Q62232|SIX2_MOUSE Homeobox protein SIX2 OS=Mus musculus GN=Six2 PE=1 SV=2 Back     alignment and function description
>sp|Q27350|SO_DROME Protein sine oculis OS=Drosophila melanogaster GN=so PE=2 SV=1 Back     alignment and function description
>sp|Q9NPC8|SIX2_HUMAN Homeobox protein SIX2 OS=Homo sapiens GN=SIX2 PE=2 SV=1 Back     alignment and function description
>sp|Q61321|SIX4_MOUSE Homeobox protein SIX4 OS=Mus musculus GN=Six4 PE=2 SV=1 Back     alignment and function description
>sp|Q9UIU6|SIX4_HUMAN Homeobox protein SIX4 OS=Homo sapiens GN=SIX4 PE=1 SV=2 Back     alignment and function description
>sp|O42406|SIX3_CHICK Homeobox protein SIX3 OS=Gallus gallus GN=SIX3 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query414
149737281 536 PREDICTED: homeobox protein SIX1-like [E 0.550 0.425 0.786 1e-102
328709554428 PREDICTED: hypothetical protein LOC10016 0.454 0.439 0.920 1e-102
410898072284 PREDICTED: homeobox protein SIX1-like [T 0.483 0.704 0.875 1e-101
47230132284 unnamed protein product [Tetraodon nigro 0.483 0.704 0.875 1e-101
432936891284 PREDICTED: homeobox protein SIX1-like [O 0.483 0.704 0.875 1e-101
348531170284 PREDICTED: homeobox protein SIX1-like [O 0.483 0.704 0.875 1e-101
390338697336 PREDICTED: homeobox protein SIX1 [Strong 0.471 0.580 0.870 1e-101
440910225357 Homeobox protein SIX1, partial [Bos grun 0.623 0.722 0.699 1e-101
119902749484 PREDICTED: homeobox protein SIX1 [Bos ta 0.497 0.425 0.839 1e-100
47218210288 unnamed protein product [Tetraodon nigro 0.444 0.638 0.918 1e-100
>gi|149737281|ref|XP_001492836.1| PREDICTED: homeobox protein SIX1-like [Equus caballus] Back     alignment and taxonomy information
 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 180/229 (78%), Positives = 193/229 (84%), Gaps = 1/229 (0%)

Query: 168 YPSPREKRELAEATGLTTTQVSNWFSSANITSSPNTSTSTASISPILPSFGFTQEQVACV 227
           Y  PRE    + A  L       +F SA     P ++   A    +LPSFGFTQEQVACV
Sbjct: 211 YGKPREGVRSSRAP-LPAAASPCFFGSAPCRVRPGSAPRQAPAMSMLPSFGFTQEQVACV 269

Query: 228 CEVLQQSGNIERLGRFLWSLPACEKLHKNESVLKAKAMVAFHRGNFKDLYRILESHQFSP 287
           CEVLQQ GN+ERLGRFLWSLPAC+ LHKNESVLKAKA+VAFHRGNF++LY+ILESHQFSP
Sbjct: 270 CEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSP 329

Query: 288 HNHPKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRS 347
           HNHPKLQ LWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSR 
Sbjct: 330 HNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRG 389

Query: 348 VLRDWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEQKD 396
           VLR+WY HNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAE K+
Sbjct: 390 VLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKE 438

Source: Equus caballus

Species: Equus caballus

Genus: Equus

Family: Equidae

Order: Perissodactyla

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|328709554|ref|XP_003243994.1| PREDICTED: hypothetical protein LOC100160072 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|410898072|ref|XP_003962522.1| PREDICTED: homeobox protein SIX1-like [Takifugu rubripes] Back     alignment and taxonomy information
>gi|47230132|emb|CAG10546.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
>gi|432936891|ref|XP_004082330.1| PREDICTED: homeobox protein SIX1-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|348531170|ref|XP_003453083.1| PREDICTED: homeobox protein SIX1-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|390338697|ref|XP_781551.3| PREDICTED: homeobox protein SIX1 [Strongylocentrotus purpuratus] gi|374534027|gb|AEZ53927.1| Six1 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|440910225|gb|ELR60042.1| Homeobox protein SIX1, partial [Bos grunniens mutus] Back     alignment and taxonomy information
>gi|119902749|ref|XP_588692.2| PREDICTED: homeobox protein SIX1 [Bos taurus] gi|359069682|ref|XP_002691065.2| PREDICTED: homeobox protein SIX1 [Bos taurus] Back     alignment and taxonomy information
>gi|47218210|emb|CAF97074.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query414
ZFIN|ZDB-GENE-040426-2308284 six1b "sine oculis homeobox ho 0.483 0.704 0.860 8.7e-95
ZFIN|ZDB-GENE-010412-1288 six2a "sine oculis-related hom 0.444 0.638 0.923 2.3e-94
UNIPROTKB|Q08DI4357 SIX1 "SIX1 protein" [Bos tauru 0.444 0.515 0.918 1e-93
UNIPROTKB|J9P3S7284 SIX1 "Uncharacterized protein" 0.444 0.647 0.918 1e-93
UNIPROTKB|Q15475284 SIX1 "Homeobox protein SIX1" [ 0.444 0.647 0.918 1e-93
UNIPROTKB|E5DCJ4284 Six1 "Uncharacterized protein" 0.444 0.647 0.918 1e-93
UNIPROTKB|A1YER0284 SIX1 "Homeobox protein SIX1" [ 0.444 0.647 0.918 1e-93
UNIPROTKB|A2D5H2284 SIX1 "Homeobox protein SIX1" [ 0.444 0.647 0.918 1e-93
UNIPROTKB|D2GVS4284 SIX1 "Uncharacterized protein" 0.444 0.647 0.918 1e-93
UNIPROTKB|D3U1G0284 D3U1G0 "Six1" [Ovis aries (tax 0.444 0.647 0.918 1e-93
ZFIN|ZDB-GENE-040426-2308 six1b "sine oculis homeobox homolog 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 943 (337.0 bits), Expect = 8.7e-95, P = 8.7e-95
 Identities = 173/201 (86%), Positives = 186/201 (92%)

Query:   213 ILPSFGFTQEQVACVCEVLQQSGNIERLGRFLWSLPACEKLHKNESVLKAKAMVAFHRGN 272
             +LPSFGFTQEQVACVCEVLQQ GN+ERLGRFLWSLPAC+ LHKNESVLKAKA+VAFHRGN
Sbjct:     3 MLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGN 62

Query:   273 FKDLYRILESHQFSPHNHPKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIW 332
             F++LY+ILESHQFSPHNHPKLQ LWLKAHY+EAEKLRGRPLGAVGKYRVRRKFPLPRTIW
Sbjct:    63 FRELYKILESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRTIW 122

Query:   333 DGEETSYCFKEKSRSVLRDWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAA 392
             DGEETSYCFKEKSR VLR+WYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAA
Sbjct:   123 DGEETSYCFKEKSRGVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAA 182

Query:   393 EQKDGSVHSFRVNIGGDSKTQ 413
             E K+   +S   N G + + Q
Sbjct:   183 EAKERE-NSENNNTGANKQNQ 202
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0021984 "adenohypophysis development" evidence=IGI
GO:0051146 "striated muscle cell differentiation" evidence=IMP
GO:0048839 "inner ear development" evidence=IMP
GO:0048935 "peripheral nervous system neuron development" evidence=IMP
GO:0002074 "extraocular skeletal muscle development" evidence=IMP
GO:0043282 "pharyngeal muscle development" evidence=IMP
ZFIN|ZDB-GENE-010412-1 six2a "sine oculis-related homeobox 2a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q08DI4 SIX1 "SIX1 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P3S7 SIX1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q15475 SIX1 "Homeobox protein SIX1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E5DCJ4 Six1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A1YER0 SIX1 "Homeobox protein SIX1" [Gorilla gorilla gorilla (taxid:9595)] Back     alignment and assigned GO terms
UNIPROTKB|A2D5H2 SIX1 "Homeobox protein SIX1" [Lagothrix lagotricha (taxid:9519)] Back     alignment and assigned GO terms
UNIPROTKB|D2GVS4 SIX1 "Uncharacterized protein" [Ailuropoda melanoleuca (taxid:9646)] Back     alignment and assigned GO terms
UNIPROTKB|D3U1G0 D3U1G0 "Six1" [Ovis aries (taxid:9940)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A1YER0SIX1_GORGONo assigned EC number0.91840.44440.6478N/AN/A
Q9NPC8SIX2_HUMANNo assigned EC number0.91800.44200.6288noN/A
Q27350SO_DROMENo assigned EC number0.8450.48300.4807yesN/A
Q94166HM33_CAEELNo assigned EC number0.64440.42510.6743yesN/A
Q15475SIX1_HUMANNo assigned EC number0.91840.44440.6478yesN/A
A2D5H2SIX1_LAGLANo assigned EC number0.91840.44440.6478N/AN/A
Q62232SIX2_MOUSENo assigned EC number0.91800.44200.6182noN/A
Q62231SIX1_MOUSENo assigned EC number0.91840.44440.6478yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query414
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 5e-15
smart0038957 smart00389, HOX, Homeodomain 7e-14
pfam0592040 pfam05920, Homeobox_KN, Homeobox KN domain 7e-12
pfam0592040 pfam05920, Homeobox_KN, Homeobox KN domain 1e-10
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 2e-10
pfam0004657 pfam00046, Homeobox, Homeobox domain 3e-10
smart0038957 smart00389, HOX, Homeodomain 3e-09
pfam0004657 pfam00046, Homeobox, Homeobox domain 2e-05
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 0.003
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information 
 Score = 68.8 bits (169), Expect = 5e-15
 Identities = 21/52 (40%), Positives = 28/52 (53%)

Query: 339 YCFKEKSRSVLRDWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDR 390
             F  +    L   +  NPYPS  E+ ELA+  GLT  QV  WF+NRR + +
Sbjct: 5   TRFTPEQLEELEKEFEKNPYPSREEREELAKELGLTERQVKIWFQNRRAKLK 56

Length = 59
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|203350 pfam05920, Homeobox_KN, Homeobox KN domain Back     alignment and domain information
>gnl|CDD|203350 pfam05920, Homeobox_KN, Homeobox KN domain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 414
KOG0775|consensus304 100.0
KOG0775|consensus304 100.0
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.35
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.34
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.33
KOG0843|consensus197 99.33
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.32
KOG0488|consensus309 99.31
KOG2251|consensus 228 99.31
KOG0489|consensus261 99.28
KOG0493|consensus342 99.28
KOG0850|consensus245 99.28
KOG0490|consensus235 99.27
KOG3802|consensus398 99.27
KOG0487|consensus308 99.23
KOG0484|consensus125 99.22
KOG0850|consensus245 99.21
KOG0842|consensus307 99.21
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.2
KOG0487|consensus308 99.2
KOG0492|consensus246 99.2
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 99.19
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.19
KOG0842|consensus307 99.19
KOG0485|consensus268 99.15
KOG0493|consensus342 99.12
KOG0848|consensus317 99.1
KOG0494|consensus 332 99.09
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.08
KOG4577|consensus 383 99.06
KOG0492|consensus246 99.06
KOG0489|consensus261 99.05
KOG0843|consensus197 99.05
KOG0491|consensus194 99.05
KOG0488|consensus309 98.98
KOG0774|consensus334 98.96
KOG0483|consensus198 98.95
KOG0483|consensus198 98.93
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 98.93
KOG0848|consensus317 98.91
COG5576156 Homeodomain-containing transcription factor [Trans 98.9
KOG0485|consensus268 98.9
KOG0844|consensus 408 98.87
KOG2251|consensus228 98.86
KOG0486|consensus 351 98.84
KOG0491|consensus194 98.79
COG5576156 Homeodomain-containing transcription factor [Trans 98.73
KOG3802|consensus398 98.71
KOG0847|consensus288 98.69
KOG0773|consensus342 98.57
KOG0484|consensus125 98.55
KOG0773|consensus342 98.52
KOG0774|consensus334 98.52
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.52
KOG0844|consensus408 98.42
KOG0494|consensus332 98.38
KOG0490|consensus235 98.38
KOG0486|consensus351 98.31
KOG0847|consensus288 98.24
KOG2252|consensus558 98.23
KOG0849|consensus354 98.18
KOG1168|consensus385 98.17
KOG4577|consensus383 97.96
KOG0849|consensus354 97.72
KOG2252|consensus558 97.62
KOG1168|consensus385 97.5
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 97.31
KOG1146|consensus 1406 97.27
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 96.59
KOG1146|consensus 1406 94.09
KOG3623|consensus 1007 90.32
KOG3623|consensus 1007 89.73
>KOG0775|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.3e-44  Score=340.15  Aligned_cols=200  Identities=79%  Similarity=1.301  Sum_probs=188.7

Q ss_pred             CCCCCCCCCCCccchhhhhhhhccCCchhhhhhhccCCCcccccccchhHHhHHHHHHhcccChHHHHHHHhcCCCCCCC
Q psy14872        210 ISPILPSFGFTQEQVACVCEVLQQSGNIERLGRFLWSLPACEKLHKNESVLKAKAMVAFHRGNFKDLYRILESHQFSPHN  289 (414)
Q Consensus       210 ~~~~~~~~~fSpeQ~a~i~eal~q~gd~e~l~~~l~slp~s~~l~~~e~v~ra~a~~~~~~~~~~~~~~ll~~~~f~~~~  289 (414)
                      .+...|+..|+++|++|+|++|++.||+|+|.+|+|++|+++.+..+|+|++|+++++||.++|.++++||+++.|++.+
T Consensus        52 s~~~~pt~~fS~eQvacvCe~L~q~Gd~erL~rFlwsLp~~~~~~~nEsvLkArA~vafH~gnf~eLY~iLE~h~Fs~~~  131 (304)
T KOG0775|consen   52 SMSALPTFGFSEEQVACVCESLQQGGDIERLGRFLWSLPVCEELLKNESVLKARAVVAFHSGNFRELYHILENHKFSPHN  131 (304)
T ss_pred             ccccCCCcCCCHHHHHHHHHHHHhccCHHHHHHHHHcCchHHHHhhhHHHHHHHHHHHHhcccHHHHHHHHHhccCChhh
Confidence            35777888999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chHHHHHHHHhhHHHHHhhcCCCCCCCCcCcccCCCCCCCcccCCCccccccCHHHHHHHHHHHhhCCCCCHHHHHHHHH
Q psy14872        290 HPKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYTHNPYPSPREKRELAE  369 (414)
Q Consensus       290 ~~~lq~~w~~~~~~~~e~~~g~~l~~~~~~r~R~~~p~P~~~~~~~~~~~~ft~~q~~~L~~~F~~n~yPs~~~r~~LA~  369 (414)
                      |+.||++|+.+||.++++.+|++||+|++||+|++.|.|+|||||+++.++|....+..|++||..++||++.++.+||+
T Consensus       132 h~~LQ~lWl~AhY~EAek~RGR~LgaV~KYRvRrKfPlPrTIWDGEet~yCFKekSR~~LrewY~~~~YPsp~eKReLA~  211 (304)
T KOG0775|consen  132 HPKLQALWLKAHYKEAEKLRGRPLGAVDKYRVRRKFPLPRTIWDGEETVYCFKEKSRSLLREWYLQNPYPSPREKRELAE  211 (304)
T ss_pred             hHHHHHHHHHHHHHHHHHhcCCcCCccccceeeccCCCCCccccCceeeeehhHhhHHHHHHHHhcCCCCChHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhCCCccccccccccchhHhHHHHhccCCCCcccccCCCC
Q psy14872        370 ATGLTTTQVSNWFKNRRQRDRAAEQKDGSVHSFRVNIGGD  409 (414)
Q Consensus       370 ~~gL~~~qV~vWFqNrR~R~Kr~~~~~~~~~~~~~s~gg~  409 (414)
                      .|||+..||.+||+|||+|+|-..++.......+.+.|.+
T Consensus       212 aTgLt~tQVsNWFKNRRQRDRa~~ak~~~~~~~~~s~~~~  251 (304)
T KOG0775|consen  212 ATGLTITQVSNWFKNRRQRDRAAAAKNSSNLSDSSSNGEE  251 (304)
T ss_pred             HhCCchhhhhhhhhhhhhhhhhccccccCCCccccccccc
Confidence            9999999999999999999997666666555544444433

>KOG0775|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query414
4egc_A559 Crystal Structure Of Mbp-fused Human Six1 Bound To 1e-102
1lfu_P82 Nmr Solution Stucture Of The Extended Pbx Homeodoma 1e-06
1b72_B87 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 2e-06
1puf_B73 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 4e-06
1b8i_B63 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 6e-06
3k2a_A67 Crystal Structure Of The Homeobox Domain Of Human H 8e-06
1du6_A64 Solution Structure Of The Truncated Pbx Homeodomain 8e-06
2lk2_A89 Solution Nmr Structure Of Homeobox Domain (171-248) 4e-05
2dmn_A83 The Solution Structure Of The Homeobox Domain Of Hu 7e-05
1x2n_A73 Solution Structure Of The Homeobox Domain Of Human 1e-04
>pdb|4EGC|A Chain A, Crystal Structure Of Mbp-fused Human Six1 Bound To Human Eya2 Eya Domain Length = 559 Back     alignment and structure 
Iteration: 1

 Score =  370 bits (949), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 169/184 (91%), Positives = 178/184 (96%)
Query: 213 ILPSFGFTQEQVACVCEVLQQSGNIERLGRFLWSLPACEKLHKNESVLKAKAMVAFHRGN 272
           +LPSFGFTQEQVACVCEVLQQ GN+ERLGRFLWSLPAC+ LHKNESVLKAKA+VAFHRGN
Sbjct: 373 MLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGN 432
Query: 273 FKDLYRILESHQFSPHNHPKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIW 332
           F++LY+ILESHQFSPHNHPKLQ LWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIW
Sbjct: 433 FRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIW 492
Query: 333 DGEETSYCFKEKSRSVLRDWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAA 392
           DGEETSYCFKEKSR VLR+WY HNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAA
Sbjct: 493 DGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAA 552
Query: 393 EQKD 396
           E K+
Sbjct: 553 EAKE 556
>pdb|1LFU|P Chain P, Nmr Solution Stucture Of The Extended Pbx Homeodomain Bound To Dna Length = 82 Back     alignment and structure
>pdb|1B72|B Chain B, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 87 Back     alignment and structure
>pdb|1PUF|B Chain B, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 73 Back     alignment and structure
>pdb|1B8I|B Chain B, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 63 Back     alignment and structure
>pdb|3K2A|A Chain A, Crystal Structure Of The Homeobox Domain Of Human Homeobox Protein Meis2 Length = 67 Back     alignment and structure
>pdb|1DU6|A Chain A, Solution Structure Of The Truncated Pbx Homeodomain Length = 64 Back     alignment and structure
>pdb|2LK2|A Chain A, Solution Nmr Structure Of Homeobox Domain (171-248) Of Human Homeobox Protein Tgif1, Northeast Structural Genomics Consortium Target Hr4411b Length = 89 Back     alignment and structure
>pdb|2DMN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Tgif2lx Length = 83 Back     alignment and structure
>pdb|1X2N|A Chain A, Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Pknox1 Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query414
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 6e-18
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 2e-14
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 7e-18
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 1e-14
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 2e-17
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 5e-14
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 2e-17
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 2e-14
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 5e-17
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 9e-14
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 8e-16
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 1e-13
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 3e-15
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 2e-09
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 3e-15
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 4e-13
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 3e-15
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 5e-13
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 4e-15
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 4e-13
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 1e-14
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 1e-12
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 1e-13
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 2e-08
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 8e-13
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 5e-08
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 1e-12
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 3e-08
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 1e-12
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 2e-05
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 3e-11
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 1e-06
2xsd_C164 POU domain, class 3, transcription factor 1; trans 1e-10
2xsd_C164 POU domain, class 3, transcription factor 1; trans 3e-04
1e3o_C160 Octamer-binding transcription factor 1; transcript 1e-09
1e3o_C160 Octamer-binding transcription factor 1; transcript 2e-04
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 1e-09
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 3e-06
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-09
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-04
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 1e-08
3d1n_I151 POU domain, class 6, transcription factor 1; prote 1e-08
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 2e-08
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 6e-06
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 5e-08
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 6e-08
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 2e-04
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 8e-08
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-08
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 2e-07
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 3e-07
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 4e-07
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 6e-07
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-06
2e19_A64 Transcription factor 8; homeobox domain, structura 1e-05
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 2e-05
3a01_A93 Homeodomain-containing protein; homeodomain, prote 2e-05
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 3e-05
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 4e-05
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 4e-05
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 4e-05
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 7e-05
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 8e-05
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 9e-05
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 1e-04
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 1e-04
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 2e-04
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 2e-04
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 2e-04
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 2e-04
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 3e-04
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 3e-04
1lfb_A99 Liver transcription factor (LFB1); transcription r 4e-04
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
 Score = 76.6 bits (189), Expect = 6e-18
 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 341 FKEKSRSVLRDWYT---HNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDR 390
           F +++  +L  W+     NPY   +    L + T L+  Q+ NW  NRR++++
Sbjct: 5   FTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 57
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Length = 87 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Length = 87 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Length = 73 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Length = 73 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} Length = 67 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} Length = 67 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query414
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.6
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.57
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.57
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.56
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.56
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.54
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.53
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.53
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.53
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.52
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.52
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.52
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.51
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.51
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.51
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.51
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.51
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.5
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.5
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.5
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.5
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.5
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.5
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.5
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.49
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.49
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.49
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.49
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.49
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.48
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.48
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.48
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.48
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.48
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.48
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.48
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.48
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.48
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.48
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.47
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.47
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.47
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.47
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.47
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.47
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.47
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.47
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.47
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.47
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.47
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.47
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.47
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.46
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.46
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.46
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.46
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.46
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.46
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.46
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.45
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.45
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.45
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.45
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.45
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.45
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.45
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.44
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.44
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.44
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.44
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.44
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.44
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.44
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.43
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.43
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.43
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.43
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.43
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.43
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.42
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.42
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.42
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.42
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.42
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.42
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.42
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.42
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.41
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.41
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.41
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.41
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.41
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.41
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.4
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.4
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.4
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.4
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.4
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.39
2e19_A64 Transcription factor 8; homeobox domain, structura 99.39
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.39
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.39
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.38
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.38
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.38
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.38
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.38
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.36
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.36
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.36
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.36
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.36
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.36
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.36
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.35
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.35
2e19_A64 Transcription factor 8; homeobox domain, structura 99.35
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.35
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.35
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.35
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.34
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.34
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.34
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.34
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.33
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.32
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.32
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.31
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.31
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.31
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.3
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.29
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.29
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.27
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.26
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.25
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.24
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.24
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.22
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.22
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.21
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.2
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.18
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.15
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.12
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.09
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.06
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.06
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 98.91
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 98.89
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 98.89
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 98.86
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 98.85
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 98.75
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 97.98
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 97.2
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 96.22
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 94.43
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
Probab=99.60  E-value=6.9e-16  Score=121.10  Aligned_cols=62  Identities=15%  Similarity=0.309  Sum_probs=56.0

Q ss_pred             cccccCHHHHHHHHHHHhhCCCCCHHHHHHHHHHhCCCccccccccccchhHhHHHHhccCC
Q psy14872        337 TSYCFKEKSRSVLRDWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEQKDGS  398 (414)
Q Consensus       337 ~~~~ft~~q~~~L~~~F~~n~yPs~~~r~~LA~~~gL~~~qV~vWFqNrR~R~Kr~~~~~~~  398 (414)
                      .+..||.+|+.+|+.+|..++||+..++++||..+||+..||++||||+|+|+|+..-+-..
T Consensus         6 ~r~kfT~~Ql~~Le~~F~~~~YPs~~er~~LA~~tgLte~qIkvWFqNrR~k~Kk~~l~w~~   67 (76)
T 2ecc_A            6 SGKRKTKEQLAILKSFFLQCQWARREDYQKLEQITGLPRPEIIQWFGDTRYALKHGQLKWFR   67 (76)
T ss_dssp             CCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHHHHHTCCSSTT
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCcCHHHhhHHhHhhHHHHHHHHHHHHH
Confidence            34579999999999999999999999999999999999999999999999999987544333
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 414
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 3e-14
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 3e-10
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 1e-13
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 9e-09
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 2e-13
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 8e-09
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 6e-12
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 3e-07
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 3e-11
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 2e-06
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 7e-11
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 2e-06
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 8e-10
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 4e-05
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 1e-09
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 1e-06
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 2e-09
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 4e-05
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 2e-09
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 1e-04
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 4e-09
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 3e-05
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 5e-09
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 3e-05
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 6e-09
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 2e-04
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 8e-09
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 2e-04
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 1e-08
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 2e-04
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 1e-08
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 3e-04
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 2e-08
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 3e-04
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 3e-08
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 0.001
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 5e-08
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 2e-04
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 6e-08
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 0.002
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 6e-08
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 0.003
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 2e-07
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 2e-07
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 2e-07
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 3e-07
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 4e-07
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 5e-07
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 2e-06
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 2e-06
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 4e-06
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 5e-06
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 5e-05
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein pknox1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 64.8 bits (158), Expect = 3e-14
 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 341 FKEKSRSVLRDWYT---HNPYPSPREKRELAEATGLTTTQVSNWFKNRRQR 388
             + + +V+R W      +PYP+  EK+++A  T LT  QV+NWF N R+R
Sbjct: 9   LPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRR 59
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query414
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.63
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.61
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.61
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.59
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.59
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.59
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.59
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.57
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.57
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.56
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.56
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.56
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.55
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.55
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.55
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.54
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.54
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.53
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.53
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.53
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.53
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.53
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.52
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.52
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.52
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.52
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.52
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.51
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.51
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.51
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.51
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.51
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.5
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.49
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.49
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.49
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.49
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.48
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.48
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.48
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.48
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.48
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.48
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.47
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.47
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.46
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.46
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.46
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.45
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.45
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.43
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.42
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.41
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.39
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.38
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.37
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.36
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.36
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.33
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.32
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.32
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.3
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.63  E-value=3.7e-17  Score=120.29  Aligned_cols=58  Identities=24%  Similarity=0.518  Sum_probs=54.2

Q ss_pred             CCccccccCHHHHHHHHHHHhhCCCCCHHHHHHHHHHhCCCccccccccccchhHhHH
Q psy14872        334 GEETSYCFKEKSRSVLRDWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRA  391 (414)
Q Consensus       334 ~~~~~~~ft~~q~~~L~~~F~~n~yPs~~~r~~LA~~~gL~~~qV~vWFqNrR~R~Kr  391 (414)
                      |++.++.||..|+.+|+..|..++||+.++++.||..+||++.+|++||||+|+|+||
T Consensus         1 Grr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~kk   58 (58)
T d2craa1           1 GRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK   58 (58)
T ss_dssp             CCCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhhhccC
Confidence            3455678999999999999999999999999999999999999999999999999874
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure