Psyllid ID: psy14885
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 483 | ||||||
| 328787872 | 1641 | PREDICTED: contactin-like [Apis mellifer | 0.409 | 0.120 | 0.515 | 2e-62 | |
| 380021534 | 1641 | PREDICTED: contactin-like [Apis florea] | 0.409 | 0.120 | 0.515 | 3e-62 | |
| 307183641 | 1156 | Contactin [Camponotus floridanus] | 0.426 | 0.178 | 0.504 | 6e-61 | |
| 322790658 | 252 | hypothetical protein SINV_13283 [Solenop | 0.391 | 0.75 | 0.529 | 6e-60 | |
| 332023779 | 1220 | Contactin [Acromyrmex echinatior] | 0.418 | 0.165 | 0.508 | 3e-59 | |
| 383850888 | 1650 | PREDICTED: contactin-like [Megachile rot | 0.416 | 0.121 | 0.493 | 3e-58 | |
| 340724306 | 1642 | PREDICTED: contactin-like [Bombus terres | 0.424 | 0.124 | 0.487 | 3e-57 | |
| 350420740 | 1813 | PREDICTED: contactin-like [Bombus impati | 0.424 | 0.113 | 0.482 | 6e-57 | |
| 242009529 | 1266 | Contactin precursor, putative [Pediculus | 0.376 | 0.143 | 0.509 | 2e-56 | |
| 307210402 | 1647 | Contactin [Harpegnathos saltator] | 0.422 | 0.123 | 0.473 | 2e-54 |
| >gi|328787872|ref|XP_003251020.1| PREDICTED: contactin-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
Score = 246 bits (627), Expect = 2e-62, Method: Compositional matrix adjust.
Identities = 116/225 (51%), Positives = 156/225 (69%), Gaps = 27/225 (12%)
Query: 8 LFIFVSFHSVFSQTI--DELELRCPQHWVQYRDSCYRFVKSPLKTRNDAKLNCKSLDSDL 65
++I++ ++ F+Q I +EL CPQHW+++++SCYRF+KSP+K R DAK NC++ SDL
Sbjct: 9 IYIYILSYNTFAQNILYEELYQHCPQHWIKFQESCYRFIKSPIKERQDAKRNCEAYQSDL 68
Query: 66 ANVNDADEHGFIMYQLFWQDPQRRKWYFGGTQQSPNLWVNEDDPQRRKWYFGGTQQSPNL 125
+N +EHGFI+YQL WQDPQ RK WY G Q+ N
Sbjct: 69 ITINSLEEHGFILYQLLWQDPQHRK-----------------------WYTGVKYQNGN- 104
Query: 126 WVNE-DGTNLNELDAAFLPEPADNVQRDYLAYSFSQSLKRWGFERVTGMEPLLFICEASI 184
W+NE D T L +D AFLPEP D+ +DYL YS++ +L+RWG E+VTG E LL+ICEA I
Sbjct: 105 WINEGDNTQLINMDNAFLPEPPDSFDKDYLIYSYNNNLQRWGLEKVTGKEKLLYICEAPI 164
Query: 185 QKLHYLLNDDRTYQYGMDIENPDKIPRGPYFIKQPTDVVFDLSKR 229
L+ L++DDRTYQYG++I+NP++IPRGPYFIKQPTD VFD+S R
Sbjct: 165 SNLYNLIDDDRTYQYGIEIDNPNEIPRGPYFIKQPTDKVFDMSTR 209
|
Source: Apis mellifera Species: Apis mellifera Genus: Apis Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|380021534|ref|XP_003694618.1| PREDICTED: contactin-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|307183641|gb|EFN70344.1| Contactin [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|322790658|gb|EFZ15442.1| hypothetical protein SINV_13283 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|332023779|gb|EGI64003.1| Contactin [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|383850888|ref|XP_003701006.1| PREDICTED: contactin-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340724306|ref|XP_003400523.1| PREDICTED: contactin-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350420740|ref|XP_003492608.1| PREDICTED: contactin-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|242009529|ref|XP_002425536.1| Contactin precursor, putative [Pediculus humanus corporis] gi|212509411|gb|EEB12798.1| Contactin precursor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|307210402|gb|EFN86967.1| Contactin [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 483 | ||||||
| FB|FBgn0037240 | 1390 | Cont "Contactin" [Drosophila m | 0.169 | 0.058 | 0.390 | 4.9e-28 | |
| ZFIN|ZDB-GENE-070912-39 | 151 | si:ch211-125e6.5 "si:ch211-125 | 0.223 | 0.715 | 0.275 | 4.5e-06 | |
| ZFIN|ZDB-GENE-070912-38 | 149 | si:ch211-125e6.14 "si:ch211-12 | 0.223 | 0.724 | 0.285 | 1.5e-05 | |
| UNIPROTKB|D4A3W3 | 219 | Cd302 "CD302 antigen" [Rattus | 0.200 | 0.442 | 0.275 | 4.1e-05 | |
| RGD|1307606 | 228 | Cd302 "CD302 molecule" [Rattus | 0.200 | 0.425 | 0.275 | 4.8e-05 | |
| UNIPROTKB|Q5FVR3 | 228 | Cd302 "CD302 antigen" [Rattus | 0.200 | 0.425 | 0.275 | 4.8e-05 | |
| UNIPROTKB|H0YGB2 | 138 | CLEC4C "C-type lectin domain f | 0.192 | 0.673 | 0.270 | 8.8e-05 | |
| UNIPROTKB|H0YH49 | 140 | CLEC2D "C-type lectin domain f | 0.194 | 0.671 | 0.281 | 8.8e-05 | |
| UNIPROTKB|F1PPJ0 | 226 | CLEC4E "Uncharacterized protei | 0.246 | 0.526 | 0.255 | 0.00014 | |
| ZFIN|ZDB-GENE-080220-41 | 96 | zgc:171818 "zgc:171818" [Danio | 0.151 | 0.760 | 0.341 | 0.00014 |
| FB|FBgn0037240 Cont "Contactin" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 203 (76.5 bits), Expect = 4.9e-28, Sum P(2) = 4.9e-28
Identities = 32/82 (39%), Positives = 55/82 (67%)
Query: 29 CPQHWVQYRDSCYRFVKSPLKTRNDAKLNCKSLDSDLANVNDADEHGFIMYQLFWQDPQR 88
CP+HWV +R +CYRF++SP + +AK CK+ ++DL NV++ ++H FI+ L Q+ ++
Sbjct: 139 CPEHWVSFRQTCYRFIRSPKRNWAEAKKICKAHNADLINVDNVEKHSFILKNLILQNQRQ 198
Query: 89 RKWYFGGTQQSPNLWVNEDDPQ 110
+++ Q P WVN+D+ Q
Sbjct: 199 NRFFISARQTGPLNWVNDDNTQ 220
|
|
| ZFIN|ZDB-GENE-070912-39 si:ch211-125e6.5 "si:ch211-125e6.5" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070912-38 si:ch211-125e6.14 "si:ch211-125e6.14" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A3W3 Cd302 "CD302 antigen" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|1307606 Cd302 "CD302 molecule" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5FVR3 Cd302 "CD302 antigen" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YGB2 CLEC4C "C-type lectin domain family 4 member C" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YH49 CLEC2D "C-type lectin domain family 2 member D" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PPJ0 CLEC4E "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-080220-41 zgc:171818 "zgc:171818" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 483 | |||
| cd09276 | 128 | cd09276, Rnase_HI_RT_non_LTR, non-LTR RNase HI dom | 2e-29 | |
| pfam00075 | 126 | pfam00075, RNase_H, RNase H | 1e-13 | |
| cd06222 | 123 | cd06222, RNase_H, RNase H is an endonuclease that | 3e-13 | |
| smart00034 | 124 | smart00034, CLECT, C-type lectin (CTL) or carbohyd | 3e-10 | |
| cd03593 | 116 | cd03593, CLECT_NK_receptors_like, C-type lectin-li | 9e-09 | |
| cd03590 | 126 | cd03590, CLECT_DC-SIGN_like, C-type lectin-like do | 1e-07 | |
| cd00037 | 116 | cd00037, CLECT, C-type lectin (CTL)/C-type lectin- | 2e-06 | |
| cd09277 | 133 | cd09277, RNase_HI_bacteria_HBD, Bacterial RNase HI | 2e-06 | |
| cd09280 | 150 | cd09280, RNase_HI_eukaryote_like, Eukaryotic RNase | 3e-06 | |
| pfam05473 | 191 | pfam05473, Herpes_UL45, UL45 protein | 7e-05 | |
| cd03589 | 137 | cd03589, CLECT_CEL-1_like, C-type lectin-like doma | 2e-04 | |
| COG0328 | 154 | COG0328, RnhA, Ribonuclease HI [DNA replication, r | 3e-04 | |
| pfam13456 | 88 | pfam13456, RVT_3, Reverse transcriptase-like | 4e-04 | |
| cd09279 | 128 | cd09279, RNase_HI_archaeal_like, RNAse HI family t | 0.001 | |
| cd03594 | 129 | cd03594, CLECT_REG-1_like, C-type lectin-like doma | 0.001 | |
| PHA03097 | 157 | PHA03097, PHA03097, C-type lectin-like protein; Pr | 0.002 | |
| cd09278 | 139 | cd09278, RNase_HI_prokaryote_like, RNase HI family | 0.004 |
| >gnl|CDD|187700 cd09276, Rnase_HI_RT_non_LTR, non-LTR RNase HI domain of reverse transcriptases | Back alignment and domain information |
|---|
Score = 111 bits (280), Expect = 2e-29
Identities = 35/124 (28%), Positives = 63/124 (50%), Gaps = 6/124 (4%)
Query: 222 VVF-DLSKRNSNTGFAFII---NNENFQYRLPHEASIFTAEAIAIFYCIKKISDMK--IK 275
V++ D SK TG F I + Y+L S+F AE +AI ++ +
Sbjct: 1 VIYTDGSKLEGRTGAGFAIVRKGTISRSYKLGPYCSVFDAELLAILEALQLALREGRRAR 60
Query: 276 KAIIFSDNKSVLNGIDNIQQRNNIIQLIKQEYYFASTNGSQISFMWIPSHSNIALNDKAD 335
K IFSD+++ L + + + + ++ I++ + +G ++ W+P HS I N++AD
Sbjct: 61 KITIFSDSQAALKALRSPRSSSPLVLRIRKAIRELANHGVKVRLHWVPGHSGIEGNERAD 120
Query: 336 QLAK 339
+LAK
Sbjct: 121 RLAK 124
|
Ribonuclease H (RNase H) is classified into two families, type 1 (prokaryotic RNase HI, eukaryotic RNase H1 and viral RNase H) and type 2 (prokaryotic RNase HII and HIII, and eukaryotic RNase H2). Ribonuclease HI (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner. RNase H is widely present in various organisms, including bacteria, archaea and eukaryotes. RNase HI has also been observed as an adjunct domain to the reverse transcriptase gene in retroviruses, long-term repeat (LTR)-bearing retrotransposons and non-LTR retrotransposons. RNase HI in LTR retrotransposons perform degradation of the original RNA template, generation of a polypurine tract (the primer for plus-strand DNA synthesis), and final removal of RNA primers from newly synthesized minus and plus strands. The catalytic residues for RNase H enzymatic activity, three aspartatic acids and one glutamatic acid residue (DEDD), are unvaried across all RNase H domains. The position of the RNase domain of non-LTR and LTR transposons is at the carboxyl terminal of the reverse transcriptase (RT) domain and their RNase domains group together, indicating a common evolutionary origin. Many non-LTR transposons have lost the RNase domain because their activity is at the nucleus and cellular RNase may suffice; however LTR retotransposons always encode their own RNase domain because it requires RNase activity in RNA-protein particles in the cytoplasm. RNase H inhibitors have been explored as an anti-HIV drug target because RNase H inactivation inhibits reverse transcription. Length = 128 |
| >gnl|CDD|215695 pfam00075, RNase_H, RNase H | Back alignment and domain information |
|---|
| >gnl|CDD|187690 cd06222, RNase_H, RNase H is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner | Back alignment and domain information |
|---|
| >gnl|CDD|214480 smart00034, CLECT, C-type lectin (CTL) or carbohydrate-recognition domain (CRD) | Back alignment and domain information |
|---|
| >gnl|CDD|153063 cd03593, CLECT_NK_receptors_like, C-type lectin-like domain (CTLD) of the type found in natural killer cell receptors (NKRs) | Back alignment and domain information |
|---|
| >gnl|CDD|153060 cd03590, CLECT_DC-SIGN_like, C-type lectin-like domain (CTLD) of the type found in human dendritic cell (DC)-specific intercellular adhesion molecule 3-grabbing non-integrin (DC-SIGN) and the related receptor, DC-SIGN receptor (DC-SIGNR) | Back alignment and domain information |
|---|
| >gnl|CDD|153057 cd00037, CLECT, C-type lectin (CTL)/C-type lectin-like (CTLD) domain | Back alignment and domain information |
|---|
| >gnl|CDD|187701 cd09277, RNase_HI_bacteria_HBD, Bacterial RNase HI containing a hybrid binding domain (HBD) at the N-terminus | Back alignment and domain information |
|---|
| >gnl|CDD|187704 cd09280, RNase_HI_eukaryote_like, Eukaryotic RNase H is longer and more complex than their prokaryotic counterparts and unlike prokaryote, RNase H are essential in higher eukaryote | Back alignment and domain information |
|---|
| >gnl|CDD|218599 pfam05473, Herpes_UL45, UL45 protein | Back alignment and domain information |
|---|
| >gnl|CDD|153059 cd03589, CLECT_CEL-1_like, C-type lectin-like domain (CTLD) of the type found in CEL-1 from Cucumaria echinata and Echinoidin from Anthocidaris crassispina | Back alignment and domain information |
|---|
| >gnl|CDD|223405 COG0328, RnhA, Ribonuclease HI [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|205634 pfam13456, RVT_3, Reverse transcriptase-like | Back alignment and domain information |
|---|
| >gnl|CDD|187703 cd09279, RNase_HI_archaeal_like, RNAse HI family that includes Archaeal RNase HI | Back alignment and domain information |
|---|
| >gnl|CDD|153064 cd03594, CLECT_REG-1_like, C-type lectin-like domain (CTLD) of the type found in Human REG-1 (lithostathine), REG-4, and avian eggshell-specific proteins: ansocalcin, structhiocalcin-1(SCA-1), and -2(SCA-2) | Back alignment and domain information |
|---|
| >gnl|CDD|222982 PHA03097, PHA03097, C-type lectin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187702 cd09278, RNase_HI_prokaryote_like, RNase HI family found mainly in prokaryotes | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 483 | |||
| cd03588 | 124 | CLECT_CSPGs C-type lectin-like domain (CTLD) of th | 99.91 | |
| cd03589 | 137 | CLECT_CEL-1_like C-type lectin-like domain (CTLD) | 99.91 | |
| cd03597 | 129 | CLECT_attractin_like C-type lectin-like domain (CT | 99.91 | |
| cd03594 | 129 | CLECT_REG-1_like C-type lectin-like domain (CTLD) | 99.91 | |
| cd03599 | 153 | CLECT_DGCR2_like C-type lectin-like domain (CTLD) | 99.91 | |
| cd03590 | 126 | CLECT_DC-SIGN_like C-type lectin-like domain (CTLD | 99.9 | |
| cd03596 | 129 | CLECT_tetranectin_like C-type lectin-like domain ( | 99.89 | |
| COG0328 | 154 | RnhA Ribonuclease HI [DNA replication, recombinati | 99.89 | |
| cd03593 | 116 | CLECT_NK_receptors_like C-type lectin-like domain | 99.88 | |
| PRK06548 | 161 | ribonuclease H; Provisional | 99.88 | |
| PHA02642 | 216 | C-type lectin-like protein; Provisional | 99.87 | |
| PRK08719 | 147 | ribonuclease H; Reviewed | 99.85 | |
| cd03598 | 117 | CLECT_EMBP_like C-type lectin-like domain (CTLD) o | 99.85 | |
| PHA02953 | 170 | IEV and EEV membrane glycoprotein; Provisional | 99.85 | |
| PHA03097 | 157 | C-type lectin-like protein; Provisional | 99.84 | |
| PRK00203 | 150 | rnhA ribonuclease H; Reviewed | 99.84 | |
| cd03591 | 114 | CLECT_collectin_like C-type lectin-like domain (CT | 99.84 | |
| smart00034 | 126 | CLECT C-type lectin (CTL) or carbohydrate-recognit | 99.84 | |
| PF00075 | 132 | RNase_H: RNase H; InterPro: IPR002156 The RNase H | 99.83 | |
| cd03592 | 115 | CLECT_selectins_like C-type lectin-like domain (CT | 99.83 | |
| cd03601 | 119 | CLECT_TC14_like C-type lectin-like domain (CTLD) o | 99.82 | |
| TIGR00864 | 2740 | PCC polycystin cation channel protein. Note: this | 99.8 | |
| cd03603 | 118 | CLECT_VCBS A bacterial subgroup of the C-type lect | 99.8 | |
| cd03595 | 149 | CLECT_chondrolectin_like C-type lectin-like domain | 99.8 | |
| cd03600 | 141 | CLECT_thrombomodulin_like C-type lectin-like domai | 99.79 | |
| cd03602 | 108 | CLECT_1 C-type lectin (CTL)/C-type lectin-like (CT | 99.78 | |
| PHA02867 | 167 | C-type lectin protein; Provisional | 99.75 | |
| PRK13907 | 128 | rnhA ribonuclease H; Provisional | 99.73 | |
| cd06222 | 130 | RnaseH RNase H (RNase HI) is an endonuclease that | 99.73 | |
| KOG3752|consensus | 371 | 99.68 | ||
| cd00037 | 116 | CLECT C-type lectin (CTL)/C-type lectin-like (CTLD | 99.61 | |
| PRK07708 | 219 | hypothetical protein; Validated | 99.6 | |
| PF00059 | 105 | Lectin_C: Lectin C-type domain; InterPro: IPR00130 | 99.52 | |
| PRK07238 | 372 | bifunctional RNase H/acid phosphatase; Provisional | 99.5 | |
| PHA02911 | 213 | C-type lectin-like protein; Provisional | 99.38 | |
| PF13456 | 87 | RVT_3: Reverse transcriptase-like; PDB: 3ALY_A 2EH | 99.29 | |
| PF05473 | 200 | Herpes_UL45: UL45 protein; InterPro: IPR008646 Thi | 98.91 | |
| PHA02672 | 166 | ORF110 EEV glycoprotein; Provisional | 97.56 | |
| PHA03093 | 185 | EEV glycoprotein; Provisional | 96.91 | |
| PHA02673 | 161 | ORF109 EEV glycoprotein; Provisional | 96.86 | |
| PF05966 | 190 | Chordopox_A33R: Chordopoxvirus A33R protein; Inter | 95.82 | |
| PF13966 | 86 | zf-RVT: zinc-binding in reverse transcriptase | 94.01 | |
| cd03519 | 91 | Link_domain_HAPLN_module_2 Link_domain_HAPLN_modul | 86.1 |
| >cd03588 CLECT_CSPGs C-type lectin-like domain (CTLD) of the type found in chondroitin sulfate proteoglycan core proteins | Back alignment and domain information |
|---|
Probab=99.91 E-value=1.5e-24 Score=185.84 Aligned_cols=121 Identities=19% Similarity=0.422 Sum_probs=101.4
Q ss_pred CcccccccCCeEEEEecCCCCCHHHHHHHhhhcCCcccccCCHhHHHHHHHHhhhcCCCCCceeeecccCCCCcccccCc
Q psy14885 29 CPQHWVQYRDSCYRFVKSPLKTRNDAKLNCKSLDSDLANVNDADEHGFIMYQLFWQDPQRRKWYFGGTQQSPNLWVNEDD 108 (483)
Q Consensus 29 C~~gw~~~~~~Cy~~~~~~~~tw~~A~~~C~~~g~~L~~i~s~~e~~~l~~~~~~~~~~~~~~wig~~~~~~~~Wig~~~ 108 (483)
||+||+.|++.||+++..+ ++|.+|+..|+.+||+||+|+|++|++||..++. ..+|||+++.
T Consensus 1 Cp~gw~~~~~~Cy~~~~~~-~sw~~A~~~C~~~gg~La~i~s~~e~~fl~~~~~------~~~WIGl~~~---------- 63 (124)
T cd03588 1 CEEGWDKFQGHCYRHFPDR-ETWEDAERRCREQQGHLSSIVTPEEQEFVNNNAQ------DYQWIGLNDR---------- 63 (124)
T ss_pred CCccceecCCEEEEEECCc-cCHHHHHHHHHhcCCEEeccCCHHHHHHHHHhcc------CcEEecceec----------
Confidence 9999999999999999995 9999999999999999999999999999988642 2345555432
Q ss_pred ccccccccCCcCCCCCccccCCCCccccccccCCC-CCCCc--ccCCeEEEecccccccccccccCCCCceeeeeecc
Q psy14885 109 PQRRKWYFGGTQQSPNLWVNEDGTNLNELDAAFLP-EPADN--VQRDYLAYSFSQSLKRWGFERVTGMEPLLFICEAS 183 (483)
Q Consensus 109 ~~~~~w~~~g~~~~~~~~~W~dg~~~~~~~~~w~~-~P~~~--~~~~Cv~~~~~~~~~~W~~~~C~~~~~~~fvCe~~ 183 (483)
...+.|.|+||+++.+ .+|.+ +|++. ..++||++..... +.|.+.+|. ..++|||||.
T Consensus 64 ------------~~~~~~~W~dg~~~~~--~~W~~~~p~~~~~~~~~Cv~~~~~~~-~~W~d~~C~--~~~~fICe~~ 124 (124)
T cd03588 64 ------------TIEGDFRWSDGHPLQF--ENWRPNQPDNFFATGEDCVVMIWHEE-GEWNDVPCN--YHLPFTCKKG 124 (124)
T ss_pred ------------CCCCceEeCCCCcccc--cCcCCCCCCCCCCCCCCeEEEecCCC-CeEcCCCCC--CCCeeeeeCC
Confidence 2467899999999875 78999 99874 3579999864322 469999999 9999999974
|
CLECT_CSPGs: C-type lectin-like domain (CTLD) of the type found in chondroitin sulfate proteoglycan core proteins (CSPGs) in human and chicken aggrecan, frog brevican, and zebra fish dermacan. CTLD refers to a domain homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Xenopus brevican is expressed in the notochord and the brain during early embryogenesis. Zebra fish dermacan is expressed in dermal bones and may play a role in dermal bone development. CSPGs do contain LINK domain(s) which bind HA. These LINK domains are considered by one classif |
| >cd03589 CLECT_CEL-1_like C-type lectin-like domain (CTLD) of the type found in CEL-1 from Cucumaria echinata and Echinoidin from Anthocidaris crassispina | Back alignment and domain information |
|---|
| >cd03597 CLECT_attractin_like C-type lectin-like domain (CTLD) of the type found in human and mouse attractin (AtrN) and attractin-like protein (ALP) | Back alignment and domain information |
|---|
| >cd03594 CLECT_REG-1_like C-type lectin-like domain (CTLD) of the type found in Human REG-1 (lithostathine), REG-4, and avian eggshell-specific proteins: ansocalcin, structhiocalcin-1(SCA-1), and -2(SCA-2) | Back alignment and domain information |
|---|
| >cd03599 CLECT_DGCR2_like C-type lectin-like domain (CTLD) of the type found in DGCR2, an integral membrane protein deleted in DiGeorge Syndrome (DGS) | Back alignment and domain information |
|---|
| >cd03590 CLECT_DC-SIGN_like C-type lectin-like domain (CTLD) of the type found in human dendritic cell (DC)-specific intercellular adhesion molecule 3-grabbing non-integrin (DC-SIGN) and the related receptor, DC-SIGN receptor (DC-SIGNR) | Back alignment and domain information |
|---|
| >cd03596 CLECT_tetranectin_like C-type lectin-like domain (CTLD) of the type found in the tetranectin (TN), cartilage derived C-type lectin (CLECSF1), and stem cell growth factor (SCGF) | Back alignment and domain information |
|---|
| >COG0328 RnhA Ribonuclease HI [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd03593 CLECT_NK_receptors_like C-type lectin-like domain (CTLD) of the type found in natural killer cell receptors (NKRs) | Back alignment and domain information |
|---|
| >PRK06548 ribonuclease H; Provisional | Back alignment and domain information |
|---|
| >PHA02642 C-type lectin-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK08719 ribonuclease H; Reviewed | Back alignment and domain information |
|---|
| >cd03598 CLECT_EMBP_like C-type lectin-like domain (CTLD) of the type found in the human proteins, eosinophil major basic protein (EMBP) and prepro major basic protein homolog (MBPH) | Back alignment and domain information |
|---|
| >PHA02953 IEV and EEV membrane glycoprotein; Provisional | Back alignment and domain information |
|---|
| >PHA03097 C-type lectin-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK00203 rnhA ribonuclease H; Reviewed | Back alignment and domain information |
|---|
| >cd03591 CLECT_collectin_like C-type lectin-like domain (CTLD) of the type found in human collectins including lung surfactant proteins A and D, mannose- or mannan binding lectin (MBL), and CL-L1 (collectin liver 1) | Back alignment and domain information |
|---|
| >smart00034 CLECT C-type lectin (CTL) or carbohydrate-recognition domain (CRD) | Back alignment and domain information |
|---|
| >PF00075 RNase_H: RNase H; InterPro: IPR002156 The RNase H domain is responsible for hydrolysis of the RNA portion of RNA x DNA hybrids, and this activity requires the presence of divalent cations (Mg2+ or Mn2+) that bind its active site | Back alignment and domain information |
|---|
| >cd03592 CLECT_selectins_like C-type lectin-like domain (CTLD) of the type found in the type 1 transmembrane proteins: P(platlet)-, E(endothelial)-, and L(leukocyte)- selectins (sels) | Back alignment and domain information |
|---|
| >cd03601 CLECT_TC14_like C-type lectin-like domain (CTLD) of the type found in lectins TC14, TC14-2, TC14-3, and TC14-4 from the budding tunicate Polyandrocarpa misakiensis and PfG6 from the Acorn worm | Back alignment and domain information |
|---|
| >TIGR00864 PCC polycystin cation channel protein | Back alignment and domain information |
|---|
| >cd03603 CLECT_VCBS A bacterial subgroup of the C-type lectin-like (CTLD) domain; a subgroup of bacterial protein domains homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins | Back alignment and domain information |
|---|
| >cd03595 CLECT_chondrolectin_like C-type lectin-like domain (CTLD) of the type found in the human type-1A transmembrane proteins chondrolectin (CHODL) and layilin | Back alignment and domain information |
|---|
| >cd03600 CLECT_thrombomodulin_like C-type lectin-like domain (CTLD) of the type found in human thrombomodulin(TM), Endosialin, C14orf27, and C1qR | Back alignment and domain information |
|---|
| >cd03602 CLECT_1 C-type lectin (CTL)/C-type lectin-like (CTLD) domain subgroup 1; a subgroup of protein domains homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins | Back alignment and domain information |
|---|
| >PHA02867 C-type lectin protein; Provisional | Back alignment and domain information |
|---|
| >PRK13907 rnhA ribonuclease H; Provisional | Back alignment and domain information |
|---|
| >cd06222 RnaseH RNase H (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a not sequence-specific manner | Back alignment and domain information |
|---|
| >KOG3752|consensus | Back alignment and domain information |
|---|
| >cd00037 CLECT C-type lectin (CTL)/C-type lectin-like (CTLD) domain | Back alignment and domain information |
|---|
| >PRK07708 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF00059 Lectin_C: Lectin C-type domain; InterPro: IPR001304 Lectins occur in plants, animals, bacteria and viruses | Back alignment and domain information |
|---|
| >PRK07238 bifunctional RNase H/acid phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02911 C-type lectin-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13456 RVT_3: Reverse transcriptase-like; PDB: 3ALY_A 2EHG_A 3HST_B | Back alignment and domain information |
|---|
| >PF05473 Herpes_UL45: UL45 protein; InterPro: IPR008646 This family consists several UL45 proteins and homologues found in the herpes simplex virus family | Back alignment and domain information |
|---|
| >PHA02672 ORF110 EEV glycoprotein; Provisional | Back alignment and domain information |
|---|
| >PHA03093 EEV glycoprotein; Provisional | Back alignment and domain information |
|---|
| >PHA02673 ORF109 EEV glycoprotein; Provisional | Back alignment and domain information |
|---|
| >PF05966 Chordopox_A33R: Chordopoxvirus A33R protein; InterPro: IPR009238 This family consists of several Chordopoxvirus A33R proteins | Back alignment and domain information |
|---|
| >PF13966 zf-RVT: zinc-binding in reverse transcriptase | Back alignment and domain information |
|---|
| >cd03519 Link_domain_HAPLN_module_2 Link_domain_HAPLN_module_2; this link domain is found in the second link module of proteins similar to the vertebrate HAPLN (hyaluronan/HA and proteoglycan binding link) protein family which includes cartilage link protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 483 | |||
| 2bpd_A | 142 | Dectin-1; receptor, beta-glucan, fungal recognitio | 2e-14 | |
| 3vpp_A | 132 | C-type lectin domain family 9 member A; dendritic | 7e-14 | |
| 2xr6_A | 170 | CD209 antigen; sugar binding protein, carbohydrate | 5e-13 | |
| 1ypq_A | 135 | Oxidised low density lipoprotein (lectin-like) rec | 7e-13 | |
| 2b6b_D | 175 | CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahe | 1e-12 | |
| 2vuv_A | 129 | Codakine; sugar-binding protein, C-type, lectin, m | 2e-12 | |
| 1sl6_A | 184 | C-type lectin DC-signr; sugar binding protein; HET | 2e-12 | |
| 2c6u_A | 122 | CLEC1B protein; lectin, rhodocytin, aggretin, C-ty | 3e-12 | |
| 2ls8_A | 156 | C-type lectin domain family 4 member D; structural | 3e-12 | |
| 2zib_A | 133 | Type II antifreeze protein; thermal hysteresis, le | 4e-12 | |
| 1tdq_B | 130 | Aggrecan core protein; extracellular matrix, lecti | 6e-12 | |
| 2py2_A | 136 | Antifreeze protein type II; type II antifreeze pro | 8e-12 | |
| 3bdw_A | 123 | Natural killer cells antigen CD94; NK cells, recep | 8e-12 | |
| 1hq8_A | 123 | NKG2-D; homodimer, CIS-proline, apoptosis; 1.95A { | 1e-11 | |
| 3ff7_C | 112 | Killer cell lectin-like receptor subfamily G membe | 1e-11 | |
| 2afp_A | 129 | Protein (SEA raven type II antifreeze protein); re | 1e-11 | |
| 3ff9_A | 115 | Killer cell lectin-like receptor subfamily G membe | 1e-11 | |
| 3hup_A | 130 | Early activation antigen CD69; C-type lectin-like | 2e-11 | |
| 1fm5_A | 199 | Early activation antigen CD69; C-type lectin-like | 2e-11 | |
| 2ox9_A | 140 | Collectin placenta 1; C-type lectin, sugar binding | 2e-11 | |
| 1mpu_A | 138 | NKG2-D type II integral membrane protein; C-type l | 2e-11 | |
| 3g8k_A | 130 | Lectin-related NK cell receptor LY49L1; natural ki | 2e-11 | |
| 3bdw_B | 120 | NKG2-A/NKG2-B type II integral membrane protein; N | 3e-11 | |
| 2yhf_A | 118 | C-type lectin domain family 5 member A; immune sys | 3e-11 | |
| 3m9z_A | 139 | Killer cell lectin-like receptor subfamily B MEMB; | 3e-11 | |
| 1qdd_A | 144 | Lithostathine; pancreatic stone inhibitor, metal b | 4e-11 | |
| 3rs1_A | 122 | C-type lectin domain family 2 member I; C-type lec | 4e-11 | |
| 1dv8_A | 128 | Asialoglycoprotein receptor 1; C-type lectin CRD, | 7e-11 | |
| 3c22_A | 156 | C-type lectin domain family 4 member K; coiled coi | 1e-10 | |
| 2h2t_B | 175 | Low affinity immunoglobulin epsilon FC receptor ( | 1e-10 | |
| 1htn_A | 182 | Tetranectin; plasminogen binding, kringle 4, alpha | 1e-10 | |
| 1fvu_B | 125 | Botrocetin beta chain; VON WILLBRAND factor modula | 2e-10 | |
| 1tn3_A | 137 | Tetranectin; plasminogen binding, kringle 4, C-typ | 2e-10 | |
| 3ubu_A | 131 | Agglucetin subunit alpha-1; platelet inhibiting, a | 2e-10 | |
| 1jwi_A | 131 | Bitiscetin; domain swapping, C-type lectin, toxin; | 2e-10 | |
| 3kqg_A | 182 | Langerin, C-type lectin domain family 4 member K; | 3e-10 | |
| 2e3x_C | 122 | Coagulation factor X-activating enzyme light CHAI; | 3e-10 | |
| 1pwb_A | 177 | SP-D, PSP-D, pulmonary surfactant-associated prote | 3e-10 | |
| 1egg_A | 147 | Macrophage mannose receptor; C-type lectin, sugar | 4e-10 | |
| 1jwi_B | 125 | Platelet aggregation inducer; domain swapping, C-t | 4e-10 | |
| 3bx4_B | 146 | Aggretin beta chain; toxin; 1.70A {Agkistrodon rho | 4e-10 | |
| 1wmz_A | 140 | Lectin CEL-I, N-acetyl-D-galactosamine-specific C- | 4e-10 | |
| 2kv3_A | 131 | Regenerating islet-derived protein 4; GISP, C-type | 5e-10 | |
| 3ubu_B | 126 | Agglucetin subunit beta-2; platelet inhibiting, ag | 8e-10 | |
| 3c8j_A | 203 | Natural killer cell receptor LY49C; MHC, virus, im | 9e-10 | |
| 1sb2_B | 129 | Rhodocetin beta subunit; C-type lectin, domain swa | 9e-10 | |
| 1gz2_A | 142 | Ovocleidin-17, OC-17 ovocleidin; structural protei | 1e-09 | |
| 1umr_C | 125 | Convulxin beta, CVX beta; lectin, C-type lectin, p | 1e-09 | |
| 3g8l_A | 190 | Lectin-related NK cell receptor LY49L1; natural ki | 1e-09 | |
| 3gpr_D | 124 | Rhodocetin subunit delta; disulfide bond, lectin, | 1e-09 | |
| 3pbf_A | 148 | Pulmonary surfactant-associated protein A; collect | 2e-09 | |
| 1oz7_A | 131 | Echicetin A-chain; platelet aggregation, dimer, to | 2e-09 | |
| 1c3a_B | 125 | Flavocetin-A: beta subunit; C-type lectin-like dom | 2e-09 | |
| 1j34_B | 123 | Coagulation factor IX-binding protein B chain; mag | 2e-09 | |
| 1oz7_B | 123 | Echicetin B-chain; platelet aggregation, dimer, to | 2e-09 | |
| 1jzn_A | 135 | Galactose-specific lectin; C-type lectin, protein- | 3e-09 | |
| 1ukm_B | 128 | EMS16 B chain, EMS16 subunit B; domain swapping, C | 3e-09 | |
| 1c3a_A | 135 | Flavocetin-A: alpha subunit; C-type lectin-like do | 3e-09 | |
| 1ukm_A | 134 | EMS16 A chain, EMS16 subunit A; domain swapping, C | 4e-09 | |
| 1uv0_A | 149 | Pancreatitis-associated protein 1; lectin, C-type, | 4e-09 | |
| 1umr_A | 135 | Convulxin alpha, CVX alpha; lectin, C-type lectin, | 5e-09 | |
| 3gpr_C | 134 | Rhodocetin subunit gamma; disulfide bond, lectin, | 5e-09 | |
| 3bx4_A | 136 | Aggretin alpha chain; toxin; 1.70A {Agkistrodon rh | 6e-09 | |
| 2e3x_B | 134 | Coagulation factor X-activating enzyme light CHAI; | 8e-09 | |
| 1sb2_A | 133 | Rhodocetin alpha subunit; C-type lectin, domain sw | 1e-08 | |
| 2kq2_A | 147 | Ribonuclease H-related protein; PSI, NESG, protein | 1e-08 | |
| 1j34_A | 129 | Coagulation factor IX-binding protein A chain; mag | 2e-08 | |
| 3alu_A | 157 | Lectin CEL-IV, C-type; C-type lectin, raffinose, s | 2e-08 | |
| 1fvu_A | 133 | Botrocetin alpha chain; VON WILLBRAND factor modul | 6e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 1rtm_1 | 149 | Mannose-binding protein-A; lectin; 1.80A {Rattus n | 2e-07 | |
| 1buu_A | 168 | Protein (mannose-binding protein A); lectin, HOST | 2e-07 | |
| 1hup_A | 141 | Mannose-binding protein; alpha-helical coiled-coil | 3e-07 | |
| 1wk1_A | 150 | Hypothetical protein YK1067A12; lectin C-type doma | 2e-06 | |
| 3p1g_A | 165 | Xenotropic murine leukemia virus-related virus (X | 3e-05 | |
| 2qkb_A | 154 | Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hy | 4e-05 | |
| 1byf_A | 125 | TC14, protein (polyandrocarpa lectin); C-type lect | 4e-05 | |
| 2msb_A | 115 | Mannose-binding protein-A; lectin; HET: BMA MAN; 1 | 6e-05 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 1e-04 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 2e-04 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 2e-04 | |
| 1rdl_1 | 113 | SUB-MBP-C, mannose-binding protein-C; C-type lecti | 4e-04 | |
| 1jl1_A | 155 | Ribonuclease HI; RNAse HI, protein stability, ther | 4e-04 |
| >2bpd_A Dectin-1; receptor, beta-glucan, fungal recognition, C-type lectin-like domain, CTLD, carbohydrate; 1.5A {Mus musculus} PDB: 2bph_A 2bpe_A 2cl8_A* Length = 142 | Back alignment and structure |
|---|
Score = 69.4 bits (170), Expect = 2e-14
Identities = 18/105 (17%), Positives = 38/105 (36%), Gaps = 8/105 (7%)
Query: 29 CPQHWVQYRDSCYRFVKSPLKTRNDAKLNCKSLDSDLANVNDADEHGFIMYQLFWQDPQR 88
C +W+ + SCY F S + +K +C L + L ++++ E FI Q +
Sbjct: 17 CLPNWIMHGKSCYLFSFSG-NSWYGSKRHCSQLGAHLLKIDNSKEFEFIESQT--SSHRI 73
Query: 89 RKWYFGGTQQSPN---LWVNEDDPQRRKWYFGGTQQSPNLWVNED 130
++ G ++ W + + P + +
Sbjct: 74 NAFWIGLSRNQSEGPWFWEDGSAFFPNSFQVRNAV--PQESLLHN 116
|
| >3vpp_A C-type lectin domain family 9 member A; dendritic cell, C-type lectin-like domain, membrane, immune; 1.64A {Homo sapiens} Length = 132 | Back alignment and structure |
|---|
| >2xr6_A CD209 antigen; sugar binding protein, carbohydrate binding, mannose; HET: MAN 07B; 1.35A {Homo sapiens} PDB: 1sl4_A* 2it6_A* 1k9i_A* 2xr5_A* 1sl5_A* 2it5_A* 1xph_A 1k9j_A* Length = 170 | Back alignment and structure |
|---|
| >1ypq_A Oxidised low density lipoprotein (lectin-like) receptor 1; oxidized low density lipoprotein receptor, LOX-1, CTLD, C- type lectin like domain; 1.40A {Homo sapiens} SCOP: d.169.1.1 PDB: 1ypu_A 1yxk_A 3vlg_A 1ypo_A 1yxj_A Length = 135 | Back alignment and structure |
|---|
| >2b6b_D CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahedral virus, virus-recepto; 25.00A {Homo sapiens} SCOP: d.169.1.1 Length = 175 | Back alignment and structure |
|---|
| >2vuv_A Codakine; sugar-binding protein, C-type, lectin, mannose, invertebrate; HET: CIT; 1.3A {Codakia orbicularis} PDB: 2vuz_A* Length = 129 | Back alignment and structure |
|---|
| >1sl6_A C-type lectin DC-signr; sugar binding protein; HET: GAL NDG FUC; 2.25A {Homo sapiens} SCOP: d.169.1.1 PDB: 1xar_A Length = 184 | Back alignment and structure |
|---|
| >2c6u_A CLEC1B protein; lectin, rhodocytin, aggretin, C-type lectin-like, platelets, thrombosis; 1.6A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2ls8_A C-type lectin domain family 4 member D; structural genomics, NEW YORK structural genomics research consortium, nysgrc, PSI-biology, immune system; NMR {Homo sapiens} Length = 156 | Back alignment and structure |
|---|
| >2zib_A Type II antifreeze protein; thermal hysteresis, lectin; 1.34A {Brachyopsis rostratus} Length = 133 | Back alignment and structure |
|---|
| >1tdq_B Aggrecan core protein; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: d.169.1.1 Length = 130 | Back alignment and structure |
|---|
| >2py2_A Antifreeze protein type II; type II antifreeze protein; 1.70A {Clupea harengus} Length = 136 | Back alignment and structure |
|---|
| >3bdw_A Natural killer cells antigen CD94; NK cells, receptor, glycoprotein, lectin, signal-A transmembrane, immune system receptor; 2.50A {Homo sapiens} SCOP: d.169.1.1 PDB: 3cdg_J 1b6e_A 3cii_G Length = 123 | Back alignment and structure |
|---|
| >1hq8_A NKG2-D; homodimer, CIS-proline, apoptosis; 1.95A {Mus musculus} SCOP: d.169.1.1 PDB: 1jsk_A 1kcg_A* Length = 123 | Back alignment and structure |
|---|
| >3ff7_C Killer cell lectin-like receptor subfamily G member 1; KLRG1-cadherin complex, calcium, cell adhesion, cell junction, cell membrane; 1.80A {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2afp_A Protein (SEA raven type II antifreeze protein); recombinant SEA raven protein, solution backbone fold, C- type lectin; NMR {Hemitripterus americanus} SCOP: d.169.1.1 Length = 129 | Back alignment and structure |
|---|
| >3ff9_A Killer cell lectin-like receptor subfamily G member 1; natural killer cell receptor KLTG1, glycoprotein, membrane, phosphoprotein, signal-anchor; 1.80A {Mus musculus} PDB: 3ff8_C Length = 115 | Back alignment and structure |
|---|
| >3hup_A Early activation antigen CD69; C-type lectin-like domain, disulfide bond, glycoprotein, LEC membrane, phosphoprotein, signal-anchor, transmembrane; 1.37A {Homo sapiens} PDB: 1e87_A 1e8i_A 3cck_A Length = 130 | Back alignment and structure |
|---|
| >1fm5_A Early activation antigen CD69; C-type lectin-like domain, natural killer cell receptor, lectin, C-type lectin, immune system; 2.27A {Homo sapiens} SCOP: d.169.1.1 Length = 199 | Back alignment and structure |
|---|
| >2ox9_A Collectin placenta 1; C-type lectin, sugar binding protein; HET: GAL NAG FUC; 1.95A {Mus musculus} PDB: 2ox8_A Length = 140 | Back alignment and structure |
|---|
| >1mpu_A NKG2-D type II integral membrane protein; C-type lectin-like domain, immune system; 2.50A {Homo sapiens} SCOP: d.169.1.1 PDB: 1hyr_B Length = 138 | Back alignment and structure |
|---|
| >3bdw_B NKG2-A/NKG2-B type II integral membrane protein; NK cells, receptor, glycoprotein, lectin, signal-A transmembrane, immune system receptor; 2.50A {Homo sapiens} PDB: 3cdg_K 3cii_H Length = 120 | Back alignment and structure |
|---|
| >2yhf_A C-type lectin domain family 5 member A; immune system; 1.90A {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >3m9z_A Killer cell lectin-like receptor subfamily B MEMB; C-type lectin-like domain, domain swapping, disulfide bond, transmembrane protein; 1.70A {Mus musculus} PDB: 3t3a_A Length = 139 | Back alignment and structure |
|---|
| >1qdd_A Lithostathine; pancreatic stone inhibitor, metal binding protein; HET: SIA NDG GAL; 1.30A {Homo sapiens} SCOP: d.169.1.1 PDB: 1lit_A Length = 144 | Back alignment and structure |
|---|
| >3rs1_A C-type lectin domain family 2 member I; C-type lectin-like, ligand of NK receptor, natural killer CE receptors, surface of activated T lymphocytes; 1.94A {Mus musculus} Length = 122 | Back alignment and structure |
|---|
| >1dv8_A Asialoglycoprotein receptor 1; C-type lectin CRD, signaling protein; 2.30A {Homo sapiens} SCOP: d.169.1.1 Length = 128 | Back alignment and structure |
|---|
| >3c22_A C-type lectin domain family 4 member K; coiled coil, glycoprotein, membrane, signal-anchor, transmembrane, immune system, sugar binding protein; 1.50A {Homo sapiens} PDB: 3p5g_A* 3p5d_A* 3p5f_A* 3p5e_A* 3p5h_A* 3p5i_A* 3p7g_A* 3p7f_A* 3p7h_A* 3bc7_A* 3bbs_A* 3bc6_A* Length = 156 | Back alignment and structure |
|---|
| >2h2t_B Low affinity immunoglobulin epsilon FC receptor ( IGE receptor) (FC-epsilon-RII)...; C-type lectin, calcium-bound, lectin domain; 1.30A {Homo sapiens} PDB: 2h2r_A 1t8c_A 1t8d_A Length = 175 | Back alignment and structure |
|---|
| >1htn_A Tetranectin; plasminogen binding, kringle 4, alpha-helical coiled coil, C-type lectin, carbohydrate recognition domain; 2.80A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 Length = 182 | Back alignment and structure |
|---|
| >1fvu_B Botrocetin beta chain; VON WILLBRAND factor modulator, C-type lectin, metal- binding, loop exchanged dimer, toxin; 1.80A {Bothrops jararaca} SCOP: d.169.1.1 PDB: 1ijk_C 1u0n_C 1u0o_B Length = 125 | Back alignment and structure |
|---|
| >1tn3_A Tetranectin; plasminogen binding, kringle 4, C-type lectin, carbohydrate recognition domain; 2.00A {Homo sapiens} SCOP: d.169.1.1 PDB: 1rjh_A 3l9j_C Length = 137 | Back alignment and structure |
|---|
| >3ubu_A Agglucetin subunit alpha-1; platelet inhibiting, agkisacucetin, dimer, toxin, C-type LEC GPIB inhibitor, GPIB binding; 1.91A {Deinagkistrodon acutus} Length = 131 | Back alignment and structure |
|---|
| >1jwi_A Bitiscetin; domain swapping, C-type lectin, toxin; 2.00A {Bitis arietans} SCOP: d.169.1.1 PDB: 1uex_A Length = 131 | Back alignment and structure |
|---|
| >3kqg_A Langerin, C-type lectin domain family 4 member K; trimer, NECK and CRD, coiled coil, immune system; 2.30A {Homo sapiens} Length = 182 | Back alignment and structure |
|---|
| >2e3x_C Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} Length = 122 | Back alignment and structure |
|---|
| >1pwb_A SP-D, PSP-D, pulmonary surfactant-associated protein D; collectin, C-type lectin, alpha-helical coiled coil, carbohydrate recognition domain; HET: GLC; 1.40A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 PDB: 1pw9_A* 3ikn_A* 3ikp_A* 3ikq_A* 3ikr_A* 2rie_A* 2ggx_A* 2ggu_A* 2ork_A* 2orj_A* 2ria_A* 2rib_A* 2ric_A* 2rid_A* 2os9_A* 3dbz_A 3g81_A* 3g83_A* 1b08_A 3g84_A* ... Length = 177 | Back alignment and structure |
|---|
| >1egg_A Macrophage mannose receptor; C-type lectin, sugar binding protein; 2.30A {Homo sapiens} SCOP: d.169.1.1 PDB: 1egi_A Length = 147 | Back alignment and structure |
|---|
| >1jwi_B Platelet aggregation inducer; domain swapping, C-type lectin, toxin; 2.00A {Bitis arietans} SCOP: d.169.1.1 PDB: 1uex_B Length = 125 | Back alignment and structure |
|---|
| >3bx4_B Aggretin beta chain; toxin; 1.70A {Agkistrodon rhodostoma} PDB: 2vrp_B Length = 146 | Back alignment and structure |
|---|
| >1wmz_A Lectin CEL-I, N-acetyl-D-galactosamine-specific C-type; C-type lectin, N-acetylgalactosamine, invertebrate, sugar binding protein; HET: NGA A2G; 1.70A {Cucumaria echinata} SCOP: d.169.1.1 PDB: 1wmy_A* Length = 140 | Back alignment and structure |
|---|
| >2kv3_A Regenerating islet-derived protein 4; GISP, C-type lectin, REG IV, disulfide bond, glycoPro lectin, secreted, sugar binding protein; NMR {Homo sapiens} Length = 131 | Back alignment and structure |
|---|
| >3ubu_B Agglucetin subunit beta-2; platelet inhibiting, agkisacucetin, dimer, toxin, C-type LEC GPIB inhibitor, GPIB binding; 1.91A {Deinagkistrodon acutus} Length = 126 | Back alignment and structure |
|---|
| >3c8j_A Natural killer cell receptor LY49C; MHC, virus, immune system; 2.60A {Mus musculus} SCOP: d.169.1.1 PDB: 3c8k_D 1p4l_D 1ja3_A 1p1z_D Length = 203 | Back alignment and structure |
|---|
| >1sb2_B Rhodocetin beta subunit; C-type lectin, domain swapping, toxin; 1.90A {Calloselasma rhodostoma} SCOP: d.169.1.1 PDB: 3gpr_B Length = 129 | Back alignment and structure |
|---|
| >1gz2_A Ovocleidin-17, OC-17 ovocleidin; structural protein, CTLD, eggshell structural protein, phosphoprotein, sugar-binding protein, glycoprotein; HET: SEP; 1.5A {Gallus gallus} SCOP: d.169.1.1 Length = 142 | Back alignment and structure |
|---|
| >1umr_C Convulxin beta, CVX beta; lectin, C-type lectin, platelet, sugar-binding protein, activator, snake venom; 2.40A {Crotalus durissus terrificus} SCOP: d.169.1.1 PDB: 1uos_B Length = 125 | Back alignment and structure |
|---|
| >3g8l_A Lectin-related NK cell receptor LY49L1; natural killer cell receptor, immune system; 2.50A {Mus musculus} Length = 190 | Back alignment and structure |
|---|
| >3gpr_D Rhodocetin subunit delta; disulfide bond, lectin, secreted, toxin, cell adhesion; 3.20A {Calloselasma rhodostoma} Length = 124 | Back alignment and structure |
|---|
| >3pbf_A Pulmonary surfactant-associated protein A; collectin, carbohydrate binding, lectin, mannose, sugar BIND protein; 1.80A {Rattus norvegicus} PDB: 1r14_A* 1r13_A* 3paq_A* 3par_A 3pak_A Length = 148 | Back alignment and structure |
|---|
| >1oz7_A Echicetin A-chain; platelet aggregation, dimer, toxin; 2.40A {Echis carinatus} SCOP: d.169.1.1 Length = 131 | Back alignment and structure |
|---|
| >1c3a_B Flavocetin-A: beta subunit; C-type lectin-like domains, membrane protein; 2.50A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1v4l_B Length = 125 | Back alignment and structure |
|---|
| >1j34_B Coagulation factor IX-binding protein B chain; magnesium ION, calcium ION, GLA domain, protein binding/blood clotting complex; HET: CGU; 1.55A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1bj3_B 1ixx_B* 1j35_B* 1x2t_B* 1x2w_B 1wt9_B 1iod_B 1y17_B Length = 123 | Back alignment and structure |
|---|
| >1oz7_B Echicetin B-chain; platelet aggregation, dimer, toxin; 2.40A {Echis carinatus} SCOP: d.169.1.1 Length = 123 | Back alignment and structure |
|---|
| >1jzn_A Galactose-specific lectin; C-type lectin, protein-disaccharide complex, sugar binding P; HET: BGC GAL; 2.20A {Crotalus atrox} SCOP: d.169.1.1 PDB: 1muq_A* Length = 135 | Back alignment and structure |
|---|
| >1ukm_B EMS16 B chain, EMS16 subunit B; domain swapping, C-type lectin, toxin; HET: NAG; 1.90A {Echis multisquamatus} SCOP: d.169.1.1 PDB: 1v7p_B* Length = 128 | Back alignment and structure |
|---|
| >1c3a_A Flavocetin-A: alpha subunit; C-type lectin-like domains, membrane protein; 2.50A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1v4l_A Length = 135 | Back alignment and structure |
|---|
| >1ukm_A EMS16 A chain, EMS16 subunit A; domain swapping, C-type lectin, toxin; HET: NAG; 1.90A {Echis multisquamatus} SCOP: d.169.1.1 PDB: 1v7p_A* Length = 134 | Back alignment and structure |
|---|
| >1uv0_A Pancreatitis-associated protein 1; lectin, C-type, secreted, inflammatory response, acute phase; 1.78A {Homo sapiens} SCOP: d.169.1.1 PDB: 2go0_A Length = 149 | Back alignment and structure |
|---|
| >1umr_A Convulxin alpha, CVX alpha; lectin, C-type lectin, platelet, sugar-binding protein, activator, snake venom; 2.40A {Crotalus durissus terrificus} SCOP: d.169.1.1 PDB: 1uos_A Length = 135 | Back alignment and structure |
|---|
| >3gpr_C Rhodocetin subunit gamma; disulfide bond, lectin, secreted, toxin, cell adhesion; 3.20A {Calloselasma rhodostoma} Length = 134 | Back alignment and structure |
|---|
| >3bx4_A Aggretin alpha chain; toxin; 1.70A {Agkistrodon rhodostoma} PDB: 2vrp_A Length = 136 | Back alignment and structure |
|---|
| >2e3x_B Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} Length = 134 | Back alignment and structure |
|---|
| >1sb2_A Rhodocetin alpha subunit; C-type lectin, domain swapping, toxin; 1.90A {Calloselasma rhodostoma} SCOP: d.169.1.1 PDB: 3gpr_A Length = 133 | Back alignment and structure |
|---|
| >2kq2_A Ribonuclease H-related protein; PSI, NESG, protein structure, APO enzyme, structural genomics, protein structure initiative; NMR {Desulfitobacterium hafniense dcb-2} PDB: 2kw4_A Length = 147 | Back alignment and structure |
|---|
| >1j34_A Coagulation factor IX-binding protein A chain; magnesium ION, calcium ION, GLA domain, protein binding/blood clotting complex; HET: CGU; 1.55A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1bj3_A* 1j35_A* 1x2t_A* 1x2w_A 1ixx_A 1y17_A 1wt9_A 1iod_A* Length = 129 | Back alignment and structure |
|---|
| >3alu_A Lectin CEL-IV, C-type; C-type lectin, raffinose, sugar binding protein; HET: RAF; 1.65A {Cucumaria echinata} PDB: 3als_A* 3alt_A* Length = 157 | Back alignment and structure |
|---|
| >1fvu_A Botrocetin alpha chain; VON WILLBRAND factor modulator, C-type lectin, metal- binding, loop exchanged dimer, toxin; 1.80A {Bothrops jararaca} SCOP: d.169.1.1 PDB: 1ijk_B 1u0n_B 1u0o_A Length = 133 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1rtm_1 Mannose-binding protein-A; lectin; 1.80A {Rattus norvegicus} SCOP: d.169.1.1 h.1.1.1 PDB: 1kwu_A* 1kwv_A* 1kwt_A* 1kwx_A* 1kwy_A* 1kx1_A* 1kww_A 1kwz_A* 1kx0_A* 3kmb_1* 1kmb_1* 2kmb_1* 4kmb_1* 1afb_1* 1afa_1* 1afd_1 1bch_1* 1bcj_1* 1fif_A 1fih_A* Length = 149 | Back alignment and structure |
|---|
| >1buu_A Protein (mannose-binding protein A); lectin, HOST defense, metalloprotein, sugar binding protein; 1.90A {Rattus norvegicus} SCOP: d.169.1.1 h.1.1.1 Length = 168 | Back alignment and structure |
|---|
| >1hup_A Mannose-binding protein; alpha-helical coiled-coil, C-type lectin; 2.50A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 Length = 141 | Back alignment and structure |
|---|
| >1wk1_A Hypothetical protein YK1067A12; lectin C-type domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Caenorhabditis elegans} SCOP: d.169.1.1 Length = 150 | Back alignment and structure |
|---|
| >3p1g_A Xenotropic murine leukemia virus-related virus (X H domain; XMRV, RNAse H, reverse transcriptase, transcription; 1.50A {Xenotropic mulv-related virus} PDB: 3v1q_A 3v1o_A 3v1r_A* 2hb5_A Length = 165 | Back alignment and structure |
|---|
| >2qkb_A Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hybrid; 2.40A {Homo sapiens} PDB: 2qk9_A 2qkk_A* Length = 154 | Back alignment and structure |
|---|
| >1byf_A TC14, protein (polyandrocarpa lectin); C-type lectin, galactose-specific, sugar binding protein; 2.00A {Polyandrocarpa misakiensis} SCOP: d.169.1.1 PDB: 1tlg_A* Length = 125 | Back alignment and structure |
|---|
| >2msb_A Mannose-binding protein-A; lectin; HET: BMA MAN; 1.70A {Rattus rattus} SCOP: d.169.1.1 PDB: 1msb_A 1ytt_A* Length = 115 | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Length = 157 | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Length = 162 | Back alignment and structure |
|---|
| >1rdl_1 SUB-MBP-C, mannose-binding protein-C; C-type lectin, calcium-binding protein; HET: MMA; 1.70A {Rattus rattus} SCOP: d.169.1.1 PDB: 1rdj_1* 1rdk_1* 1rdi_1* 1rdm_1* 1rdn_1* 1rdo_1 1bv4_A 1kza_1* 1kzb_1* 1kzc_1* 1kzd_1* 1kze_1* Length = 113 | Back alignment and structure |
|---|
| >1jl1_A Ribonuclease HI; RNAse HI, protein stability, thermostability, hydrogen exchange, cooperativity, hydrolase; 1.30A {Escherichia coli} SCOP: c.55.3.1 PDB: 1f21_A 1jxb_A 1g15_A 1rch_A 1rdd_A 1rnh_A* 2rn2_A 1rda_A 1law_A 1rdb_A 1lav_A 3aa4_A 1rbu_A 1gob_A 1rdc_A 1kvc_A 3aa3_A 3aa2_A 3aa5_X 1rbv_A ... Length = 155 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 483 | |||
| 1qdd_A | 144 | Lithostathine; pancreatic stone inhibitor, metal b | 99.93 | |
| 2py2_A | 136 | Antifreeze protein type II; type II antifreeze pro | 99.93 | |
| 2kv3_A | 131 | Regenerating islet-derived protein 4; GISP, C-type | 99.92 | |
| 1uv0_A | 149 | Pancreatitis-associated protein 1; lectin, C-type, | 99.92 | |
| 1jzn_A | 135 | Galactose-specific lectin; C-type lectin, protein- | 99.92 | |
| 1gz2_A | 142 | Ovocleidin-17, OC-17 ovocleidin; structural protei | 99.92 | |
| 3vpp_A | 132 | C-type lectin domain family 9 member A; dendritic | 99.92 | |
| 3bx4_B | 146 | Aggretin beta chain; toxin; 1.70A {Agkistrodon rho | 99.92 | |
| 1tn3_A | 137 | Tetranectin; plasminogen binding, kringle 4, C-typ | 99.92 | |
| 1wmz_A | 140 | Lectin CEL-I, N-acetyl-D-galactosamine-specific C- | 99.92 | |
| 1c3a_A | 135 | Flavocetin-A: alpha subunit; C-type lectin-like do | 99.92 | |
| 1ypq_A | 135 | Oxidised low density lipoprotein (lectin-like) rec | 99.92 | |
| 1jwi_A | 131 | Bitiscetin; domain swapping, C-type lectin, toxin; | 99.92 | |
| 1egg_A | 147 | Macrophage mannose receptor; C-type lectin, sugar | 99.91 | |
| 2afp_A | 129 | Protein (SEA raven type II antifreeze protein); re | 99.91 | |
| 1ukm_A | 134 | EMS16 A chain, EMS16 subunit A; domain swapping, C | 99.91 | |
| 1umr_A | 135 | Convulxin alpha, CVX alpha; lectin, C-type lectin, | 99.91 | |
| 2c6u_A | 122 | CLEC1B protein; lectin, rhodocytin, aggretin, C-ty | 99.91 | |
| 3ubu_A | 131 | Agglucetin subunit alpha-1; platelet inhibiting, a | 99.91 | |
| 1fvu_A | 133 | Botrocetin alpha chain; VON WILLBRAND factor modul | 99.91 | |
| 2ox9_A | 140 | Collectin placenta 1; C-type lectin, sugar binding | 99.91 | |
| 1tdq_B | 130 | Aggrecan core protein; extracellular matrix, lecti | 99.91 | |
| 1j34_A | 129 | Coagulation factor IX-binding protein A chain; mag | 99.91 | |
| 2e3x_B | 134 | Coagulation factor X-activating enzyme light CHAI; | 99.91 | |
| 3bx4_A | 136 | Aggretin alpha chain; toxin; 1.70A {Agkistrodon rh | 99.91 | |
| 1sb2_A | 133 | Rhodocetin alpha subunit; C-type lectin, domain sw | 99.91 | |
| 1dv8_A | 128 | Asialoglycoprotein receptor 1; C-type lectin CRD, | 99.91 | |
| 3c22_A | 156 | C-type lectin domain family 4 member K; coiled coi | 99.91 | |
| 1oz7_A | 131 | Echicetin A-chain; platelet aggregation, dimer, to | 99.91 | |
| 1fvu_B | 125 | Botrocetin beta chain; VON WILLBRAND factor modula | 99.91 | |
| 1sb2_B | 129 | Rhodocetin beta subunit; C-type lectin, domain swa | 99.9 | |
| 3gpr_D | 124 | Rhodocetin subunit delta; disulfide bond, lectin, | 99.9 | |
| 2zib_A | 133 | Type II antifreeze protein; thermal hysteresis, le | 99.9 | |
| 3kqg_A | 182 | Langerin, C-type lectin domain family 4 member K; | 99.9 | |
| 3gpr_C | 134 | Rhodocetin subunit gamma; disulfide bond, lectin, | 99.9 | |
| 1htn_A | 182 | Tetranectin; plasminogen binding, kringle 4, alpha | 99.9 | |
| 3alu_A | 157 | Lectin CEL-IV, C-type; C-type lectin, raffinose, s | 99.9 | |
| 1ukm_B | 128 | EMS16 B chain, EMS16 subunit B; domain swapping, C | 99.9 | |
| 3bdw_A | 123 | Natural killer cells antigen CD94; NK cells, recep | 99.9 | |
| 2bpd_A | 142 | Dectin-1; receptor, beta-glucan, fungal recognitio | 99.9 | |
| 1jwi_B | 125 | Platelet aggregation inducer; domain swapping, C-t | 99.9 | |
| 2ls8_A | 156 | C-type lectin domain family 4 member D; structural | 99.83 | |
| 2vuv_A | 129 | Codakine; sugar-binding protein, C-type, lectin, m | 99.9 | |
| 2b6b_D | 175 | CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahe | 99.9 | |
| 3rs1_A | 122 | C-type lectin domain family 2 member I; C-type lec | 99.9 | |
| 1j34_B | 123 | Coagulation factor IX-binding protein B chain; mag | 99.9 | |
| 1umr_C | 125 | Convulxin beta, CVX beta; lectin, C-type lectin, p | 99.9 | |
| 1sl6_A | 184 | C-type lectin DC-signr; sugar binding protein; HET | 99.9 | |
| 2yhf_A | 118 | C-type lectin domain family 5 member A; immune sys | 99.9 | |
| 1oz7_B | 123 | Echicetin B-chain; platelet aggregation, dimer, to | 99.9 | |
| 2e3x_C | 122 | Coagulation factor X-activating enzyme light CHAI; | 99.9 | |
| 3g8k_A | 130 | Lectin-related NK cell receptor LY49L1; natural ki | 99.89 | |
| 3ubu_B | 126 | Agglucetin subunit beta-2; platelet inhibiting, ag | 99.89 | |
| 1c3a_B | 125 | Flavocetin-A: beta subunit; C-type lectin-like dom | 99.89 | |
| 1hq8_A | 123 | NKG2-D; homodimer, CIS-proline, apoptosis; 1.95A { | 99.89 | |
| 1mpu_A | 138 | NKG2-D type II integral membrane protein; C-type l | 99.89 | |
| 2h2t_B | 175 | Low affinity immunoglobulin epsilon FC receptor ( | 99.89 | |
| 1hup_A | 141 | Mannose-binding protein; alpha-helical coiled-coil | 99.89 | |
| 3bdw_B | 120 | NKG2-A/NKG2-B type II integral membrane protein; N | 99.89 | |
| 2xr6_A | 170 | CD209 antigen; sugar binding protein, carbohydrate | 99.89 | |
| 3m9z_A | 139 | Killer cell lectin-like receptor subfamily B MEMB; | 99.89 | |
| 3hup_A | 130 | Early activation antigen CD69; C-type lectin-like | 99.88 | |
| 1rtm_1 | 149 | Mannose-binding protein-A; lectin; 1.80A {Rattus n | 99.88 | |
| 2kq2_A | 147 | Ribonuclease H-related protein; PSI, NESG, protein | 99.88 | |
| 3ff7_C | 112 | Killer cell lectin-like receptor subfamily G membe | 99.88 | |
| 3ff9_A | 115 | Killer cell lectin-like receptor subfamily G membe | 99.88 | |
| 1fm5_A | 199 | Early activation antigen CD69; C-type lectin-like | 99.88 | |
| 3qio_A | 150 | GAG-POL polyprotein; RNAse H, inhibitor, nuclease, | 99.88 | |
| 2qkb_A | 154 | Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hy | 99.88 | |
| 1buu_A | 168 | Protein (mannose-binding protein A); lectin, HOST | 99.87 | |
| 3h08_A | 146 | RNH (ribonuclease H); RNAse H, 3D-structure, endon | 99.87 | |
| 3c8j_A | 203 | Natural killer cell receptor LY49C; MHC, virus, im | 99.87 | |
| 2msb_A | 115 | Mannose-binding protein-A; lectin; HET: BMA MAN; 1 | 99.87 | |
| 3p1g_A | 165 | Xenotropic murine leukemia virus-related virus (X | 99.86 | |
| 2e4l_A | 158 | Ribonuclease HI, RNAse HI; hydrolase, endoribonucl | 99.86 | |
| 1jl1_A | 155 | Ribonuclease HI; RNAse HI, protein stability, ther | 99.86 | |
| 3g8l_A | 190 | Lectin-related NK cell receptor LY49L1; natural ki | 99.86 | |
| 1rdl_1 | 113 | SUB-MBP-C, mannose-binding protein-C; C-type lecti | 99.85 | |
| 1wk1_A | 150 | Hypothetical protein YK1067A12; lectin C-type doma | 99.85 | |
| 1pwb_A | 177 | SP-D, PSP-D, pulmonary surfactant-associated prote | 99.85 | |
| 1h8u_A | 117 | MBP, eosinophil granule major basic protein 1; lec | 99.85 | |
| 3pbf_A | 148 | Pulmonary surfactant-associated protein A; collect | 99.84 | |
| 1byf_A | 125 | TC14, protein (polyandrocarpa lectin); C-type lect | 99.84 | |
| 1ril_A | 166 | Ribonuclease H; hydrolase(endoribonuclease); 2.80A | 99.83 | |
| 2lsn_A | 165 | Reverse transcriptase; RNAse H, viral protein; NMR | 99.81 | |
| 3hst_B | 141 | Protein RV2228C/MT2287; ribonuclease H1, RV2228C N | 99.8 | |
| 3u3g_D | 140 | Ribonuclease H, RNAse H1; hydrolase, cleave the RN | 99.79 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 99.76 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 99.76 | |
| 2ehg_A | 149 | Ribonuclease HI; RNAse HI, hyperthermophilic archa | 99.76 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 99.75 | |
| 1mu2_A | 555 | HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polym | 99.73 | |
| 2zd1_A | 557 | Reverse transcriptase/ribonuclease H; P51/P66, het | 99.73 | |
| 1zbf_A | 142 | Ribonuclease H-related protein; RNAse H, RNA/DNA h | 99.37 | |
| 4htu_A | 134 | Ribonuclease H, RNAse H; 5-chloro-2'-deoxyuridine, | 99.15 | |
| 3k7b_A | 96 | Protein A33; C-type lectin-like domain, homodimer, | 98.37 | |
| 3fd4_A | 191 | Glycoprotein GP42; C type lectin, virus entry, mem | 94.65 |
| >1qdd_A Lithostathine; pancreatic stone inhibitor, metal binding protein; HET: SIA NDG GAL; 1.30A {Homo sapiens} SCOP: d.169.1.1 PDB: 1lit_A | Back alignment and structure |
|---|
Probab=99.93 E-value=1e-25 Score=196.81 Aligned_cols=131 Identities=18% Similarity=0.363 Sum_probs=113.9
Q ss_pred cCCCcccccccCCeEEEEecCCCCCHHHHHHHhhhc-CCcccccCCHhHHHHHHHHhhhcCCCCCceeeecccCCCCccc
Q psy14885 26 ELRCPQHWVQYRDSCYRFVKSPLKTRNDAKLNCKSL-DSDLANVNDADEHGFIMYQLFWQDPQRRKWYFGGTQQSPNLWV 104 (483)
Q Consensus 26 ~~~C~~gw~~~~~~Cy~~~~~~~~tw~~A~~~C~~~-g~~L~~i~s~~e~~~l~~~~~~~~~~~~~~wig~~~~~~~~Wi 104 (483)
...||+||+.|+++||+++... ++|.+|+..|+.+ ||+|++|+|.+|++||..++.........||||+++..
T Consensus 11 ~~~Cp~gw~~~~~~CY~~~~~~-~~w~~A~~~C~~~~gg~La~i~s~~e~~~l~~~~~~~~~~~~~~WIGl~~~~----- 84 (144)
T 1qdd_A 11 RISCPEGTNAYRSYCYYFNEDR-ETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPK----- 84 (144)
T ss_dssp GTSCCTTCEEETTEEEEEEEEE-ECHHHHHHHHHHTTSCEECCCCSHHHHHHHHHHHHHTTCCCSEEEEEEECTT-----
T ss_pred CCCCCCCceecCCEeEEEeCCC-cCHHHHHHHhhccCCceECccCCHHHHHHHHHHHHhcCCCCCCEEEeeEcCC-----
Confidence 5689999999999999999995 9999999999998 89999999999999999999876544567777777543
Q ss_pred ccCcccccccccCCcCCCCCccccCCCCccccccccCCC-CCCCcccCCeEEEecccccccccccccCCCCceeeeeecc
Q psy14885 105 NEDDPQRRKWYFGGTQQSPNLWVNEDGTNLNELDAAFLP-EPADNVQRDYLAYSFSQSLKRWGFERVTGMEPLLFICEAS 183 (483)
Q Consensus 105 g~~~~~~~~w~~~g~~~~~~~~~W~dg~~~~~~~~~w~~-~P~~~~~~~Cv~~~~~~~~~~W~~~~C~~~~~~~fvCe~~ 183 (483)
.++.|.|+||+++.+ .+|.+ +|++...++|+.+....+.+.|++.+|+ ..++||||++
T Consensus 85 -----------------~~~~~~W~dg~~~~~--~~W~~~~P~~~~~~~Cv~~~~~~~~~~W~d~~C~--~~~~fICe~~ 143 (144)
T 1qdd_A 85 -----------------KNRAWHWSSGSLVSY--KSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCE--DKFSFVCKFK 143 (144)
T ss_dssp -----------------SSSCCEETTCCCCCC--CCBCTTCSCSSSCCSEEEEEGGGTTCSEEEECTT--SCEEEEEEEE
T ss_pred -----------------CCCeEEeCCCCCcCc--CccCCCCcCCCCCCCcEEEEecCCCCeEeCCCCC--CCceeeeeec
Confidence 457899999999876 78999 9998667899999876554479999999 9999999986
|
| >2py2_A Antifreeze protein type II; type II antifreeze protein; 1.70A {Clupea harengus} | Back alignment and structure |
|---|
| >2kv3_A Regenerating islet-derived protein 4; GISP, C-type lectin, REG IV, disulfide bond, glycoPro lectin, secreted, sugar binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uv0_A Pancreatitis-associated protein 1; lectin, C-type, secreted, inflammatory response, acute phase; 1.78A {Homo sapiens} SCOP: d.169.1.1 PDB: 2go0_A | Back alignment and structure |
|---|
| >1jzn_A Galactose-specific lectin; C-type lectin, protein-disaccharide complex, sugar binding P; HET: BGC GAL; 2.20A {Crotalus atrox} SCOP: d.169.1.1 PDB: 1muq_A* | Back alignment and structure |
|---|
| >1gz2_A Ovocleidin-17, OC-17 ovocleidin; structural protein, CTLD, eggshell structural protein, phosphoprotein, sugar-binding protein, glycoprotein; HET: SEP; 1.5A {Gallus gallus} SCOP: d.169.1.1 | Back alignment and structure |
|---|
| >3vpp_A C-type lectin domain family 9 member A; dendritic cell, C-type lectin-like domain, membrane, immune; 1.64A {Homo sapiens} | Back alignment and structure |
|---|
| >3bx4_B Aggretin beta chain; toxin; 1.70A {Agkistrodon rhodostoma} PDB: 2vrp_B | Back alignment and structure |
|---|
| >1tn3_A Tetranectin; plasminogen binding, kringle 4, C-type lectin, carbohydrate recognition domain; 2.00A {Homo sapiens} SCOP: d.169.1.1 PDB: 1rjh_A 3l9j_C | Back alignment and structure |
|---|
| >1wmz_A Lectin CEL-I, N-acetyl-D-galactosamine-specific C-type; C-type lectin, N-acetylgalactosamine, invertebrate, sugar binding protein; HET: NGA A2G; 1.70A {Cucumaria echinata} SCOP: d.169.1.1 PDB: 1wmy_A* | Back alignment and structure |
|---|
| >1c3a_A Flavocetin-A: alpha subunit; C-type lectin-like domains, membrane protein; 2.50A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1v4l_A | Back alignment and structure |
|---|
| >1ypq_A Oxidised low density lipoprotein (lectin-like) receptor 1; oxidized low density lipoprotein receptor, LOX-1, CTLD, C- type lectin like domain; 1.40A {Homo sapiens} SCOP: d.169.1.1 PDB: 1ypu_A 1yxk_A 3vlg_A 1ypo_A 1yxj_A | Back alignment and structure |
|---|
| >1jwi_A Bitiscetin; domain swapping, C-type lectin, toxin; 2.00A {Bitis arietans} SCOP: d.169.1.1 PDB: 1uex_A | Back alignment and structure |
|---|
| >1egg_A Macrophage mannose receptor; C-type lectin, sugar binding protein; 2.30A {Homo sapiens} SCOP: d.169.1.1 PDB: 1egi_A | Back alignment and structure |
|---|
| >2afp_A Protein (SEA raven type II antifreeze protein); recombinant SEA raven protein, solution backbone fold, C- type lectin; NMR {Hemitripterus americanus} SCOP: d.169.1.1 | Back alignment and structure |
|---|
| >1ukm_A EMS16 A chain, EMS16 subunit A; domain swapping, C-type lectin, toxin; HET: NAG; 1.90A {Echis multisquamatus} SCOP: d.169.1.1 PDB: 1v7p_A* | Back alignment and structure |
|---|
| >1umr_A Convulxin alpha, CVX alpha; lectin, C-type lectin, platelet, sugar-binding protein, activator, snake venom; 2.40A {Crotalus durissus terrificus} SCOP: d.169.1.1 PDB: 1uos_A | Back alignment and structure |
|---|
| >2c6u_A CLEC1B protein; lectin, rhodocytin, aggretin, C-type lectin-like, platelets, thrombosis; 1.6A {Homo sapiens} | Back alignment and structure |
|---|
| >3ubu_A Agglucetin subunit alpha-1; platelet inhibiting, agkisacucetin, dimer, toxin, C-type LEC GPIB inhibitor, GPIB binding; 1.91A {Deinagkistrodon acutus} | Back alignment and structure |
|---|
| >1fvu_A Botrocetin alpha chain; VON WILLBRAND factor modulator, C-type lectin, metal- binding, loop exchanged dimer, toxin; 1.80A {Bothrops jararaca} SCOP: d.169.1.1 PDB: 1ijk_B 1u0n_B 1u0o_A | Back alignment and structure |
|---|
| >2ox9_A Collectin placenta 1; C-type lectin, sugar binding protein; HET: GAL NAG FUC; 1.95A {Mus musculus} PDB: 2ox8_A | Back alignment and structure |
|---|
| >1tdq_B Aggrecan core protein; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: d.169.1.1 | Back alignment and structure |
|---|
| >1j34_A Coagulation factor IX-binding protein A chain; magnesium ION, calcium ION, GLA domain, protein binding/blood clotting complex; HET: CGU; 1.55A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1bj3_A* 1j35_A* 1x2t_A* 1x2w_A 1ixx_A 1y17_A 1wt9_A 1iod_A* | Back alignment and structure |
|---|
| >2e3x_B Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} | Back alignment and structure |
|---|
| >3bx4_A Aggretin alpha chain; toxin; 1.70A {Agkistrodon rhodostoma} PDB: 2vrp_A | Back alignment and structure |
|---|
| >1sb2_A Rhodocetin alpha subunit; C-type lectin, domain swapping, toxin; 1.90A {Calloselasma rhodostoma} SCOP: d.169.1.1 PDB: 3gpr_A | Back alignment and structure |
|---|
| >1dv8_A Asialoglycoprotein receptor 1; C-type lectin CRD, signaling protein; 2.30A {Homo sapiens} SCOP: d.169.1.1 | Back alignment and structure |
|---|
| >3c22_A C-type lectin domain family 4 member K; coiled coil, glycoprotein, membrane, signal-anchor, transmembrane, immune system, sugar binding protein; 1.50A {Homo sapiens} PDB: 3p5g_A* 3p5d_A* 3p5f_A* 3p5e_A* 3p5h_A* 3p5i_A* 3p7g_A* 3p7f_A* 3p7h_A* 3bc7_A* 3bbs_A* 3bc6_A* | Back alignment and structure |
|---|
| >1oz7_A Echicetin A-chain; platelet aggregation, dimer, toxin; 2.40A {Echis carinatus} SCOP: d.169.1.1 | Back alignment and structure |
|---|
| >1fvu_B Botrocetin beta chain; VON WILLBRAND factor modulator, C-type lectin, metal- binding, loop exchanged dimer, toxin; 1.80A {Bothrops jararaca} SCOP: d.169.1.1 PDB: 1ijk_C 1u0n_C 1u0o_B | Back alignment and structure |
|---|
| >1sb2_B Rhodocetin beta subunit; C-type lectin, domain swapping, toxin; 1.90A {Calloselasma rhodostoma} SCOP: d.169.1.1 PDB: 3gpr_B | Back alignment and structure |
|---|
| >3gpr_D Rhodocetin subunit delta; disulfide bond, lectin, secreted, toxin, cell adhesion; 3.20A {Calloselasma rhodostoma} | Back alignment and structure |
|---|
| >2zib_A Type II antifreeze protein; thermal hysteresis, lectin; 1.34A {Brachyopsis rostratus} | Back alignment and structure |
|---|
| >3kqg_A Langerin, C-type lectin domain family 4 member K; trimer, NECK and CRD, coiled coil, immune system; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3gpr_C Rhodocetin subunit gamma; disulfide bond, lectin, secreted, toxin, cell adhesion; 3.20A {Calloselasma rhodostoma} | Back alignment and structure |
|---|
| >1htn_A Tetranectin; plasminogen binding, kringle 4, alpha-helical coiled coil, C-type lectin, carbohydrate recognition domain; 2.80A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 | Back alignment and structure |
|---|
| >3alu_A Lectin CEL-IV, C-type; C-type lectin, raffinose, sugar binding protein; HET: RAF; 1.65A {Cucumaria echinata} PDB: 3als_A* 3alt_A* | Back alignment and structure |
|---|
| >1ukm_B EMS16 B chain, EMS16 subunit B; domain swapping, C-type lectin, toxin; HET: NAG; 1.90A {Echis multisquamatus} SCOP: d.169.1.1 PDB: 1v7p_B* | Back alignment and structure |
|---|
| >3bdw_A Natural killer cells antigen CD94; NK cells, receptor, glycoprotein, lectin, signal-A transmembrane, immune system receptor; 2.50A {Homo sapiens} SCOP: d.169.1.1 PDB: 3cdg_J 1b6e_A 3cii_G | Back alignment and structure |
|---|
| >2bpd_A Dectin-1; receptor, beta-glucan, fungal recognition, C-type lectin-like domain, CTLD, carbohydrate; 1.5A {Mus musculus} PDB: 2bph_A 2bpe_A 2cl8_A* | Back alignment and structure |
|---|
| >1jwi_B Platelet aggregation inducer; domain swapping, C-type lectin, toxin; 2.00A {Bitis arietans} SCOP: d.169.1.1 PDB: 1uex_B | Back alignment and structure |
|---|
| >2ls8_A C-type lectin domain family 4 member D; structural genomics, NEW YORK structural genomics research consortium, nysgrc, PSI-biology, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vuv_A Codakine; sugar-binding protein, C-type, lectin, mannose, invertebrate; HET: CIT; 1.3A {Codakia orbicularis} PDB: 2vuz_A* | Back alignment and structure |
|---|
| >2b6b_D CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahedral virus, virus-recepto; 25.00A {Homo sapiens} SCOP: d.169.1.1 | Back alignment and structure |
|---|
| >3rs1_A C-type lectin domain family 2 member I; C-type lectin-like, ligand of NK receptor, natural killer CE receptors, surface of activated T lymphocytes; 1.94A {Mus musculus} | Back alignment and structure |
|---|
| >1j34_B Coagulation factor IX-binding protein B chain; magnesium ION, calcium ION, GLA domain, protein binding/blood clotting complex; HET: CGU; 1.55A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1bj3_B 1ixx_B* 1j35_B* 1x2t_B* 1x2w_B 1wt9_B 1iod_B 1y17_B | Back alignment and structure |
|---|
| >1umr_C Convulxin beta, CVX beta; lectin, C-type lectin, platelet, sugar-binding protein, activator, snake venom; 2.40A {Crotalus durissus terrificus} SCOP: d.169.1.1 PDB: 1uos_B | Back alignment and structure |
|---|
| >1sl6_A C-type lectin DC-signr; sugar binding protein; HET: GAL NDG FUC; 2.25A {Homo sapiens} SCOP: d.169.1.1 PDB: 1xar_A | Back alignment and structure |
|---|
| >2yhf_A C-type lectin domain family 5 member A; immune system; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1oz7_B Echicetin B-chain; platelet aggregation, dimer, toxin; 2.40A {Echis carinatus} SCOP: d.169.1.1 | Back alignment and structure |
|---|
| >2e3x_C Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} | Back alignment and structure |
|---|
| >3ubu_B Agglucetin subunit beta-2; platelet inhibiting, agkisacucetin, dimer, toxin, C-type LEC GPIB inhibitor, GPIB binding; 1.91A {Deinagkistrodon acutus} | Back alignment and structure |
|---|
| >1c3a_B Flavocetin-A: beta subunit; C-type lectin-like domains, membrane protein; 2.50A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1v4l_B | Back alignment and structure |
|---|
| >1hq8_A NKG2-D; homodimer, CIS-proline, apoptosis; 1.95A {Mus musculus} SCOP: d.169.1.1 PDB: 1jsk_A 1kcg_A* | Back alignment and structure |
|---|
| >1mpu_A NKG2-D type II integral membrane protein; C-type lectin-like domain, immune system; 2.50A {Homo sapiens} SCOP: d.169.1.1 PDB: 1hyr_B | Back alignment and structure |
|---|
| >2h2t_B Low affinity immunoglobulin epsilon FC receptor ( IGE receptor) (FC-epsilon-RII)...; C-type lectin, calcium-bound, lectin domain; 1.30A {Homo sapiens} PDB: 2h2r_A 1t8c_A 1t8d_A | Back alignment and structure |
|---|
| >1hup_A Mannose-binding protein; alpha-helical coiled-coil, C-type lectin; 2.50A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 | Back alignment and structure |
|---|
| >3bdw_B NKG2-A/NKG2-B type II integral membrane protein; NK cells, receptor, glycoprotein, lectin, signal-A transmembrane, immune system receptor; 2.50A {Homo sapiens} PDB: 3cdg_K 3cii_H | Back alignment and structure |
|---|
| >2xr6_A CD209 antigen; sugar binding protein, carbohydrate binding, mannose; HET: MAN 07B; 1.35A {Homo sapiens} PDB: 1sl4_A* 2it6_A* 1k9i_A* 2xr5_A* 1sl5_A* 2it5_A* 1xph_A 1k9j_A* | Back alignment and structure |
|---|
| >3m9z_A Killer cell lectin-like receptor subfamily B MEMB; C-type lectin-like domain, domain swapping, disulfide bond, transmembrane protein; 1.70A {Mus musculus} SCOP: d.169.1.0 PDB: 3t3a_A | Back alignment and structure |
|---|
| >3hup_A Early activation antigen CD69; C-type lectin-like domain, disulfide bond, glycoprotein, LEC membrane, phosphoprotein, signal-anchor, transmembrane; 1.37A {Homo sapiens} SCOP: d.169.1.1 PDB: 1e87_A 1e8i_A 3cck_A | Back alignment and structure |
|---|
| >1rtm_1 Mannose-binding protein-A; lectin; 1.80A {Rattus norvegicus} SCOP: d.169.1.1 h.1.1.1 PDB: 1kwu_A* 1kwv_A* 1kwt_A* 1kwx_A* 1kwy_A* 1kx1_A* 1kww_A 1kwz_A* 1kx0_A* 3kmb_1* 1kmb_1* 2kmb_1* 4kmb_1* 1afb_1* 1afa_1* 1afd_1 1bch_1* 1bcj_1* 1fif_A 1fih_A* | Back alignment and structure |
|---|
| >2kq2_A Ribonuclease H-related protein; PSI, NESG, protein structure, APO enzyme, structural genomics, protein structure initiative; NMR {Desulfitobacterium hafniense dcb-2} PDB: 2kw4_A | Back alignment and structure |
|---|
| >3ff7_C Killer cell lectin-like receptor subfamily G member 1; KLRG1-cadherin complex, calcium, cell adhesion, cell junction, cell membrane; 1.80A {Homo sapiens} SCOP: d.169.1.0 | Back alignment and structure |
|---|
| >3ff9_A Killer cell lectin-like receptor subfamily G member 1; natural killer cell receptor KLTG1, glycoprotein, membrane, phosphoprotein, signal-anchor; 1.80A {Mus musculus} SCOP: d.169.1.0 PDB: 3ff8_C | Back alignment and structure |
|---|
| >1fm5_A Early activation antigen CD69; C-type lectin-like domain, natural killer cell receptor, lectin, C-type lectin, immune system; 2.27A {Homo sapiens} SCOP: d.169.1.1 | Back alignment and structure |
|---|
| >3qio_A GAG-POL polyprotein; RNAse H, inhibitor, nuclease, transferase, hydrolase- complex; HET: QID; 1.40A {Hiv-1 M} SCOP: c.55.3.1 PDB: 3qin_A* 3hyf_A* 1o1w_A 3lp3_A* 1hrh_A 3k2p_A* 1rdh_A | Back alignment and structure |
|---|
| >2qkb_A Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hybrid; 2.40A {Homo sapiens} PDB: 2qk9_A 2qkk_A* | Back alignment and structure |
|---|
| >1buu_A Protein (mannose-binding protein A); lectin, HOST defense, metalloprotein, sugar binding protein; 1.90A {Rattus norvegicus} SCOP: d.169.1.1 h.1.1.1 | Back alignment and structure |
|---|
| >3h08_A RNH (ribonuclease H); RNAse H, 3D-structure, endonuclease, hydrolase, magnesium, metal-binding; 1.60A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >3c8j_A Natural killer cell receptor LY49C; MHC, virus, immune system; 2.60A {Mus musculus} SCOP: d.169.1.1 PDB: 3c8k_D 1p4l_D 1ja3_A 1p1z_D | Back alignment and structure |
|---|
| >2msb_A Mannose-binding protein-A; lectin; HET: BMA MAN; 1.70A {Rattus rattus} SCOP: d.169.1.1 PDB: 1msb_A 1ytt_A* | Back alignment and structure |
|---|
| >3p1g_A Xenotropic murine leukemia virus-related virus (X H domain; XMRV, RNAse H, reverse transcriptase, transcription; 1.50A {Xenotropic mulv-related virus} PDB: 3v1q_A 3v1o_A 3v1r_A* 2hb5_A 4e89_A | Back alignment and structure |
|---|
| >2e4l_A Ribonuclease HI, RNAse HI; hydrolase, endoribonuclease; 2.00A {Shewanella oneidensis} PDB: 2zqb_A | Back alignment and structure |
|---|
| >1jl1_A Ribonuclease HI; RNAse HI, protein stability, thermostability, hydrogen exchange, cooperativity, hydrolase; 1.30A {Escherichia coli} SCOP: c.55.3.1 PDB: 1f21_A 1jxb_A 1g15_A 1rch_A 1rdd_A 1rnh_A* 2rn2_A 1rda_A 1law_A 1rdb_A 1lav_A 3aa4_A 1rbu_A 1gob_A 1rdc_A 1kvc_A 3aa3_A 3aa2_A 3aa5_X 1rbv_A ... | Back alignment and structure |
|---|
| >3g8l_A Lectin-related NK cell receptor LY49L1; natural killer cell receptor, immune system; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1rdl_1 SUB-MBP-C, mannose-binding protein-C; C-type lectin, calcium-binding protein; HET: MMA; 1.70A {Rattus rattus} SCOP: d.169.1.1 PDB: 1rdj_1* 1rdk_1* 1rdi_1* 1rdm_1* 1rdn_1* 1rdo_1 1bv4_A 1kza_1* 1kzb_1* 1kzc_1* 1kzd_1* 1kze_1* | Back alignment and structure |
|---|
| >1wk1_A Hypothetical protein YK1067A12; lectin C-type domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Caenorhabditis elegans} SCOP: d.169.1.1 | Back alignment and structure |
|---|
| >1pwb_A SP-D, PSP-D, pulmonary surfactant-associated protein D; collectin, C-type lectin, alpha-helical coiled coil, carbohydrate recognition domain; HET: GLC; 1.40A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 PDB: 1pw9_A* 3ikn_A* 3ikp_A* 3ikq_A* 3ikr_A* 2rie_A* 2ggx_A* 2ggu_A* 2ork_A* 2orj_A* 2ria_A* 2rib_A* 2ric_A* 2rid_A* 2os9_A* 3dbz_A 3g81_A* 3g83_A* 1b08_A 3g84_A* ... | Back alignment and structure |
|---|
| >1h8u_A MBP, eosinophil granule major basic protein 1; lectin, eosinophil granule protein, EMBP; 1.8A {Homo sapiens} SCOP: d.169.1.1 PDB: 2brs_A* | Back alignment and structure |
|---|
| >3pbf_A Pulmonary surfactant-associated protein A; collectin, carbohydrate binding, lectin, mannose, sugar BIND protein; 1.80A {Rattus norvegicus} PDB: 1r14_A* 1r13_A* 3paq_A* 3par_A 3pak_A | Back alignment and structure |
|---|
| >1byf_A TC14, protein (polyandrocarpa lectin); C-type lectin, galactose-specific, sugar binding protein; 2.00A {Polyandrocarpa misakiensis} SCOP: d.169.1.1 PDB: 1tlg_A* | Back alignment and structure |
|---|
| >1ril_A Ribonuclease H; hydrolase(endoribonuclease); 2.80A {Thermus thermophilus} SCOP: c.55.3.1 PDB: 2rpi_A | Back alignment and structure |
|---|
| >2lsn_A Reverse transcriptase; RNAse H, viral protein; NMR {Simian foamy virus} | Back alignment and structure |
|---|
| >3hst_B Protein RV2228C/MT2287; ribonuclease H1, RV2228C N-terminal domain, fusion protein, maltose binding protein, HYDR; HET: MLR TAR; 2.25A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3u3g_D Ribonuclease H, RNAse H1; hydrolase, cleave the RNA strand of RNA/DNA hybrid; 1.40A {Uncultured organism} | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >2ehg_A Ribonuclease HI; RNAse HI, hyperthermophilic archaeon, D stranded RNA-dependent RNAse, hydrolase; 1.60A {Sulfolobus tokodaii} PDB: 3aly_A | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >1mu2_A HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase, drug design, transferase; 2.35A {Human immunodeficiency virus 2} SCOP: c.55.3.1 e.8.1.2 PDB: 1mu2_B | Back alignment and structure |
|---|
| >2zd1_A Reverse transcriptase/ribonuclease H; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} PDB: 3is9_A* 3irx_A* 2ze2_A* 3bgr_A* 3qlh_A* 3klf_A* 3qo9_A* 1dlo_A 1bqm_A 2be2_A* 1s6q_A* 1s6p_A* 1s9g_A* 1suq_A* 2b5j_A* 2b6a_A* 2ban_A* 1s9e_A* 1hni_A* 1hnv_A* ... | Back alignment and structure |
|---|
| >1zbf_A Ribonuclease H-related protein; RNAse H, RNA/DNA hybrid, DDE motif, hydrolase; 1.50A {Bacillus halodurans} SCOP: c.55.3.1 PDB: 1zbi_A 2g8u_A 2g8i_A 2g8h_A 2g8k_A 2g8f_A 2g8v_A 2g8w_A 3ey1_A* 1zbl_A 3d0p_A* 3i8d_A* 2r7y_A* | Back alignment and structure |
|---|
| >4htu_A Ribonuclease H, RNAse H; 5-chloro-2'-deoxyuridine, W-C base PAIR, wobble base PAIR, D helix; HET: DNA UCL; 1.49A {Bacillus halodurans} PDB: 3d0p_A* 4hue_A* 4huf_A* 4hug_A* 1zbf_A 1zbi_A 2g8u_A 3uld_A* 3ey1_A* 3twh_A* 2g8f_A 2g8v_A 2g8w_A 2g8i_A 2g8h_A 2g8k_A 3i8d_A* 2r7y_A* 1zbl_A | Back alignment and structure |
|---|
| >3k7b_A Protein A33; C-type lectin-like domain, homodimer, poxvirus, EEV, EV, VIR protein; 2.10A {Vaccinia virus WR} | Back alignment and structure |
|---|
| >3fd4_A Glycoprotein GP42; C type lectin, virus entry, membrane fusion, HOST-virus interaction, lectin, membrane, transmembrane, viral protein; 2.40A {Human herpesvirus 4} PDB: 1kg0_C | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 483 | ||||
| d1xpha1 | 130 | d.169.1.1 (A:265-394) DC-SIGNR (DC-SIGN related re | 1e-09 | |
| d1e87a_ | 117 | d.169.1.1 (A:) CD69 {Human (Homo sapiens) [TaxId: | 1e-09 | |
| d1ypqa1 | 131 | d.169.1.1 (A:140-270) Oxidised low density lipopro | 2e-09 | |
| d1qo3c_ | 133 | d.169.1.1 (C:) NK cell receptor {Mouse (Mus muscul | 7e-09 | |
| d3c8ja1 | 122 | d.169.1.1 (A:138-259) NK cell receptor {Mouse (Mus | 1e-08 | |
| d1uv0a_ | 140 | d.169.1.1 (A:) Pancreatitis-associated protein 1 { | 2e-08 | |
| d1tdqb_ | 126 | d.169.1.1 (B:) Aggrecan core protein {Rat (Rattus | 8e-08 | |
| d1hq8a_ | 123 | d.169.1.1 (A:) NK cell-activating receptor nkg2d { | 8e-08 | |
| d1t8da1 | 143 | d.169.1.1 (A:1-143) Low affinity immunoglobulin ep | 6e-07 | |
| d1dv8a_ | 128 | d.169.1.1 (A:) H1 subunit of the asialoglycoprotei | 7e-07 | |
| d1mu2a1 | 126 | c.55.3.1 (A:430-555) HIV RNase H (Domain of revers | 2e-06 | |
| d1kg0c_ | 136 | d.169.1.1 (C:) EBV gp42 {Epstein-Barr virus [TaxId | 3e-06 | |
| d3bdwa1 | 121 | d.169.1.1 (A:59-179) CD94 {Human (Homo sapiens) [T | 5e-06 | |
| d1gz2a_ | 139 | d.169.1.1 (A:) Ovocleidin-17 {Chicken (Gallus gall | 6e-06 | |
| d1egga_ | 136 | d.169.1.1 (A:) Macrophage mannose receptor, CRD4 { | 9e-06 | |
| d1jzna_ | 135 | d.169.1.1 (A:) Galactose-specific C-type lectin {W | 1e-05 | |
| d1c3ab_ | 125 | d.169.1.1 (B:) Snake coagglutinin beta chain {Habu | 1e-05 | |
| d1wmza_ | 140 | d.169.1.1 (A:) Lectin CEL-I {Cucumaria echinata [T | 2e-05 | |
| d1rila_ | 147 | c.55.3.1 (A:) RNase H (RNase HI) {Thermus thermoph | 2e-05 | |
| d1jwia_ | 124 | d.169.1.1 (A:) Snake coagglutinin alpha chain {Puf | 2e-05 | |
| d1oz7a_ | 131 | d.169.1.1 (A:) Snake coagglutinin alpha chain {Saw | 3e-05 | |
| d1umrc_ | 125 | d.169.1.1 (C:) Snake coagglutinin beta chain {Sout | 3e-05 | |
| d1sb2b1 | 127 | d.169.1.1 (B:2-128) Snake coagglutinin beta chain | 3e-05 | |
| d1jwib_ | 123 | d.169.1.1 (B:) Snake coagglutinin beta chain {Puff | 5e-05 | |
| d2afpa_ | 129 | d.169.1.1 (A:) Type II antifreeze protein {Sea rav | 5e-05 | |
| d1oz7b_ | 123 | d.169.1.1 (B:) Snake coagglutinin beta chain {Saw- | 6e-05 | |
| d1g1ta1 | 118 | d.169.1.1 (A:1-118) E-selectin, C-lectin domain {H | 7e-05 | |
| d1jl1a_ | 152 | c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli | 1e-04 | |
| d1v7pa_ | 134 | d.169.1.1 (A:) Snake coagglutinin alpha chain {Sna | 1e-04 | |
| d1qdda_ | 144 | d.169.1.1 (A:) Lithostathine, inhibitor of stone f | 1e-04 | |
| d1v7pb_ | 127 | d.169.1.1 (B:) Snake coagglutinin beta chain {Snak | 2e-04 | |
| d1j34b_ | 123 | d.169.1.1 (B:) Snake coagglutinin beta chain {Habu | 3e-04 | |
| d1pwba1 | 121 | d.169.1.1 (A:235-355) Surfactant protein, lectin d | 3e-04 | |
| d1wk1a_ | 150 | d.169.1.1 (A:) Hypothetical protein F28B4.3 {Caeno | 4e-04 | |
| d1umra_ | 135 | d.169.1.1 (A:) Snake coagglutinin alpha chain {Sou | 5e-04 | |
| d1fvua_ | 133 | d.169.1.1 (A:) Snake coagglutinin alpha chain {Jar | 7e-04 | |
| d1j34a_ | 129 | d.169.1.1 (A:) Snake coagglutinin alpha chain {Hab | 0.001 | |
| d1g1sa1 | 118 | d.169.1.1 (A:1-118) P-selectin, C-lectin domain {H | 0.001 | |
| d1sb2a1 | 132 | d.169.1.1 (A:1-132) Snake coagglutinin alpha chain | 0.002 | |
| d1s1ta1 | 110 | c.55.3.1 (A:430-539) HIV RNase H (Domain of revers | 0.002 | |
| d1c3aa_ | 135 | d.169.1.1 (A:) Snake coagglutinin alpha chain {Hab | 0.003 | |
| d1tn3a_ | 137 | d.169.1.1 (A:) Tetranectin {Human (Homo sapiens) [ | 0.004 | |
| d1r13a1 | 119 | d.169.1.1 (A:110-228) Surfactant protein, lectin d | 0.004 |
| >d1xpha1 d.169.1.1 (A:265-394) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: C-type lectin-like superfamily: C-type lectin-like family: C-type lectin domain domain: DC-SIGNR (DC-SIGN related receptor) species: Human (Homo sapiens) [TaxId: 9606]
Score = 54.3 bits (129), Expect = 1e-09
Identities = 21/103 (20%), Positives = 40/103 (38%), Gaps = 2/103 (1%)
Query: 28 RCPQHWVQYRDSCYRFVKSPLKTRNDAKLNCKSLDSDLANVNDADEHGFIMYQLFWQDPQ 87
CP+ W ++ +CY S + +D+ C+ + + L + A+E F+ Q +
Sbjct: 3 HCPKDWTFFQGNCYFMSNSQ-RNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRF 61
Query: 88 RRKWYFGGTQQSPNLWVNEDDPQRRKWYFGGTQQSPNLWVNED 130
Q+ WV+ + + + PN NED
Sbjct: 62 SWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGE-PNNSGNED 103
|
| >d1e87a_ d.169.1.1 (A:) CD69 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1ypqa1 d.169.1.1 (A:140-270) Oxidised low density lipoprotein {Human (Homo sapiens) [TaxId: 9606]} Length = 131 | Back information, alignment and structure |
|---|
| >d1qo3c_ d.169.1.1 (C:) NK cell receptor {Mouse (Mus musculus), ly49-a [TaxId: 10090]} Length = 133 | Back information, alignment and structure |
|---|
| >d3c8ja1 d.169.1.1 (A:138-259) NK cell receptor {Mouse (Mus musculus), ly49-c [TaxId: 10090]} Length = 122 | Back information, alignment and structure |
|---|
| >d1uv0a_ d.169.1.1 (A:) Pancreatitis-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
| >d1tdqb_ d.169.1.1 (B:) Aggrecan core protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 | Back information, alignment and structure |
|---|
| >d1hq8a_ d.169.1.1 (A:) NK cell-activating receptor nkg2d {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 | Back information, alignment and structure |
|---|
| >d1t8da1 d.169.1.1 (A:1-143) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 143 | Back information, alignment and structure |
|---|
| >d1dv8a_ d.169.1.1 (A:) H1 subunit of the asialoglycoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1mu2a1 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 2 [TaxId: 11709]} Length = 126 | Back information, alignment and structure |
|---|
| >d1kg0c_ d.169.1.1 (C:) EBV gp42 {Epstein-Barr virus [TaxId: 10376]} Length = 136 | Back information, alignment and structure |
|---|
| >d3bdwa1 d.169.1.1 (A:59-179) CD94 {Human (Homo sapiens) [TaxId: 9606]} Length = 121 | Back information, alignment and structure |
|---|
| >d1gz2a_ d.169.1.1 (A:) Ovocleidin-17 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 139 | Back information, alignment and structure |
|---|
| >d1egga_ d.169.1.1 (A:) Macrophage mannose receptor, CRD4 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 | Back information, alignment and structure |
|---|
| >d1jzna_ d.169.1.1 (A:) Galactose-specific C-type lectin {Western diamondback rattlesnake (Crotalus atrox) [TaxId: 8730]} Length = 135 | Back information, alignment and structure |
|---|
| >d1c3ab_ d.169.1.1 (B:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis), flavocetin-A [TaxId: 88087]} Length = 125 | Back information, alignment and structure |
|---|
| >d1wmza_ d.169.1.1 (A:) Lectin CEL-I {Cucumaria echinata [TaxId: 40245]} Length = 140 | Back information, alignment and structure |
|---|
| >d1rila_ c.55.3.1 (A:) RNase H (RNase HI) {Thermus thermophilus [TaxId: 274]} Length = 147 | Back information, alignment and structure |
|---|
| >d1jwia_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Puff adder (Bitis arietans), bitiscetin [TaxId: 8692]} Length = 124 | Back information, alignment and structure |
|---|
| >d1oz7a_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Saw-scaled viper (Echis carinatus), echicetin [TaxId: 40353]} Length = 131 | Back information, alignment and structure |
|---|
| >d1umrc_ d.169.1.1 (C:) Snake coagglutinin beta chain {South american rattlesnake (Crotalus durissus terrificus), convulxin [TaxId: 8732]} Length = 125 | Back information, alignment and structure |
|---|
| >d1sb2b1 d.169.1.1 (B:2-128) Snake coagglutinin beta chain {Malayan pit viper (Calloselasma rhodostoma), rhodocetin [TaxId: 8717]} Length = 127 | Back information, alignment and structure |
|---|
| >d1jwib_ d.169.1.1 (B:) Snake coagglutinin beta chain {Puff adder (Bitis arietans), bitiscetin [TaxId: 8692]} Length = 123 | Back information, alignment and structure |
|---|
| >d2afpa_ d.169.1.1 (A:) Type II antifreeze protein {Sea raven (Hemitripterus americanus) [TaxId: 8094]} Length = 129 | Back information, alignment and structure |
|---|
| >d1oz7b_ d.169.1.1 (B:) Snake coagglutinin beta chain {Saw-scaled viper (Echis carinatus), echicetin [TaxId: 40353]} Length = 123 | Back information, alignment and structure |
|---|
| >d1g1ta1 d.169.1.1 (A:1-118) E-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1jl1a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]} Length = 152 | Back information, alignment and structure |
|---|
| >d1v7pa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Snake (Echis multisquamatus), Ems16 [TaxId: 93050]} Length = 134 | Back information, alignment and structure |
|---|
| >d1qdda_ d.169.1.1 (A:) Lithostathine, inhibitor of stone formation {Human (Homo sapiens) [TaxId: 9606]} Length = 144 | Back information, alignment and structure |
|---|
| >d1v7pb_ d.169.1.1 (B:) Snake coagglutinin beta chain {Snake (Echis multisquamatus), Ems16 [TaxId: 93050]} Length = 127 | Back information, alignment and structure |
|---|
| >d1j34b_ d.169.1.1 (B:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]} Length = 123 | Back information, alignment and structure |
|---|
| >d1pwba1 d.169.1.1 (A:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]} Length = 121 | Back information, alignment and structure |
|---|
| >d1wk1a_ d.169.1.1 (A:) Hypothetical protein F28B4.3 {Caenorhabditis elegans [TaxId: 6239]} Length = 150 | Back information, alignment and structure |
|---|
| >d1umra_ d.169.1.1 (A:) Snake coagglutinin alpha chain {South american rattlesnake (Crotalus durissus terrificus), convulxin [TaxId: 8732]} Length = 135 | Back information, alignment and structure |
|---|
| >d1fvua_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]} Length = 133 | Back information, alignment and structure |
|---|
| >d1j34a_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]} Length = 129 | Back information, alignment and structure |
|---|
| >d1g1sa1 d.169.1.1 (A:1-118) P-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1sb2a1 d.169.1.1 (A:1-132) Snake coagglutinin alpha chain {Malayan pit viper (Calloselasma rhodostoma), rhodocetin [TaxId: 8717]} Length = 132 | Back information, alignment and structure |
|---|
| >d1s1ta1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]} Length = 110 | Back information, alignment and structure |
|---|
| >d1c3aa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis), flavocetin-A [TaxId: 88087]} Length = 135 | Back information, alignment and structure |
|---|
| >d1tn3a_ d.169.1.1 (A:) Tetranectin {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1r13a1 d.169.1.1 (A:110-228) Surfactant protein, lectin domain {Rat (Rattus norvegicus), SP-A [TaxId: 10116]} Length = 119 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 483 | |||
| d1qdda_ | 144 | Lithostathine, inhibitor of stone formation {Human | 99.92 | |
| d1jzna_ | 135 | Galactose-specific C-type lectin {Western diamondb | 99.92 | |
| d1gz2a_ | 139 | Ovocleidin-17 {Chicken (Gallus gallus) [TaxId: 903 | 99.91 | |
| d1xpha1 | 130 | DC-SIGNR (DC-SIGN related receptor) {Human (Homo s | 99.91 | |
| d1tn3a_ | 137 | Tetranectin {Human (Homo sapiens) [TaxId: 9606]} | 99.91 | |
| d1wmza_ | 140 | Lectin CEL-I {Cucumaria echinata [TaxId: 40245]} | 99.91 | |
| d1uv0a_ | 140 | Pancreatitis-associated protein 1 {Human (Homo sap | 99.9 | |
| d2afpa_ | 129 | Type II antifreeze protein {Sea raven (Hemitripter | 99.9 | |
| d1tdqb_ | 126 | Aggrecan core protein {Rat (Rattus norvegicus) [Ta | 99.9 | |
| d1c3aa_ | 135 | Snake coagglutinin alpha chain {Habu snake (Trimer | 99.9 | |
| d1umra_ | 135 | Snake coagglutinin alpha chain {South american rat | 99.9 | |
| d1dv8a_ | 128 | H1 subunit of the asialoglycoprotein receptor {Hum | 99.9 | |
| d1fvua_ | 133 | Snake coagglutinin alpha chain {Jararaca (Bothrops | 99.89 | |
| d1mu2a1 | 126 | HIV RNase H (Domain of reverse transcriptase) {Hum | 99.89 | |
| d1t8da1 | 143 | Low affinity immunoglobulin epsilon Fc receptor {H | 99.89 | |
| d1ypqa1 | 131 | Oxidised low density lipoprotein {Human (Homo sapi | 99.89 | |
| d1e87a_ | 117 | CD69 {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1egga_ | 136 | Macrophage mannose receptor, CRD4 {Human (Homo sap | 99.89 | |
| d1v7pb_ | 127 | Snake coagglutinin beta chain {Snake (Echis multis | 99.89 | |
| d1j34a_ | 129 | Snake coagglutinin alpha chain {Habu snake (Trimer | 99.89 | |
| d1oz7a_ | 131 | Snake coagglutinin alpha chain {Saw-scaled viper ( | 99.89 | |
| d1hq8a_ | 123 | NK cell-activating receptor nkg2d {Mouse (Mus musc | 99.89 | |
| d1oz7b_ | 123 | Snake coagglutinin beta chain {Saw-scaled viper (E | 99.89 | |
| d1sb2b1 | 127 | Snake coagglutinin beta chain {Malayan pit viper ( | 99.89 | |
| d1jwia_ | 124 | Snake coagglutinin alpha chain {Puff adder (Bitis | 99.88 | |
| d3bdwa1 | 121 | CD94 {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d1sb2a1 | 132 | Snake coagglutinin alpha chain {Malayan pit viper | 99.88 | |
| d1v7pa_ | 134 | Snake coagglutinin alpha chain {Snake (Echis multi | 99.88 | |
| d1j34b_ | 123 | Snake coagglutinin beta chain {Habu snake (Trimere | 99.88 | |
| d1umrc_ | 125 | Snake coagglutinin beta chain {South american ratt | 99.88 | |
| d1c3ab_ | 125 | Snake coagglutinin beta chain {Habu snake (Trimere | 99.88 | |
| d1fvub_ | 125 | Snake coagglutinin beta chain {Jararaca (Bothrops | 99.88 | |
| d1jwib_ | 123 | Snake coagglutinin beta chain {Puff adder (Bitis a | 99.87 | |
| d3c8ja1 | 122 | NK cell receptor {Mouse (Mus musculus), ly49-c [Ta | 99.87 | |
| d1qo3c_ | 133 | NK cell receptor {Mouse (Mus musculus), ly49-a [Ta | 99.87 | |
| d1pwba1 | 121 | Surfactant protein, lectin domain {Human (Homo sap | 99.85 | |
| d2msba_ | 112 | Mannose-binding protein A, C-lectin domain {Rat (R | 99.85 | |
| d1jl1a_ | 152 | RNase H (RNase HI) {Escherichia coli [TaxId: 562]} | 99.84 | |
| d1r13a1 | 119 | Surfactant protein, lectin domain {Rat (Rattus nor | 99.84 | |
| d1rila_ | 147 | RNase H (RNase HI) {Thermus thermophilus [TaxId: 2 | 99.84 | |
| d1hupa1 | 117 | Mannose-binding protein A, C-lectin domain {Human | 99.84 | |
| d1rdl1_ | 111 | Mannose-binding protein A, C-lectin domain {Rat (R | 99.82 | |
| d1h8ua_ | 115 | Eosinophil major basic protein {Human (Homo sapien | 99.81 | |
| d1kg0c_ | 136 | EBV gp42 {Epstein-Barr virus [TaxId: 10376]} | 99.77 | |
| d1wk1a_ | 150 | Hypothetical protein F28B4.3 {Caenorhabditis elega | 99.77 | |
| d1g1ta1 | 118 | E-selectin, C-lectin domain {Human (Homo sapiens) | 99.72 | |
| d1s1ta1 | 110 | HIV RNase H (Domain of reverse transcriptase) {Hum | 99.71 | |
| d1byfa_ | 123 | Lectin TC14 {Tunicate (Polyandrocarpa misakiensis) | 99.7 | |
| d1g1sa1 | 118 | P-selectin, C-lectin domain {Human (Homo sapiens) | 99.7 | |
| d1zbfa1 | 132 | BH0863-like Ribonuclease H {Bacillus halodurans [T | 99.57 |
| >d1qdda_ d.169.1.1 (A:) Lithostathine, inhibitor of stone formation {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: C-type lectin-like superfamily: C-type lectin-like family: C-type lectin domain domain: Lithostathine, inhibitor of stone formation species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92 E-value=1.3e-25 Score=194.23 Aligned_cols=131 Identities=18% Similarity=0.363 Sum_probs=113.6
Q ss_pred cCCCcccccccCCeEEEEecCCCCCHHHHHHHhhhc-CCcccccCCHhHHHHHHHHhhhcCCCCCceeeecccCCCCccc
Q psy14885 26 ELRCPQHWVQYRDSCYRFVKSPLKTRNDAKLNCKSL-DSDLANVNDADEHGFIMYQLFWQDPQRRKWYFGGTQQSPNLWV 104 (483)
Q Consensus 26 ~~~C~~gw~~~~~~Cy~~~~~~~~tw~~A~~~C~~~-g~~L~~i~s~~e~~~l~~~~~~~~~~~~~~wig~~~~~~~~Wi 104 (483)
..+||+||+.|++.||+++... ++|.+|+..|++. ||+||+|++++|++||..++.........||||++...
T Consensus 11 ~~~Cp~gw~~~~~~CY~~~~~~-~~w~~A~~~C~~~~gg~L~~i~s~~e~~~l~~~l~~~~~~~~~~WiGl~~~~----- 84 (144)
T d1qdda_ 11 RISCPEGTNAYRSYCYYFNEDR-ETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPK----- 84 (144)
T ss_dssp GTSCCTTCEEETTEEEEEEEEE-ECHHHHHHHHHHTTSCEECCCCSHHHHHHHHHHHHHTTCCCSEEEEEEECTT-----
T ss_pred CCcCCCCCEEECCEEEEEECCc-cCHHHHHHHHHhccccccceEEeeecchhhhhccccccccccceeeeeeccc-----
Confidence 4579999999999999999995 9999999999986 78999999999999999999877555566777776533
Q ss_pred ccCcccccccccCCcCCCCCccccCCCCccccccccCCC-CCCCcccCCeEEEecccccccccccccCCCCceeeeeecc
Q psy14885 105 NEDDPQRRKWYFGGTQQSPNLWVNEDGTNLNELDAAFLP-EPADNVQRDYLAYSFSQSLKRWGFERVTGMEPLLFICEAS 183 (483)
Q Consensus 105 g~~~~~~~~w~~~g~~~~~~~~~W~dg~~~~~~~~~w~~-~P~~~~~~~Cv~~~~~~~~~~W~~~~C~~~~~~~fvCe~~ 183 (483)
..+.|.|+||+++.+ .+|.+ +|++...++|+.+....+..+|.+.+|+ ..++||||++
T Consensus 85 -----------------~~~~w~W~dGs~~~y--~~W~~~~P~~~~~~~C~~~~~~~~~~~W~~~~C~--~~~~fICe~k 143 (144)
T d1qdda_ 85 -----------------KNRAWHWSSGSLVSY--KSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCE--DKFSFVCKFK 143 (144)
T ss_dssp -----------------SSSCCEETTCCCCCC--CCBCTTCSCSSSCCSEEEEEGGGTTCSEEEECTT--SCEEEEEEEE
T ss_pred -----------------ccceeEecCCCeeec--ccccCCCCCCCCCccEEEEEccCCCCcEEecCCC--CCeEEEEEEC
Confidence 457899999998876 78999 9988777899999877665679999999 9999999985
|
| >d1jzna_ d.169.1.1 (A:) Galactose-specific C-type lectin {Western diamondback rattlesnake (Crotalus atrox) [TaxId: 8730]} | Back information, alignment and structure |
|---|
| >d1gz2a_ d.169.1.1 (A:) Ovocleidin-17 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1xpha1 d.169.1.1 (A:265-394) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tn3a_ d.169.1.1 (A:) Tetranectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmza_ d.169.1.1 (A:) Lectin CEL-I {Cucumaria echinata [TaxId: 40245]} | Back information, alignment and structure |
|---|
| >d1uv0a_ d.169.1.1 (A:) Pancreatitis-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2afpa_ d.169.1.1 (A:) Type II antifreeze protein {Sea raven (Hemitripterus americanus) [TaxId: 8094]} | Back information, alignment and structure |
|---|
| >d1tdqb_ d.169.1.1 (B:) Aggrecan core protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1c3aa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis), flavocetin-A [TaxId: 88087]} | Back information, alignment and structure |
|---|
| >d1umra_ d.169.1.1 (A:) Snake coagglutinin alpha chain {South american rattlesnake (Crotalus durissus terrificus), convulxin [TaxId: 8732]} | Back information, alignment and structure |
|---|
| >d1dv8a_ d.169.1.1 (A:) H1 subunit of the asialoglycoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fvua_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]} | Back information, alignment and structure |
|---|
| >d1mu2a1 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 2 [TaxId: 11709]} | Back information, alignment and structure |
|---|
| >d1t8da1 d.169.1.1 (A:1-143) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ypqa1 d.169.1.1 (A:140-270) Oxidised low density lipoprotein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e87a_ d.169.1.1 (A:) CD69 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1egga_ d.169.1.1 (A:) Macrophage mannose receptor, CRD4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v7pb_ d.169.1.1 (B:) Snake coagglutinin beta chain {Snake (Echis multisquamatus), Ems16 [TaxId: 93050]} | Back information, alignment and structure |
|---|
| >d1j34a_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]} | Back information, alignment and structure |
|---|
| >d1oz7a_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Saw-scaled viper (Echis carinatus), echicetin [TaxId: 40353]} | Back information, alignment and structure |
|---|
| >d1hq8a_ d.169.1.1 (A:) NK cell-activating receptor nkg2d {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oz7b_ d.169.1.1 (B:) Snake coagglutinin beta chain {Saw-scaled viper (Echis carinatus), echicetin [TaxId: 40353]} | Back information, alignment and structure |
|---|
| >d1sb2b1 d.169.1.1 (B:2-128) Snake coagglutinin beta chain {Malayan pit viper (Calloselasma rhodostoma), rhodocetin [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1jwia_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Puff adder (Bitis arietans), bitiscetin [TaxId: 8692]} | Back information, alignment and structure |
|---|
| >d3bdwa1 d.169.1.1 (A:59-179) CD94 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sb2a1 d.169.1.1 (A:1-132) Snake coagglutinin alpha chain {Malayan pit viper (Calloselasma rhodostoma), rhodocetin [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1v7pa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Snake (Echis multisquamatus), Ems16 [TaxId: 93050]} | Back information, alignment and structure |
|---|
| >d1j34b_ d.169.1.1 (B:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]} | Back information, alignment and structure |
|---|
| >d1umrc_ d.169.1.1 (C:) Snake coagglutinin beta chain {South american rattlesnake (Crotalus durissus terrificus), convulxin [TaxId: 8732]} | Back information, alignment and structure |
|---|
| >d1c3ab_ d.169.1.1 (B:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis), flavocetin-A [TaxId: 88087]} | Back information, alignment and structure |
|---|
| >d1fvub_ d.169.1.1 (B:) Snake coagglutinin beta chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]} | Back information, alignment and structure |
|---|
| >d1jwib_ d.169.1.1 (B:) Snake coagglutinin beta chain {Puff adder (Bitis arietans), bitiscetin [TaxId: 8692]} | Back information, alignment and structure |
|---|
| >d3c8ja1 d.169.1.1 (A:138-259) NK cell receptor {Mouse (Mus musculus), ly49-c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qo3c_ d.169.1.1 (C:) NK cell receptor {Mouse (Mus musculus), ly49-a [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pwba1 d.169.1.1 (A:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2msba_ d.169.1.1 (A:) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jl1a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r13a1 d.169.1.1 (A:110-228) Surfactant protein, lectin domain {Rat (Rattus norvegicus), SP-A [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rila_ c.55.3.1 (A:) RNase H (RNase HI) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hupa1 d.169.1.1 (A:112-228) Mannose-binding protein A, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rdl1_ d.169.1.1 (1:) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1h8ua_ d.169.1.1 (A:) Eosinophil major basic protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kg0c_ d.169.1.1 (C:) EBV gp42 {Epstein-Barr virus [TaxId: 10376]} | Back information, alignment and structure |
|---|
| >d1wk1a_ d.169.1.1 (A:) Hypothetical protein F28B4.3 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1g1ta1 d.169.1.1 (A:1-118) E-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s1ta1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d1byfa_ d.169.1.1 (A:) Lectin TC14 {Tunicate (Polyandrocarpa misakiensis) [TaxId: 7723]} | Back information, alignment and structure |
|---|
| >d1g1sa1 d.169.1.1 (A:1-118) P-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zbfa1 c.55.3.1 (A:62-193) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|