Psyllid ID: psy14887


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MPQVAPQGVFSRGFNSTAINVTWNPIELIRENIRGRLIGHRIKYWKEDNPEETAVYYLSRTTRNWALIVGLQPDTKYYVKVMAYNNAGEGPESERYLERTYRKAPQKPPSAVHIKGINPTTVHVTWRYVSPSFEEEPIIGYKVRVWEVDQDMSRANDTIIPVGNTLDADIVDLSPGKRYHMRVLAFSNGGDGRMSSPAITFQMGEEKEFKSGSPALYSASTTLLLVMSSTLYIFVAFS
ccccccccEEEEEccccEEEEEEEcccccccccccEEEEEEEEEEEcccccccEEEEEccccccEEEEcccccccEEEEEEEEEcccccccccccEEEEccccccccccccEEEEEEcccEEEEEEEccccccccccEEEEEEEEEEccccccccccEEEEcccEEEEEEcccccccEEEEEEEEEccccccccccccEEEEccccccccccccEEEEcccEEEEEEcccEEEEEEEc
ccccccccEEEEEccccEEEEEEcccccccccccccEEEEEEEEEEcccccccEEEEEccccccEEEEcccccccEEEEEEEEEEccccccccccEEEEccccccccccccEEEEEccccEEEEEEcccccccccccEEEEEEEEEEccccccccEEEEEcccccEEEEEEccccccEEEEEEEEEEccccccccccEEEEccccccccccccEEEEEcccEEEEEEccccEEEEEEc
mpqvapqgvfsrgfnstainvtwnpIELIRENIRGRLIGHRIKywkednpeeTAVYYLSRTTRNWALIVGLQPDTKYYVKVMAYnnagegpeserYLERTyrkapqkppsavhikginpttVHVTWryvspsfeeepiigyKVRVWEVdqdmsrandtiipvgntldadivdlspgkryhMRVLAFsnggdgrmsspaitfqmgeekefksgspalysASTTLLLVMSSTLYIFVAFS
mpqvapqgvfsrgfnstainvtwnpieliRENIRGRLIGHrikywkednpeETAVYYLSRTTRNWALIVGLQPDTKYYVKVMAYNnagegpesERYLERTYRKapqkppsavhikginpttvHVTWRYVSpsfeeepiigYKVRVWEVDQDMSRAndtiipvgntldaDIVDLSPGKRYHMRVLAfsnggdgrmSSPAITFQMGEEKEFKSGSPALYSASTTLLLVMSSTLYIFVAFS
MPQVAPQGVFSRGFNSTAINVTWNPIELIRENIRGRLIGHRIKYWKEDNPEETAVYYLSRTTRNWALIVGLQPDTKYYVKVMAYNNAGEGPESERYLERTYRKAPQKPPSAVHIKGINPTTVHVTWRYVSPSFEEEPIIGYKVRVWEVDQDMSRANDTIIPVGNTLDADIVDLSPGKRYHMRVLAFSNGGDGRMSSPAITFQMGEEKEFKSGSPALYsasttlllvmsstlYIFVAFS
********VFSRGFNSTAINVTWNPIELIRENIRGRLIGHRIKYWKEDNPEETAVYYLSRTTRNWALIVGLQPDTKYYVKVMAYNN*************************VHIKGINPTTVHVTWRYVSPSFEEEPIIGYKVRVWEVDQDMSRANDTIIPVGNTLDADIVDLSPGKRYHMRVLAFS****************************LYSASTTLLLVMSSTLYIFVAF*
MPQVAPQGVFSRGFNSTAINVTWNPIELIRENIRGRLIGHRIKYWK***************TRNWALIVGLQPDTKYYVKVMAYNNAGEGPESERYLERTYRKAPQKPPSAVHIKGINPTTVHVTWRYVSPSFEEEPIIGYKVRVWEVDQ***********VGNTLDADIVDLSPGKRYHMRVLAFSNGGDGRMSSPA********************ASTTLLLVMSSTLYIFVAFS
MPQVAPQGVFSRGFNSTAINVTWNPIELIRENIRGRLIGHRIKYWKEDNPEETAVYYLSRTTRNWALIVGLQPDTKYYVKVMAYNNAGE*********************AVHIKGINPTTVHVTWRYVSPSFEEEPIIGYKVRVWEVDQDMSRANDTIIPVGNTLDADIVDLSPGKRYHMRVLAFSNGGDGRMSSPAITFQMGEEKEFKSGSPALYSASTTLLLVMSSTLYIFVAFS
**QVAPQGVFSRGFNSTAINVTWNPIELIRENIRGRLIGHRIKYWKEDNPEETAVYYLSRTTRNWALIVGLQPDTKYYVKVMAYNNAGEGPESERYLERTYRKAPQKPPSAVHIKGINPTTVHVTWRYVSPSFEEEPIIGYKVRVWEVDQDMSRANDTIIPVGNTLDADIVDLSPGKRYHMRVLAFSNGGDGRMSSPAITFQMGEEKEFKSGSPALYSASTTLLLVMSSTLYIFVAFS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHi
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHi
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPQVAPQGVFSRGFNSTAINVTWNPIELIRENIRGRLIGHRIKYWKEDNPEETAVYYLSRTTRNWALIVGLQPDTKYYVKVMAYNNAGEGPESERYLERTYRKAPQKPPSAVHIKGINPTTVHVTWRYVSPSFEEEPIIGYKVRVWEVDQDMSRANDTIIPVGNTLDADIVDLSPGKRYHMRVLAFSNGGDGRMSSPAITFQMGEEKEFKSGSPALYSASTTLLLVMSSTLYIFVAFS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query238 2.2.26 [Sep-21-2011]
Q9VN141390 Contactin OS=Drosophila m yes N/A 0.806 0.138 0.712 3e-86
Q022461040 Contactin-2 OS=Homo sapie yes N/A 0.579 0.132 0.345 2e-17
Q64605 1907 Receptor-type tyrosine-pr yes N/A 0.840 0.104 0.304 5e-17
B0V2N1 1907 Receptor-type tyrosine-pr yes N/A 0.840 0.104 0.304 5e-17
Q8AV58 2169 Protein sidekick-1 OS=Gal yes N/A 0.827 0.090 0.305 7e-17
P975271099 Contactin-5 OS=Rattus nor yes N/A 0.899 0.194 0.304 9e-17
A2A8L5 1898 Receptor-type tyrosine-pr no N/A 0.903 0.113 0.287 3e-16
Q64604 1898 Receptor-type tyrosine-pr no N/A 0.903 0.113 0.287 3e-16
Q613301040 Contactin-2 OS=Mus muscul no N/A 0.579 0.132 0.338 5e-16
P220631040 Contactin-2 OS=Rattus nor no N/A 0.579 0.132 0.338 7e-16
>sp|Q9VN14|CONT_DROME Contactin OS=Drosophila melanogaster GN=Cont PE=1 SV=2 Back     alignment and function desciption
 Score =  317 bits (813), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 174/205 (84%)

Query: 1    MPQVAPQGVFSRGFNSTAINVTWNPIELIRENIRGRLIGHRIKYWKEDNPEETAVYYLSR 60
            MPQVAPQ   +  +NST  NVTW PI++ RENIRG+LIGHR+KYWK  + EE +VYYLSR
Sbjct: 1152 MPQVAPQKPIALAYNSTCFNVTWQPIDMSRENIRGKLIGHRLKYWKTTHQEEDSVYYLSR 1211

Query: 61   TTRNWALIVGLQPDTKYYVKVMAYNNAGEGPESERYLERTYRKAPQKPPSAVHIKGINPT 120
            TTRNWALIVGLQPDT Y+VKVMAYN AGEGPESER+ ERTYRKAPQKPPS+VH+ GINP+
Sbjct: 1212 TTRNWALIVGLQPDTYYFVKVMAYNAAGEGPESERFEERTYRKAPQKPPSSVHVYGINPS 1271

Query: 121  TVHVTWRYVSPSFEEEPIIGYKVRVWEVDQDMSRANDTIIPVGNTLDADIVDLSPGKRYH 180
            TV V WRYVSPS +EEP+ GYKVR+WE DQ+M  AN+TI+P+G  L++ I +L+PGK Y+
Sbjct: 1272 TVRVVWRYVSPSQDEEPVEGYKVRIWESDQNMITANNTIVPIGQKLESYINNLTPGKSYN 1331

Query: 181  MRVLAFSNGGDGRMSSPAITFQMGE 205
            MRVLA+SNGGDGRMSSP + FQMG+
Sbjct: 1332 MRVLAYSNGGDGRMSSPTLHFQMGK 1356




Required for organization of septate junctions and paracellular barrier functions. Septate junctions, which are the equivalent of vertebrates tight junctions, are characterized by regular arrays of transverse structures that span the intermembrane space and form a physical barrier to diffusion.
Drosophila melanogaster (taxid: 7227)
>sp|Q02246|CNTN2_HUMAN Contactin-2 OS=Homo sapiens GN=CNTN2 PE=1 SV=1 Back     alignment and function description
>sp|Q64605|PTPRS_RAT Receptor-type tyrosine-protein phosphatase S OS=Rattus norvegicus GN=Ptprs PE=1 SV=2 Back     alignment and function description
>sp|B0V2N1|PTPRS_MOUSE Receptor-type tyrosine-protein phosphatase S OS=Mus musculus GN=Ptprs PE=1 SV=1 Back     alignment and function description
>sp|Q8AV58|SDK1_CHICK Protein sidekick-1 OS=Gallus gallus GN=SDK1 PE=2 SV=1 Back     alignment and function description
>sp|P97527|CNTN5_RAT Contactin-5 OS=Rattus norvegicus GN=Cntn5 PE=1 SV=1 Back     alignment and function description
>sp|A2A8L5|PTPRF_MOUSE Receptor-type tyrosine-protein phosphatase F OS=Mus musculus GN=Ptprf PE=1 SV=1 Back     alignment and function description
>sp|Q64604|PTPRF_RAT Receptor-type tyrosine-protein phosphatase F OS=Rattus norvegicus GN=Ptprf PE=2 SV=1 Back     alignment and function description
>sp|Q61330|CNTN2_MOUSE Contactin-2 OS=Mus musculus GN=Cntn2 PE=2 SV=2 Back     alignment and function description
>sp|P22063|CNTN2_RAT Contactin-2 OS=Rattus norvegicus GN=Cntn2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query238
307183641 1156 Contactin [Camponotus floridanus] 0.978 0.201 0.707 3e-93
328787872 1641 PREDICTED: contactin-like [Apis mellifer 0.810 0.117 0.741 4e-92
383850888 1650 PREDICTED: contactin-like [Megachile rot 0.915 0.132 0.718 5e-92
380021534 1641 PREDICTED: contactin-like [Apis florea] 0.810 0.117 0.737 7e-92
350420740 1813 PREDICTED: contactin-like [Bombus impati 0.827 0.108 0.737 1e-91
340724306 1642 PREDICTED: contactin-like [Bombus terres 0.827 0.119 0.737 1e-91
307210402 1647 Contactin [Harpegnathos saltator] 0.915 0.132 0.705 4e-90
357617701 671 contactin [Danaus plexippus] 0.777 0.275 0.731 6e-89
195113137 1424 GI10608 [Drosophila mojavensis] gi|19391 0.987 0.165 0.658 6e-88
242009529 1266 Contactin precursor, putative [Pediculus 0.953 0.179 0.684 8e-88
>gi|307183641|gb|EFN70344.1| Contactin [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  347 bits (889), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 167/236 (70%), Positives = 194/236 (82%), Gaps = 3/236 (1%)

Query: 1    MPQVAPQGVFSRGFNSTAINVTWNPIELIRENIRGRLIGHRIKYWKEDNPEETAVYYLSR 60
            MPQVAPQ V+S  +NST++N+TW PIE  RE +RG+LIGHRIKYWKE  PEE A YYLSR
Sbjct: 921  MPQVAPQQVYSMSYNSTSLNITWQPIEQTRERVRGKLIGHRIKYWKESVPEEHATYYLSR 980

Query: 61   TTRNWALIVGLQPDTKYYVKVMAYNNAGEGPESERYLERTYRKAPQKPPSAVHIKGINPT 120
            TTR W+L+VGLQPDT YYVKVMAYN+AGEGPESERYLERTYRKAPQKPPS+V++ G+NP+
Sbjct: 981  TTRPWSLVVGLQPDTYYYVKVMAYNSAGEGPESERYLERTYRKAPQKPPSSVNVYGVNPS 1040

Query: 121  TVHVTWRYVSPSFEEEPIIGYKVRVWEVDQDMSRANDTIIPVGNTLDADIVDLSPGKRYH 180
            TV V WRYV PS EEEP+IGYK+R+WEVDQDMS ANDTIIP G+ L+ADI +LSPGK YH
Sbjct: 1041 TVRVVWRYVQPSLEEEPLIGYKIRIWEVDQDMSTANDTIIPGGSKLEADIRNLSPGKAYH 1100

Query: 181  MRVLAFSNGGDGRMSSPAITFQMGEEKEFKS--GSPALYSA-STTLLLVMSSTLYI 233
            +RVLAFSNGGDGRMSSP  TFQMG+   F+S  G+  L +A   T LL +    YI
Sbjct: 1101 LRVLAFSNGGDGRMSSPTHTFQMGDAAAFRSSAGNKILDAALGITFLLFLRVFDYI 1156




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328787872|ref|XP_003251020.1| PREDICTED: contactin-like [Apis mellifera] Back     alignment and taxonomy information
>gi|383850888|ref|XP_003701006.1| PREDICTED: contactin-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380021534|ref|XP_003694618.1| PREDICTED: contactin-like [Apis florea] Back     alignment and taxonomy information
>gi|350420740|ref|XP_003492608.1| PREDICTED: contactin-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340724306|ref|XP_003400523.1| PREDICTED: contactin-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307210402|gb|EFN86967.1| Contactin [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|357617701|gb|EHJ70941.1| contactin [Danaus plexippus] Back     alignment and taxonomy information
>gi|195113137|ref|XP_002001125.1| GI10608 [Drosophila mojavensis] gi|193917719|gb|EDW16586.1| GI10608 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|242009529|ref|XP_002425536.1| Contactin precursor, putative [Pediculus humanus corporis] gi|212509411|gb|EEB12798.1| Contactin precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query238
FB|FBgn00372401390 Cont "Contactin" [Drosophila m 0.861 0.147 0.712 2.6e-79
UNIPROTKB|E2RJ851013 CNTN2 "Uncharacterized protein 0.579 0.136 0.359 3.8e-20
MGI|MGI:97815 1907 Ptprs "protein tyrosine phosph 0.840 0.104 0.304 1e-18
RGD|3452 1907 Ptprs "protein tyrosine phosph 0.840 0.104 0.304 1e-18
UNIPROTKB|Q022461040 CNTN2 "Contactin-2" [Homo sapi 0.579 0.132 0.345 1.2e-18
ZFIN|ZDB-GENE-990630-121040 cntn2 "contactin 2" [Danio rer 0.584 0.133 0.352 2.6e-18
UNIPROTKB|Q8AV58 2169 SDK1 "Protein sidekick-1" [Gal 0.827 0.090 0.3 4e-18
UNIPROTKB|H0Y6Z7 1553 PTPRF "Receptor-type tyrosine- 0.819 0.125 0.316 4.4e-18
ZFIN|ZDB-GENE-020107-3 1902 ptprsa "protein tyrosine phosp 0.844 0.105 0.297 5.6e-18
MGI|MGI:2444413 2193 Sdk1 "sidekick homolog 1 (chic 0.827 0.089 0.292 6.6e-18
FB|FBgn0037240 Cont "Contactin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 806 (288.8 bits), Expect = 2.6e-79, P = 2.6e-79
 Identities = 146/205 (71%), Positives = 174/205 (84%)

Query:     1 MPQVAPQGVFSRGFNSTAINVTWNPIELIRENIRGRLIGHRIKYWKEDNPEETAVYYLSR 60
             MPQVAPQ   +  +NST  NVTW PI++ RENIRG+LIGHR+KYWK  + EE +VYYLSR
Sbjct:  1152 MPQVAPQKPIALAYNSTCFNVTWQPIDMSRENIRGKLIGHRLKYWKTTHQEEDSVYYLSR 1211

Query:    61 TTRNWALIVGLQPDTKYYVKVMAYNNAGEGPESERYLERTYRKAPQKPPSAVHIKGINPT 120
             TTRNWALIVGLQPDT Y+VKVMAYN AGEGPESER+ ERTYRKAPQKPPS+VH+ GINP+
Sbjct:  1212 TTRNWALIVGLQPDTYYFVKVMAYNAAGEGPESERFEERTYRKAPQKPPSSVHVYGINPS 1271

Query:   121 TVHVTWRYVSPSFEEEPIIGYKVRVWEVDQDMSRANDTIIPVGNTLDADIVDLSPGKRYH 180
             TV V WRYVSPS +EEP+ GYKVR+WE DQ+M  AN+TI+P+G  L++ I +L+PGK Y+
Sbjct:  1272 TVRVVWRYVSPSQDEEPVEGYKVRIWESDQNMITANNTIVPIGQKLESYINNLTPGKSYN 1331

Query:   181 MRVLAFSNGGDGRMSSPAITFQMGE 205
             MRVLA+SNGGDGRMSSP + FQMG+
Sbjct:  1332 MRVLAYSNGGDGRMSSPTLHFQMGK 1356


GO:0007155 "cell adhesion" evidence=ISS
GO:0005918 "septate junction" evidence=IDA;NAS
GO:0030246 "carbohydrate binding" evidence=IEA
GO:0019991 "septate junction assembly" evidence=IMP
GO:0005919 "pleated septate junction" evidence=IDA
GO:0045197 "establishment or maintenance of epithelial cell apical/basal polarity" evidence=IC
GO:0021682 "nerve maturation" evidence=IMP
GO:0008366 "axon ensheathment" evidence=IMP
GO:0060857 "establishment of glial blood-brain barrier" evidence=IMP
GO:0005886 "plasma membrane" evidence=IDA
UNIPROTKB|E2RJ85 CNTN2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:97815 Ptprs "protein tyrosine phosphatase, receptor type, S" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3452 Ptprs "protein tyrosine phosphatase, receptor type, S" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q02246 CNTN2 "Contactin-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990630-12 cntn2 "contactin 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q8AV58 SDK1 "Protein sidekick-1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y6Z7 PTPRF "Receptor-type tyrosine-protein phosphatase F" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-020107-3 ptprsa "protein tyrosine phosphatase, receptor type, s, a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2444413 Sdk1 "sidekick homolog 1 (chicken)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9VN14CONT_DROMENo assigned EC number0.71210.80670.1381yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query238
pfam0004184 pfam00041, fn3, Fibronectin type III domain 1e-13
pfam0004184 pfam00041, fn3, Fibronectin type III domain 2e-12
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 6e-12
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 5e-10
smart0006083 smart00060, FN3, Fibronectin type 3 domain 5e-10
smart0006083 smart00060, FN3, Fibronectin type 3 domain 3e-09
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
 Score = 64.4 bits (157), Expect = 1e-13
 Identities = 24/88 (27%), Positives = 40/88 (45%), Gaps = 5/88 (5%)

Query: 108 PPSAVHIKGINPTTVHVTWRYVSPSFEEEPIIGYKVRVWEVDQDMSRANDTIIPVGNTLD 167
            P+ + +  +  T++ ++W   SP     PI GY+V    V+       +  +P G T  
Sbjct: 2   APTNLTVTDVTSTSLTLSW---SPPPGNGPITGYEVEYRPVN-GGEEWKEITVP-GTTTS 56

Query: 168 ADIVDLSPGKRYHMRVLAFSNGGDGRMS 195
             +  L PG  Y +RV A +  G+G  S
Sbjct: 57  YTLTGLKPGTEYEVRVQAVNGAGEGPPS 84


Length = 84

>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 238
KOG4221|consensus 1381 99.95
KOG3513|consensus 1051 99.94
KOG0196|consensus 996 99.93
KOG3513|consensus 1051 99.93
KOG4221|consensus 1381 99.88
KOG4222|consensus 1281 99.62
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 99.52
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 99.46
KOG4222|consensus 1281 99.3
KOG4258|consensus1025 99.29
KOG4802|consensus 516 99.04
cd0006393 FN3 Fibronectin type 3 domain; One of three types 99.0
cd0006393 FN3 Fibronectin type 3 domain; One of three types 98.91
KOG0196|consensus 996 98.88
smart0006083 FN3 Fibronectin type 3 domain. One of three types 98.77
KOG4258|consensus 1025 98.64
smart0006083 FN3 Fibronectin type 3 domain. One of three types 98.49
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 98.1
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 97.87
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 97.85
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 97.78
KOG4367|consensus 699 97.77
KOG4152|consensus830 97.48
KOG3632|consensus 1335 97.3
PF09067104 EpoR_lig-bind: Erythropoietin receptor, ligand bin 97.12
KOG4367|consensus699 96.83
PF10179 300 DUF2369: Uncharacterised conserved protein (DUF236 96.75
COG3401343 Fibronectin type 3 domain-containing protein [Gene 96.62
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 96.59
PF09067104 EpoR_lig-bind: Erythropoietin receptor, ligand bin 96.54
KOG4802|consensus 516 96.03
PF0924099 IL6Ra-bind: Interleukin-6 receptor alpha chain, bi 95.34
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 95.24
KOG3632|consensus 1335 95.09
PLN02533 427 probable purple acid phosphatase 94.63
COG4733 952 Phage-related protein, tail component [Function un 93.76
COG3401 343 Fibronectin type 3 domain-containing protein [Gene 92.83
KOG4806|consensus454 92.75
PF0924099 IL6Ra-bind: Interleukin-6 receptor alpha chain, bi 92.18
KOG1225|consensus525 92.09
PLN02533 427 probable purple acid phosphatase 91.68
PF07353184 Uroplakin_II: Uroplakin II; InterPro: IPR009952 Th 89.21
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 89.06
KOG4152|consensus 830 88.29
KOG0613|consensus 1205 87.96
TIGR00868863 hCaCC calcium-activated chloride channel protein 1 86.76
KOG1948|consensus1165 86.46
PF14292122 SusE: SusE outer membrane protein 80.19
>KOG4221|consensus Back     alignment and domain information
Probab=99.95  E-value=1.8e-26  Score=191.48  Aligned_cols=204  Identities=25%  Similarity=0.410  Sum_probs=169.2

Q ss_pred             CCCCCcceEEeeeccceEEEEeeecccccccccceeeEEEEEEEeeCCCcCceEEEeeccccceEEEecCCCCCEEEEEE
Q psy14887          2 PQVAPQGVFSRGFNSTAINVTWNPIELIRENIRGRLIGHRIKYWKEDNPEETAVYYLSRTTRNWALIVGLQPDTKYYVKV   81 (238)
Q Consensus         2 pp~~P~~~~~~~~~~~~~~l~W~~~~~~~~~~~~~i~~y~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~p~~~Y~~~v   81 (238)
                      ||.+|..+++.+.+...+.+.|++|    ...++++++|++.|... +...+   .....+..+++|+||++++.|.++|
T Consensus       520 ~pEgp~~~~a~ats~~ti~v~WepP----~~~n~~I~~yk~~ys~~-~~~~~---~~~~~n~~e~ti~gL~k~TeY~~~v  591 (1381)
T KOG4221|consen  520 QPEGPVQLQAYATSPTTILVTWEPP----PFGNGPITGYKLFYSED-DTGKE---LRVENNATEYTINGLEKYTEYSIRV  591 (1381)
T ss_pred             CCCCCccccccccCcceEEEEecCC----CCCCCCceEEEEEEEcC-CCCce---EEEecCccEEEeecCCCccceEEEE
Confidence            4556666888888999999999998    55678999999998554 22222   3344567789999999999999999


Q ss_pred             EEEeCCCCCCCCCcEEeeccCcCCCCCCcceEEEeeCCcEEEEEEeccCCCCCCCCeeEEEEEEEEcCCCCCCCceeeee
Q psy14887         82 MAYNNAGEGPESERYLERTYRKAPQKPPSAVHIKGINPTTVHVTWRYVSPSFEEEPIIGYKVRVWEVDQDMSRANDTIIP  161 (238)
Q Consensus        82 ~a~~~~g~~~~s~~~~~~t~~~~p~~~p~~~~~~~~~~~~~~l~W~~~~~~~~~~~i~~y~v~~~~~~~~~~~~~~~~~~  161 (238)
                      .|.|..|.|..+..+.++|..+.|..||.++++...++++|.|+|.++++...+|.|.+|+|+|+........  .....
T Consensus       592 vA~N~~G~g~sS~~i~V~Tlsd~PsaPP~Nl~lev~sStsVrVsW~pP~~~t~ng~itgYkIRy~~~~~~~~~--~~t~v  669 (1381)
T KOG4221|consen  592 VAYNSAGSGVSSADITVRTLSDVPSAPPQNLSLEVVSSTSVRVSWLPPPSETQNGQITGYKIRYRKLSREDEV--NETVV  669 (1381)
T ss_pred             EEecCCCCCCCCCceEEEeccCCCCCCCcceEEEecCCCeEEEEccCCCcccccceEEEEEEEecccCccccc--ceeec
Confidence            9999999999999999999999999999999999999999999999988889999999999999876655432  23444


Q ss_pred             cCCcceEEecCCCCCceEEEEEEEEeCCCCCCCCCCcEEEeeccc--ccCCCCCcee
Q psy14887        162 VGNTLDADIVDLSPGKRYHMRVLAFSNGGDGRMSSPAITFQMGEE--KEFKSGSPAL  216 (238)
Q Consensus       162 ~~~~~~~~i~~L~p~t~Y~~~V~a~~~~g~g~~s~~~~~~~t~~~--~~~~p~~~~~  216 (238)
                      .++.+++++.+|+|++.|.|+|.|.|..|.|+.|+. +.+.|...  ++.+|.+|..
T Consensus       670 ~~n~~~~l~~~Lep~T~Y~vrIsa~t~nGtGpaS~w-~~aeT~~~d~~e~vp~~ps~  725 (1381)
T KOG4221|consen  670 KGNTTQYLFNGLEPNTQYRVRISAMTVNGTGPASEW-VSAETPESDLDERVPGKPSE  725 (1381)
T ss_pred             ccchhhhHhhcCCCCceEEEEEEEeccCCCCCcccc-eeccCccccccccCCCCCce
Confidence            568899999999999999999999999999999964 66666443  3456666653



>KOG3513|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>PF09240 IL6Ra-bind: Interleukin-6 receptor alpha chain, binding; InterPro: IPR015321 Members of this entry adopt a structure consisting of an immunoglobulin-like beta-sandwich, with seven strands in two beta-sheets, in a Greek-key topology Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>KOG4806|consensus Back     alignment and domain information
>PF09240 IL6Ra-bind: Interleukin-6 receptor alpha chain, binding; InterPro: IPR015321 Members of this entry adopt a structure consisting of an immunoglobulin-like beta-sandwich, with seven strands in two beta-sheets, in a Greek-key topology Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>PF07353 Uroplakin_II: Uroplakin II; InterPro: IPR009952 This family contains uroplakin II, which is approximately 180 residues long and seems to be restricted to mammals Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1 Back     alignment and domain information
>KOG1948|consensus Back     alignment and domain information
>PF14292 SusE: SusE outer membrane protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query238
1uen_A125 Solution Structure Of The Third Fibronectin Iii Dom 1e-08
3f7q_A234 First Pair Of Fibronectin Type Iii Domains And Part 4e-07
3f7p_C248 Crystal Structure Of A Complex Between Integrin Bet 4e-07
3f7r_A249 First Pair Of Fibronectin Type Iii Domains And Part 4e-07
1qg3_A195 Crystal Structure Of A Tandem Pair Of Fibronectin T 5e-07
2edx_A134 Solution Structures Of The Fn3 Domain Of Human Rece 9e-07
3p4l_A211 Crystal Structure Of A Hemojuvelin-Binding Fragment 2e-06
2ee2_A119 Solution Structures Of The Fn3 Domain Of Human Cont 7e-06
2edy_A103 Solution Structures Of The Fn3 Domain Of Human Rece 2e-05
2dlh_A121 Solution Structure Of The Second Fn3 Domain Of Huma 2e-04
1x5h_A132 The Solution Structure Of The Third Fibronectin Typ 7e-04
>pdb|1UEN|A Chain A, Solution Structure Of The Third Fibronectin Iii Domain Of Human Kiaa0343 Protein Length = 125 Back     alignment and structure

Iteration: 1

Score = 56.6 bits (135), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 33/99 (33%), Positives = 51/99 (51%), Gaps = 8/99 (8%) Query: 1 MPQVAPQGVFSRGFNSTAINVTWNPIELIRENIRGRLIGHRIKYWKEDNPEETAVYYLSR 60 +P VAP V NST V W+P+ L ++IRG L G+RI YWK + + ++ + Sbjct: 13 LPMVAPGNVRVNVVNSTLAEVHWDPVPL--KSIRGHLQGYRIYYWKTQSSSKRNRRHIEK 70 Query: 61 T------TRNWALIVGLQPDTKYYVKVMAYNNAGEGPES 93 ++ ++ GL+P + Y + V N GEGP S Sbjct: 71 KILTFQGSKTHGMLPGLEPFSHYTLNVRVVNGKGEGPAS 109
>pdb|3F7Q|A Chain A, First Pair Of Fibronectin Type Iii Domains And Part Of The Connecting Segment Of The Integrin Beta4 Length = 234 Back     alignment and structure
>pdb|3F7P|C Chain C, Crystal Structure Of A Complex Between Integrin Beta4 And Plectin Length = 248 Back     alignment and structure
>pdb|3F7R|A Chain A, First Pair Of Fibronectin Type Iii Domains And Part Of The Connecting Segment Of The Integrin Beta4 Length = 249 Back     alignment and structure
>pdb|1QG3|A Chain A, Crystal Structure Of A Tandem Pair Of Fibronectin Type Iii Domains From The Cytoplasmic Tail Of Integrin Alpha6 Beta4 Length = 195 Back     alignment and structure
>pdb|2EDX|A Chain A, Solution Structures Of The Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 134 Back     alignment and structure
>pdb|3P4L|A Chain A, Crystal Structure Of A Hemojuvelin-Binding Fragment Of Neogenin Length = 211 Back     alignment and structure
>pdb|2EE2|A Chain A, Solution Structures Of The Fn3 Domain Of Human Contactin 1 Length = 119 Back     alignment and structure
>pdb|2EDY|A Chain A, Solution Structures Of The Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 103 Back     alignment and structure
>pdb|2DLH|A Chain A, Solution Structure Of The Second Fn3 Domain Of Human Receptor-Type Tyrosine-Protein Phosphatase Delta Length = 121 Back     alignment and structure
>pdb|1X5H|A Chain A, The Solution Structure Of The Third Fibronectin Type Iii Domain Of Human Neogenin Length = 132 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query238
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 5e-50
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 4e-17
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 7e-49
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 3e-19
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 3e-34
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 1e-18
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 2e-17
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 3e-06
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 1e-33
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 2e-31
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 5e-25
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 7e-14
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 2e-06
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 1e-31
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 9e-25
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 2e-31
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 1e-22
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 3e-30
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 2e-20
3l5i_A 290 Interleukin-6 receptor subunit beta; cytokine rece 2e-04
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 3e-30
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 8e-21
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 4e-30
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 2e-19
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 6e-29
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 1e-27
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 2e-28
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 5e-25
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 2e-21
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 2e-10
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 4e-07
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 5e-28
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 2e-18
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 2e-27
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 2e-15
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 4e-27
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 3e-14
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 1e-13
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 1e-05
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 6e-27
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 3e-24
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 2e-23
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 7e-27
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 6e-26
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 6e-18
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 7e-11
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 8e-27
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 4e-22
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 1e-26
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 6e-11
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 7e-09
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 2e-26
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 4e-17
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 3e-26
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 1e-22
3r8q_A 290 Fibronectin; heparin, FNIII, heparin binding, cell 8e-10
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 4e-09
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 1e-25
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 4e-22
1tdq_A 283 Tenascin-R; extracellular matrix, lecticans, tenas 2e-08
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 5e-25
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 6e-23
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 2e-24
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 5e-22
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 6e-24
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 8e-13
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 1e-08
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 4e-23
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 2e-19
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 2e-22
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 2e-16
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 4e-22
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 5e-11
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 4e-08
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 5e-22
3e0g_A 483 Leukemia inhibitory factor receptor; IG domain, cy 3e-04
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 8e-22
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 1e-21
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 4e-12
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 5e-10
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 1e-21
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 2e-10
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 5e-21
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 1e-11
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 2e-20
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 2e-11
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 4e-09
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 7e-20
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 2e-08
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 1e-07
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 1e-18
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 5e-16
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 2e-18
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 2e-14
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 4e-18
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 5e-07
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 8e-18
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 6e-17
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 9e-18
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 1e-10
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 9e-18
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 1e-15
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 2e-17
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 4e-16
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 7e-17
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 2e-14
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 8e-17
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 8e-17
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 3e-12
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 2e-16
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 3e-16
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 2e-12
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 1e-14
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 2e-09
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 1e-14
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 5e-12
3t04_D103 Monobody 7C12; engineered binding protein, antibod 3e-14
3t04_D103 Monobody 7C12; engineered binding protein, antibod 3e-12
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 5e-14
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 5e-13
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 6e-14
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 9e-09
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 7e-14
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 9e-14
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 4e-13
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 1e-13
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 9e-07
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 1e-13
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 5e-05
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 2e-13
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 1e-10
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 9e-13
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 2e-12
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 1e-12
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 3e-10
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 1e-12
3se4_A 414 Interferon alpha/beta receptor 1; type I interfero 3e-08
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 2e-07
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 3e-12
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 1e-08
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 4e-12
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 6e-11
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 1e-11
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 2e-08
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 1e-11
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 1e-06
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 3e-11
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 2e-10
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 4e-11
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 2e-09
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 5e-11
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 1e-10
3k2m_C101 Monobody HA4; engineered binding protein, antibody 5e-11
3k2m_C101 Monobody HA4; engineered binding protein, antibody 2e-10
1x3d_A118 Fibronectin type-III domain containing protein 3A; 8e-11
1x3d_A118 Fibronectin type-III domain containing protein 3A; 4e-07
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 1e-10
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 1e-07
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 1e-10
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 1e-09
2erj_C247 Cytokine receptor common gamma chain; immune syste 3e-10
2erj_C247 Cytokine receptor common gamma chain; immune syste 2e-04
1x4x_A106 Fibronectin type-III domain containing protein 3A; 3e-10
1x4x_A106 Fibronectin type-III domain containing protein 3A; 1e-09
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 3e-10
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 7e-09
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 3e-10
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 3e-05
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 5e-10
2gys_A419 Cytokine receptor common beta chain; dimer of inte 5e-10
2gys_A419 Cytokine receptor common beta chain; dimer of inte 4e-07
2gys_A 419 Cytokine receptor common beta chain; dimer of inte 1e-06
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 7e-10
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 1e-09
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 2e-09
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 3e-09
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 2e-09
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 1e-07
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 2e-09
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 6e-04
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 2e-09
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 3e-08
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 3e-09
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 9e-09
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 5e-09
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 6e-07
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 5e-09
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 2e-07
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 5e-09
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 9e-08
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 7e-09
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 3e-07
3bpo_C 314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 2e-04
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 1e-08
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 3e-04
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 1e-08
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 5e-08
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 1e-08
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 2e-07
2crm_A120 Fibronectin type-III domain containing protein 3A; 2e-08
2crm_A120 Fibronectin type-III domain containing protein 3A; 8e-05
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 2e-08
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 3e-08
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 2e-07
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 3e-08
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 4e-08
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 8e-06
1eer_B227 Epobp, erythropoietin receptor; signal transductio 5e-08
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 8e-08
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 1e-07
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 9e-08
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 2e-06
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 1e-07
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 3e-07
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 2e-07
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 6e-05
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 2e-07
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 2e-07
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 2e-05
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 2e-07
2crz_A110 Fibronectin type-III domain containing protein 3A; 2e-07
2crz_A110 Fibronectin type-III domain containing protein 3A; 1e-06
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 2e-07
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 4e-05
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 2e-07
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 3e-07
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 3e-07
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 1e-04
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 3e-07
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 8e-05
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 3e-07
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 7e-05
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 4e-07
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 1e-04
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 5e-07
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 3e-06
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 8e-07
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 1e-06
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 1e-06
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 9e-06
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 2e-06
1x5x_A109 Fibronectin type-III domain containing protein 3A; 2e-06
1x5x_A109 Fibronectin type-III domain containing protein 3A; 5e-06
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 2e-06
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 2e-06
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 3e-06
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 6e-06
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 2e-05
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 3e-04
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 3e-04
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 7e-04
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 8e-04
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
 Score =  161 bits (409), Expect = 5e-50
 Identities = 49/207 (23%), Positives = 77/207 (37%), Gaps = 7/207 (3%)

Query: 1   MPQVAPQGVFSRGFNSTAINVTWNPIELIRENIRGRLIGHRIKYWKEDNPEETAVYYLSR 60
           +P + P GV +   +   I +TW    L +         + +  WK + P  T     + 
Sbjct: 3   LPMMPPVGVQASILSHDTIRITWADNSLPKHQKITDSRYYTV-RWKTNIPANTKYKNAN- 60

Query: 61  TTRNWALIVGLQPDTKYYVKVMAYNNAGEGPESERYLERTYRKAPQKPPSAVHIKG--IN 118
            T    L+ GL+P+T Y   VM          S      T+   P  PP  V +      
Sbjct: 61  ATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGTTFELVPTSPPKDVTVVSKEGK 120

Query: 119 PTTVHVTWRYVSPSFEEEPIIGYKVRVWEVDQDMSRANDTIIPVGNTLDADIVDLSPGKR 178
           P T+ V W+   PS     I GY +                  VGN L   I +L+    
Sbjct: 121 PKTIIVNWQ--PPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTP 178

Query: 179 YHMRVLAFSNGGDGRMSSPAITFQMGE 205
           Y+ ++ A ++ G G MS   + F+  +
Sbjct: 179 YYFKIQARNSKGMGPMSEA-VQFRTPK 204


>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Length = 226 Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Length = 219 Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Length = 211 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query238
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 100.0
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 100.0
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.98
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.97
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.96
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.96
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.96
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.95
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.95
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.95
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.94
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.94
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.94
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.93
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.93
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 99.93
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.93
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.93
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 99.93
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 99.92
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.92
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.91
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.91
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 99.91
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 99.91
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.91
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.9
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.9
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.9
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 99.89
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 99.89
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 99.88
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 99.88
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 99.88
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.88
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.87
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 99.87
3se4_A 414 Interferon alpha/beta receptor 1; type I interfero 99.86
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.86
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.85
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.85
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.85
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.84
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.84
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 99.84
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.83
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.83
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.83
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.83
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.82
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.82
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 99.81
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 99.81
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 99.81
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 99.8
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 99.8
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 99.8
3lb6_C 380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.8
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 99.8
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.79
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 99.79
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.78
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.78
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.77
1eer_B227 Epobp, erythropoietin receptor; signal transductio 99.76
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 99.76
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.76
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.76
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.75
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.75
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.75
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.74
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.74
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.74
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 99.73
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.72
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.72
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.71
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.71
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.71
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.71
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.7
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.7
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.7
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.7
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 99.7
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.7
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.69
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.69
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 99.69
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.69
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.69
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.69
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 99.68
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 99.68
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.68
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 99.68
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.67
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.67
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.67
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 99.66
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.66
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.66
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.66
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.66
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.66
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.66
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.66
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.66
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.66
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.65
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.65
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.65
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.65
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.65
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.64
3t04_D103 Monobody 7C12; engineered binding protein, antibod 99.64
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 99.64
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.64
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.64
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.63
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.63
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.63
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.63
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.63
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.62
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.62
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 99.62
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.62
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.62
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 99.62
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 99.62
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.61
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 99.61
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.61
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 99.61
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 99.61
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.6
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 99.6
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 99.6
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.59
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.59
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 99.59
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 99.59
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 99.59
2erj_C247 Cytokine receptor common gamma chain; immune syste 99.59
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 99.58
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 99.57
3t04_D103 Monobody 7C12; engineered binding protein, antibod 99.57
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 99.57
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 99.57
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 99.57
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 99.57
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 99.57
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 99.56
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.56
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 99.56
3k2m_C101 Monobody HA4; engineered binding protein, antibody 99.56
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 99.56
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 99.56
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 99.56
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.55
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 99.55
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 99.55
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 99.55
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 99.55
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 99.55
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.55
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.54
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 99.54
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 99.54
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 99.54
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 99.53
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 99.53
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 99.53
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 99.52
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 99.51
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 99.51
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 99.5
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 99.5
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.5
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 99.5
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 99.5
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.5
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 99.49
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.49
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 99.48
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 99.48
3f7q_A 234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.48
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 99.47
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 99.47
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 99.46
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 99.46
3k2m_C101 Monobody HA4; engineered binding protein, antibody 99.46
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 99.45
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 99.45
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 99.45
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.44
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.44
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 99.43
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 99.43
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 99.43
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.43
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 99.42
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 99.42
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 99.39
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 99.39
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 99.38
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 99.38
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.38
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.37
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 99.37
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 99.37
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 99.37
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.37
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.37
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 99.37
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 99.36
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 99.36
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 99.36
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 99.36
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 99.35
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.33
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 99.33
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 99.33
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.33
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.33
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.32
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.32
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 99.32
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.3
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.3
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 99.29
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.29
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.27
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.27
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.26
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.23
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 99.22
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.22
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 99.18
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 99.18
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.17
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.17
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.15
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.15
1eer_B227 Epobp, erythropoietin receptor; signal transductio 99.13
2hft_A218 Human tissue factor; coagulation factor; 1.69A {Ho 99.11
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 99.1
3s9d_B199 Interferon alpha/beta receptor 2; human, type I in 99.09
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 99.08
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 99.08
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 99.07
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 99.05
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 98.98
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 98.96
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 98.96
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 98.95
2erj_C247 Cytokine receptor common gamma chain; immune syste 98.93
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 98.88
1wft_A123 1700129L13RIK protein; FN3 domain, similar to HOST 98.88
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 98.85
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 98.83
1oww_A98 FN, fibronectin first type III module, CIG; fibron 98.82
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 98.77
1wft_A123 1700129L13RIK protein; FN3 domain, similar to HOST 98.77
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 98.76
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 98.7
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 98.67
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 98.66
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 98.65
3bes_R250 Interferon-gamma binding protein C4R; orthopoxviru 98.6
1oww_A98 FN, fibronectin first type III module, CIG; fibron 98.49
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 98.36
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 98.31
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 98.3
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 98.26
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 97.92
3b4n_A 344 Endo-pectate lyase; pectin, galacturonic acid, rig 97.59
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 97.36
3cxe_C120 Granulocyte-macrophage colony-stimulating factor s 97.3
3b4n_A344 Endo-pectate lyase; pectin, galacturonic acid, rig 97.05
3cxe_C120 Granulocyte-macrophage colony-stimulating factor s 96.81
2uvf_A 608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 96.75
2uvf_A 608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 96.29
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 96.14
4go6_A45 HCF N-terminal chain 1; tandem fibronectin repeat, 95.97
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 95.76
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 95.41
4gns_A290 Chitin biosynthesis protein CHS5; FN3, BRCT, tetra 94.53
3s9d_B199 Interferon alpha/beta receptor 2; human, type I in 94.35
3arx_A 584 Chitinase A; TIM barrel, inhibitor complex, glycos 93.11
3arx_A 584 Chitinase A; TIM barrel, inhibitor complex, glycos 93.08
4go6_A45 HCF N-terminal chain 1; tandem fibronectin repeat, 92.63
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 92.62
4gns_A290 Chitin biosynthesis protein CHS5; FN3, BRCT, tetra 90.71
2hft_A218 Human tissue factor; coagulation factor; 1.69A {Ho 89.41
2w91_A653 Endo-beta-N-acetylglucosaminidase D; hydrolase, N- 87.87
2qfp_A 424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 86.93
1xzw_A 426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 86.29
4a2l_A795 BT_4663, two-component system sensor histidine kin 85.71
3ott_A758 Two-component system sensor histidine kinase; beta 85.08
2qfp_A 424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 84.12
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 82.75
1edq_A 540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 82.33
1xzw_A 426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 82.18
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
Probab=100.00  E-value=1e-31  Score=194.55  Aligned_cols=200  Identities=23%  Similarity=0.303  Sum_probs=158.5

Q ss_pred             CCCCCCcceEEeeeccceEEEEeeecccccccccceeeEEEEEEEeeCCCcCceEEEeeccccceEEEecCCCCCEEEEE
Q psy14887          1 MPQVAPQGVFSRGFNSTAINVTWNPIELIRENIRGRLIGHRIKYWKEDNPEETAVYYLSRTTRNWALIVGLQPDTKYYVK   80 (238)
Q Consensus         1 ~pp~~P~~~~~~~~~~~~~~l~W~~~~~~~~~~~~~i~~y~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~p~~~Y~~~   80 (238)
                      .|+.+|.++++...+.+++.|+|++|.......++.+.+|.|+|+..+........  .......+.+.+|.|++.|.|+
T Consensus         3 ~P~~~P~~l~~~~~~~~si~l~W~~p~~~~~~~~~~i~~Y~v~~~~~~~~~~~~~~--~~~~~~~~~i~~L~p~t~Y~~~   80 (211)
T 3p4l_A            3 LPMMPPVGVQASILSHDTIRITWADNSLPKHQKITDSRYYTVRWKTNIPANTKYKN--ANATTLSYLVTGLKPNTLYEFS   80 (211)
T ss_dssp             CCCCCCEEEEEEECSSSCEEEEEECTTSCTTCCCCSSCEEEEEEEECC---CCCEE--EEESSSEEEECSCCTTCEEEEE
T ss_pred             CCCCCCCCEEEEecCCCeEEEEEeCCCCCcccccCCCcEEEEEEEECCCCcceEEE--eCCCceEEEecCcCCCCEEEEE
Confidence            58999999999999999999999987543334457889999998765443222221  2234567999999999999999


Q ss_pred             EEEEeCCCCCCCCCcEEeeccCcCCCCCCcceEEEee--CCcEEEEEEeccCCCCCCCCeeEEEEEEEEcCCCCCCCcee
Q psy14887         81 VMAYNNAGEGPESERYLERTYRKAPQKPPSAVHIKGI--NPTTVHVTWRYVSPSFEEEPIIGYKVRVWEVDQDMSRANDT  158 (238)
Q Consensus        81 v~a~~~~g~~~~s~~~~~~t~~~~p~~~p~~~~~~~~--~~~~~~l~W~~~~~~~~~~~i~~y~v~~~~~~~~~~~~~~~  158 (238)
                      |+|.|..|.+.++....+.|.+..|..+|.++.+...  +.+++.|.|+  ++...+|.+.+|.|+|+..+.........
T Consensus        81 V~A~n~~g~~~~S~~~~~~t~~~~P~~~P~~~~~~~~~~s~~sv~l~W~--~p~~~~g~i~~Y~v~~~~~~~~~~~~~~~  158 (211)
T 3p4l_A           81 VMVTKGRRSSTWSMTAHGTTFELVPTSPPKDVTVVSKEGKPKTIIVNWQ--PPSEANGKITGYIIYYSTDVNAEIHDWVI  158 (211)
T ss_dssp             EEEEETTEECCCCCCEEEECCCCCCCSCCEEEEEEEETTEEEEEEEEEE--CCTTCCSCCCEEEEEEESCTTSCGGGSEE
T ss_pred             EEEEcCCCCCccceeEeeecccCCCCCCCcceEEEecCCCCCEEEEEEC--CCCCCCCCEEEEEEEEEECCCCCCCceEE
Confidence            9999999999999889999998888779999998877  3789999999  56678899999999998765543221122


Q ss_pred             eeecCCcceEEecCCCCCceEEEEEEEEeCCCCCCCCCCcEEEeecc
Q psy14887        159 IIPVGNTLDADIVDLSPGKRYHMRVLAFSNGGDGRMSSPAITFQMGE  205 (238)
Q Consensus       159 ~~~~~~~~~~~i~~L~p~t~Y~~~V~a~~~~g~g~~s~~~~~~~t~~  205 (238)
                      .......+++++.+|.|++.|.|+|+|+|..|.|++|++ +.+.+..
T Consensus       159 ~~~~~~~~~~~i~~L~p~t~Y~~~V~A~n~~G~g~~S~~-v~~~~~~  204 (211)
T 3p4l_A          159 EPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEA-VQFRTPK  204 (211)
T ss_dssp             EEEESSCSEEEECCCCTTCEEEEEEEEEETTEECCCCCC-EEEECC-
T ss_pred             EEecCCeeEEEEcCCCCCCEEEEEEEEEcCCccCCCCCC-EEccCcc
Confidence            344677889999999999999999999999999999965 6666543



>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} Back     alignment and structure
>3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A Back     alignment and structure
>3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Back     alignment and structure
>4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Back     alignment and structure
>4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... Back     alignment and structure
>2w91_A Endo-beta-N-acetylglucosaminidase D; hydrolase, N-glycan, secreted, oxazoline, NAG-thiazoline, substrate-participation; 1.40A {Streptococcus pneumoniae} PDB: 2w92_A* Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 238
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 2e-15
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 2e-12
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 5e-13
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 1e-12
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 8e-13
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 2e-07
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 0.003
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 1e-12
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 4e-09
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 4e-12
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 2e-11
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 6e-12
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 2e-09
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 6e-11
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 9e-10
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 1e-10
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 9e-09
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 1e-10
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 6e-10
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 4e-10
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 6e-10
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 4e-10
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 8e-09
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 2e-09
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 1e-08
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 2e-09
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 6e-07
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 4e-09
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 3e-06
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 4e-09
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 4e-08
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 6e-09
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 1e-07
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 1e-08
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 1e-08
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 1e-08
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 1e-06
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 2e-08
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 7e-07
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 2e-08
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 4e-07
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 4e-08
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 6e-08
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 6e-08
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 8e-08
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 6e-08
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 9e-08
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 7e-08
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 6e-06
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 9e-08
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 2e-07
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 1e-07
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 6e-06
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 2e-07
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 8e-05
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 2e-07
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 2e-06
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 2e-07
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 1e-06
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 2e-07
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 3e-05
d2b5ib2104 b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch 3e-07
d2b5ib2104 b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch 1e-05
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 5e-07
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 5e-06
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 9e-07
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 4e-06
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 1e-06
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 2e-04
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 1e-06
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 1e-06
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 1e-06
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 7e-05
d1iarb2101 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch 1e-06
d1iarb2101 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch 4e-06
d2dtge1102 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo 2e-06
d2dtge1102 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo 8e-06
d1wj3a_117 b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s 2e-06
d1wj3a_117 b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s 0.001
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 2e-06
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 3e-06
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 2e-06
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 1e-05
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 3e-06
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 2e-04
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 3e-06
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 1e-05
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 3e-06
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 1e-05
d2cspa1117 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho 3e-06
d2cspa1117 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho 3e-05
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 4e-06
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 3e-05
d2ibga195 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit 4e-06
d2ibga195 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit 4e-06
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 4e-06
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 0.001
d1bqua2115 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki 5e-06
d1bqua2115 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki 8e-06
d1n26a3104 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c 9e-06
d1n26a3104 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c 2e-04
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 1e-05
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 2e-05
d1tena_90 b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId 1e-05
d1tena_90 b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId 6e-05
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 2e-05
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 1e-04
d1bpva_104 b.1.2.1 (A:) Type I titin module {Human (Homo sapi 2e-05
d1bpva_104 b.1.2.1 (A:) Type I titin module {Human (Homo sapi 7e-04
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 2e-05
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 1e-04
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 2e-05
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 1e-04
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 2e-05
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 4e-05
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 4e-05
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 1e-04
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 4e-05
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 9e-05
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 5e-05
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 3e-04
d1tdqa193 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) 6e-05
d1tdqa193 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) 0.003
d2cuia1101 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) 3e-04
d2cuia1101 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) 6e-04
d1uc6a_109 b.1.2.1 (A:) Ciliary neurotrophic factor receptor 4e-04
d1uc6a_109 b.1.2.1 (A:) Ciliary neurotrophic factor receptor 0.004
d3d85d394 b.1.2.1 (D:212-305) The p40 domain of interleukin- 5e-04
d2d9qb2105 b.1.2.1 (B:204-308) Granulocyte colony-stimulating 7e-04
d2d9qb2105 b.1.2.1 (B:204-308) Granulocyte colony-stimulating 0.002
d1owwa_93 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 8e-04
d1owwa_93 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 0.001
d1cd9b2106 b.1.2.1 (B:108-213) Granulocyte colony-stimulating 0.001
d2b5ic195 b.1.2.1 (C:130-224) Cytokine receptor common gamma 0.001
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 0.001
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 0.001
d1x5ia1113 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [ 0.002
d2fnba_95 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 0.002
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: KIAA0343 protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 68.4 bits (166), Expect = 2e-15
 Identities = 35/116 (30%), Positives = 55/116 (47%), Gaps = 11/116 (9%)

Query: 2   PQVAPQGVFSRGFNSTAINVTWNPIELIRENIRGRLIGHRIKYWKEDNPEETAVYYLSR- 60
           P VAP  V     NST   V W+P+    ++IRG L G+RI YWK  +  +    ++ + 
Sbjct: 14  PMVAPGNVRVNVVNSTLAEVHWDPVP--LKSIRGHLQGYRIYYWKTQSSSKRNRRHIEKK 71

Query: 61  -----TTRNWALIVGLQPDTKYYVKVMAYNNAGEGPESERYLERTYRKAPQKPPSA 111
                 ++   ++ GL+P + Y + V   N  GEGP S    +R +       PS+
Sbjct: 72  ILTFQGSKTHGMLPGLEPFSHYTLNVRVVNGKGEGPASP---DRVFNTPEGSGPSS 124


>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query238
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.77
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.76
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.76
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.76
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.75
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.74
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.72
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.71
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.71
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.71
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.71
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.7
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.7
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.69
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.69
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.69
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.68
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.68
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.67
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.67
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.67
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.67
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.67
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.66
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.66
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.66
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.66
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.66
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.66
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.65
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.64
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.64
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.64
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.64
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.63
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 99.63
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.63
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.63
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.63
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.63
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.62
d2crza197 Fibronectin type-III domain containing protein 3a, 99.62
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.62
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.62
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.62
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.62
d2crza197 Fibronectin type-III domain containing protein 3a, 99.61
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.61
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.61
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.61
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.6
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.6
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 99.6
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.6
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.58
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.58
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 99.58
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 99.58
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 99.58
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 99.57
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 99.57
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.57
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 99.57
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.57
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 99.57
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 99.56
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.56
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 99.56
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.56
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.56
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 99.55
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.55
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 99.55
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 99.55
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 99.55
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 99.55
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.54
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 99.54
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 99.54
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.54
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.53
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 99.53
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.53
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 99.52
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.52
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 99.52
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 99.52
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 99.52
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.52
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.52
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 99.51
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.51
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.51
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.51
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 99.5
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.5
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 99.5
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.5
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 99.5
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 99.49
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.49
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.49
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 99.49
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 99.49
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 99.48
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 99.48
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 99.48
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 99.48
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 99.47
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 99.47
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.47
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.46
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.46
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 99.46
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.46
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 99.46
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 99.46
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.46
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.45
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 99.45
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 99.45
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 99.44
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 99.43
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.42
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 99.41
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 99.41
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 99.4
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.4
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 99.4
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.39
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 99.38
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.36
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 99.36
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 99.34
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 99.31
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.29
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.29
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 99.28
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 99.27
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 99.24
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 99.19
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.19
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 99.03
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 99.01
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 98.87
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 98.81
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.54
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 97.63
d2c4fu1116 Extracellular region of human tissue factor {Human 97.61
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 97.49
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 97.45
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 97.34
d2hfta1106 Extracellular region of human tissue factor {Human 97.23
d1f6fb196 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 97.18
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 97.15
d1a21a1103 Extracellular region of human tissue factor {Rabbi 96.96
d1f6fb196 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 96.64
d2c4fu1116 Extracellular region of human tissue factor {Human 96.32
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 96.03
d1axib199 Growth hormone receptor {Human (Homo sapiens) [Tax 94.87
d2gysa399 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 94.48
d1a21a1103 Extracellular region of human tissue factor {Rabbi 94.25
d2hfta1106 Extracellular region of human tissue factor {Human 93.71
d1axib199 Growth hormone receptor {Human (Homo sapiens) [Tax 88.16
d2b5ic296 Cytokine receptor common gamma chain {Human (Homo 86.1
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Neogenin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.81  E-value=9.6e-20  Score=117.78  Aligned_cols=107  Identities=22%  Similarity=0.400  Sum_probs=87.5

Q ss_pred             EeeccCcCCCCCCcceEEEeeCCcEEEEEEeccCCCCCCCCeeEEEEEEEEcCCCCCCCceeeeecCCcceEEecCCCCC
Q psy14887         97 LERTYRKAPQKPPSAVHIKGINPTTVHVTWRYVSPSFEEEPIIGYKVRVWEVDQDMSRANDTIIPVGNTLDADIVDLSPG  176 (238)
Q Consensus        97 ~~~t~~~~p~~~p~~~~~~~~~~~~~~l~W~~~~~~~~~~~i~~y~v~~~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~  176 (238)
                      .++|.+++|..+|.++.+...+.+++.|+|+++.....+|.|.+|+|+|+..+.....  .........+++.+.+|+|+
T Consensus         3 ~v~T~~~~P~~~P~~v~~~~~~~~si~v~W~~p~~~~~ng~i~~Y~v~y~~~~~~~~~--~~~~~~~~~~~~~i~~L~p~   80 (119)
T d1x5ha1           3 AVRTLSDVPSAAPQNLSLEVRNSKSIMIHWQPPAPATQNGQITGYKIRYRKASRKSDV--TETLVSGTQLSQLIEGLDRG   80 (119)
T ss_dssp             CCCCCCSSCCCCCEEEEEECCSSSEEEEEEECCCTTTCCSCEEEEBCEEEETTEEEEE--ECCBCCTTCCEEEEECCCSS
T ss_pred             EEEcCCCCCCCCCcCeEEEEecCcEEEEEEEcccccCCCCCEEEEEEEEeecccccce--eeeecCCCccEEEeCCCCCC
Confidence            4678888888889999999999999999999765677889999999999887654321  12334567789999999999


Q ss_pred             ceEEEEEEEEeCCCCCCCCCCcEEEeeccc
Q psy14887        177 KRYHMRVLAFSNGGDGRMSSPAITFQMGEE  206 (238)
Q Consensus       177 t~Y~~~V~a~~~~g~g~~s~~~~~~~t~~~  206 (238)
                      +.|.|+|+|+|..|.|++|+. +.++|...
T Consensus        81 t~Y~~~V~A~n~~G~G~~S~~-~~~~T~~~  109 (119)
T d1x5ha1          81 TEYNFRVAALTINGTGPATDW-LSAETFES  109 (119)
T ss_dssp             CEEEEECEEEETTEEEEECCC-EEEECCSS
T ss_pred             CEEEEEEEEEcCCcCCCCCCC-EEEEeCCC
Confidence            999999999999999999864 66776543



>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa3 b.1.2.1 (A:218-316) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic2 b.1.2.1 (C:34-129) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure