Psyllid ID: psy14903

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-
MQKALVNDKCNIIGYTAWSILDNFEWLDGYTISQADDLRSLGSPPAGSWVPISMISKSAHPIYSETGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGKVSITLDSSNYYPHNATSKEDQEAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSILIANNNQSSNAPPSIINDRAATYSQDPNWPSSNSPWLKRSIG
cHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEcccHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccccccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHcccccEEEccccccHHccccccccccccccccccccccccccccccccccccccccc
ccHHHHcccccEEEEEEEccEccccHHHHHHcccHHHHHHHccccEEEEEEEcccHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcHcccEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHccHcEccccccHHHHHHHHHHHHHHccccHHHcccccHHHHHHHcccccEEEEEcccEEEEEEccccccccccHHHHcccEEEccccccccccHHHHHEcc
mqkalvndkcniIGYTAWSILdnfewldgytisqaddlrslgsppagswvpismisksahpiysetgdyppivRQIVDqnsakegrarsrlprftEEEIKALKGKVsitldssnyyphnatskeDQEAAERVFQFTLGlfahpiyseagdyppiVRQIVDqnsakegrarsrlprftEEEIKALKGSFDFFALNHYTSILIannnqssnappsiindraatysqdpnwpssnspwlkrsig
mqkalvndkcNIIGYTAWSILDNFEWLDGYTISQADDLRSLGSPPAGSWVPISMISKSAHPIYSETGDYPPIVRQIVdqnsakegrarsrlprfteeeikalkgkvsitldssnyYPHNATSKEDQEAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDqnsakegrarsrlprftEEEIKALKGSFDFFALNHYTSILIANNNQSSNAPPSIINDRAATysqdpnwpssnspwlkrsig
MQKALVNDKCNIIGYTAWSILDNFEWLDGYTISQADDLRSLGSPPAGSWVPISMISKSAHPIYSETGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGKVSITLDSSNYYPHNATSKEDQEAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSILiannnqssnappsiinDRAATYSQDPNWPSSNSPWLKRSIG
****LVNDKCNIIGYTAWSILDNFEWLDGYTISQADDLR*******GSWVPISMISKSAHPIYSETGDYPPIVRQI*****************************************************ERVFQFTLGLFAHPIYSEAGDYPPIVRQIV********************EIKALKGSFDFFALNHYTSILIAN**************************************
*QKALVNDKCNIIGYTAWSILDNFEWLDGYTISQADDLRSLGSPPAGSWVPISMISKSAHPIYSETGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGKVSITLDSSNYYPHNATSKEDQEAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSILIANNNQSSNAPPSIINDRAATYSQDPNWPSSNSPWLKRSIG
MQKALVNDKCNIIGYTAWSILDNFEWLDGYTISQADDLRSLGSPPAGSWVPISMISKSAHPIYSETGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGKVSITLDSSNYYPHNATSKEDQEAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSILIANNNQSSNAPPSIINDRAATYS******************
MQKALVNDKCNIIGYTAWSILDNFEWLDGYTISQADDLRSLGSPPAGSWVPISMISKSAHPIYSETGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGKVSITLDSSNYYPHNATSKEDQEAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSILIANNNQSSNAPPSIINDRAATYSQDPNWPSSNSPWLKRSIG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQKALVNDKCNIIGYTAWSILDNFEWLDGYTISQADDLRSLGSPPAGSWVPISMISKSAHPIYSETGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGKVSITLDSSNYYPHNATSKEDQEAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSILIANNNQSSNAPPSIINDRAATYSQDPNWPSSNSPWLKRSIG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query241 2.2.26 [Sep-21-2011]
Q95X01 464 Myrosinase 1 OS=Brevicory N/A N/A 0.585 0.303 0.435 2e-24
Q8K1F9 566 Lactase-like protein OS=M no N/A 0.543 0.231 0.436 2e-23
Q6UWM7 567 Lactase-like protein OS=H yes N/A 0.547 0.232 0.425 3e-23
P09848 1927 Lactase-phlorizin hydrola no N/A 0.556 0.069 0.411 2e-21
P09849 1926 Lactase-phlorizin hydrola yes N/A 0.539 0.067 0.407 2e-21
Q02401 1928 Lactase-phlorizin hydrola no N/A 0.547 0.068 0.425 3e-20
Q5RF65 469 Cytosolic beta-glucosidas no N/A 0.576 0.296 0.4 1e-19
Q9H227 469 Cytosolic beta-glucosidas no N/A 0.551 0.283 0.408 3e-19
P97265 469 Cytosolic beta-glucosidas no N/A 0.564 0.289 0.380 2e-17
Q9Z2Y9 1014 Klotho OS=Rattus norvegic no N/A 0.390 0.092 0.445 4e-16
>sp|Q95X01|MYRO1_BREBR Myrosinase 1 OS=Brevicoryne brassicae PE=1 SV=1 Back     alignment and function desciption
 Score =  112 bits (281), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 64/147 (43%), Positives = 87/147 (59%), Gaps = 6/147 (4%)

Query: 87  ARSRLPRFTEEEIKALK-GKVSITLDSSNYYPHNATSKEDQEAAERVFQFTLGLFAHPIY 145
           A  +  R  EE  K  + GK+SI++    + P NA S +D E AER  QF  G F HP+Y
Sbjct: 201 AHGKAYRLYEEMFKPTQNGKISISISGVFFMPKNAESDDDIETAERANQFERGWFGHPVY 260

Query: 146 SEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSILIANNN 205
              GDYPPI+++ VDQ S +EG   S+LP+FT++EIK LKG+ DF+ALNHY+S L+    
Sbjct: 261 K--GDYPPIMKKWVDQKSKEEGLPWSKLPKFTKDEIKLLKGTADFYALNHYSSRLVT--- 315

Query: 206 QSSNAPPSIINDRAATYSQDPNWPSSN 232
             S+  P+   D +   S D  W   N
Sbjct: 316 FGSDPNPNFNPDASYVTSVDEAWLKPN 342
Hydrolyzes glucosinolates to a labile aglcone. This rapidly undergoes spontaneous rearrangement, eliminating sulfur to yield a number of toxic metabolites. Thereby developing a chemical defense system that exploits and mimics the host plant.
Brevicoryne brassicae (taxid: 69196)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 4EC: 7
>sp|Q8K1F9|LCTL_MOUSE Lactase-like protein OS=Mus musculus GN=Lctl PE=2 SV=1 Back     alignment and function description
>sp|Q6UWM7|LCTL_HUMAN Lactase-like protein OS=Homo sapiens GN=LCTL PE=1 SV=2 Back     alignment and function description
>sp|P09848|LPH_HUMAN Lactase-phlorizin hydrolase OS=Homo sapiens GN=LCT PE=1 SV=3 Back     alignment and function description
>sp|P09849|LPH_RABIT Lactase-phlorizin hydrolase OS=Oryctolagus cuniculus GN=LCT PE=1 SV=1 Back     alignment and function description
>sp|Q02401|LPH_RAT Lactase-phlorizin hydrolase OS=Rattus norvegicus GN=Lct PE=2 SV=2 Back     alignment and function description
>sp|Q5RF65|GBA3_PONAB Cytosolic beta-glucosidase OS=Pongo abelii GN=GBA3 PE=2 SV=1 Back     alignment and function description
>sp|Q9H227|GBA3_HUMAN Cytosolic beta-glucosidase OS=Homo sapiens GN=GBA3 PE=1 SV=2 Back     alignment and function description
>sp|P97265|GBA3_CAVPO Cytosolic beta-glucosidase OS=Cavia porcellus GN=Gba3 PE=1 SV=1 Back     alignment and function description
>sp|Q9Z2Y9|KLOT_RAT Klotho OS=Rattus norvegicus GN=Kl PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query241
357611300 495 hypothetical protein KGM_22373 [Danaus p 0.626 0.305 0.480 4e-31
183979384 495 similar to CG9701-PA [Papilio xuthus] 0.626 0.305 0.434 6e-29
195428030 622 GK16843 [Drosophila willistoni] gi|19415 0.688 0.266 0.436 5e-28
357605634 522 hypothetical protein KGM_13579 [Danaus p 0.622 0.287 0.440 1e-27
195428032 494 GK16842 [Drosophila willistoni] gi|19415 0.697 0.340 0.402 2e-27
183979247 531 similar to CG9701-PA [Papilio xuthus] 0.556 0.252 0.466 8e-27
364023607 501 seminal fluid protein CSSFP028 [Chilo su 0.543 0.261 0.469 1e-26
118788042 565 AGAP006426-PA [Anopheles gambiae str. PE 0.684 0.292 0.416 2e-26
300432455 495 beta-glucosidase [Reticulitermes flavipe 0.614 0.298 0.447 2e-26
170045442 920 lactase-phlorizin hydrolase [Culex quinq 0.593 0.155 0.486 2e-26
>gi|357611300|gb|EHJ67411.1| hypothetical protein KGM_22373 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  140 bits (354), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 91/152 (59%), Gaps = 1/152 (0%)

Query: 86  RARSRLPRFTEEEIKALKGKVSITLDSSNYYPHNATSKEDQEAAERVFQFTLGLFAHPIY 145
           RA   + R  ++E +   G V ITLD S +     TS EDQ AAE V QF  G FAHPI+
Sbjct: 222 RAHGMVYRMYKQEYRHRVGAVGITLDFS-WLEAATTSSEDQIAAETVRQFNFGWFAHPIF 280

Query: 146 SEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSILIANNN 205
           S+ GDYPP++R+ VD  S ++   RSRLP FTE+EI+ +KGS DF  LNHYT+ L+  N 
Sbjct: 281 SKTGDYPPVMRKRVDSISRRQHFTRSRLPTFTEDEIEMIKGSSDFLGLNHYTTYLVTKNK 340

Query: 206 QSSNAPPSIINDRAATYSQDPNWPSSNSPWLK 237
              +  PS   D     SQ   WP SNS WLK
Sbjct: 341 SKISMTPSFEADTGGILSQKAEWPKSNSTWLK 372

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|183979384|dbj|BAG30744.1| similar to CG9701-PA [Papilio xuthus] Back     alignment and taxonomy information
>gi|195428030|ref|XP_002062078.1| GK16843 [Drosophila willistoni] gi|194158163|gb|EDW73064.1| GK16843 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|357605634|gb|EHJ64708.1| hypothetical protein KGM_13579 [Danaus plexippus] Back     alignment and taxonomy information
>gi|195428032|ref|XP_002062079.1| GK16842 [Drosophila willistoni] gi|194158164|gb|EDW73065.1| GK16842 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|183979247|dbj|BAG30785.1| similar to CG9701-PA [Papilio xuthus] Back     alignment and taxonomy information
>gi|364023607|gb|AEW46878.1| seminal fluid protein CSSFP028 [Chilo suppressalis] Back     alignment and taxonomy information
>gi|118788042|ref|XP_557100.2| AGAP006426-PA [Anopheles gambiae str. PEST] gi|116127088|gb|EAL40075.2| AGAP006426-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|300432455|gb|ADK12988.1| beta-glucosidase [Reticulitermes flavipes] Back     alignment and taxonomy information
>gi|170045442|ref|XP_001850318.1| lactase-phlorizin hydrolase [Culex quinquefasciatus] gi|167868487|gb|EDS31870.1| lactase-phlorizin hydrolase [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query241
UNIPROTKB|E1BK89 1928 LCT "Uncharacterized protein" 0.547 0.068 0.402 5.4e-29
ZFIN|ZDB-GENE-081104-434 1898 si:dkey-79p17.2 "si:dkey-79p17 0.539 0.068 0.380 2.5e-27
UNIPROTKB|F1NAN4 1936 LCT "Uncharacterized protein" 0.547 0.068 0.380 2.6e-27
UNIPROTKB|F1PDK6 1360 LCT "Uncharacterized protein" 0.547 0.097 0.388 2.9e-27
UNIPROTKB|P09848 1927 LCT "Lactase-phlorizin hydrola 0.547 0.068 0.388 5.4e-27
UNIPROTKB|I3L7V1 1930 LOC100625897 "Uncharacterized 0.547 0.068 0.380 8.7e-27
RGD|620823 1928 Lct "lactase" [Rattus norvegic 0.547 0.068 0.395 5.3e-25
UNIPROTKB|F1N923 753 KL "Uncharacterized protein" [ 0.468 0.150 0.396 7.2e-24
UNIPROTKB|F1P3B9 1003 KL "Uncharacterized protein" [ 0.468 0.112 0.396 1.7e-23
UNIPROTKB|E1BAI2 1012 KL "Uncharacterized protein" [ 0.414 0.098 0.439 5.8e-23
UNIPROTKB|E1BK89 LCT "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 263 (97.6 bits), Expect = 5.4e-29, Sum P(2) = 5.4e-29
 Identities = 54/134 (40%), Positives = 74/134 (55%)

Query:   104 GKVSITLDSSNYYPHNATSKEDQEAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNS 163
             G +SIT+ S    P + +++ED EAA+R  QF  G FAHPI+   GDYP +++  +   S
Sbjct:  1593 GVISITISSDWAEPRDPSNQEDVEAAKRYVQFMGGWFAHPIFKN-GDYPEVMKTRIRDRS 1651

Query:   164 AKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSILXXXXXXXXXXXXXXXXDRAATYS 223
               EG  +SRLP FTE E + + G++DFF  NHYT++L                DR     
Sbjct:  1652 LAEGLNKSRLPEFTESEKRRINGTYDFFGFNHYTTVLAYNLNYASWISSFDA-DRGVASI 1710

Query:   224 QDPNWPSSNSPWLK 237
              D +WP S S WLK
Sbjct:  1711 TDRSWPDSGSFWLK 1724
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0004553 "hydrolase activity, hydrolyzing O-glycosyl compounds" evidence=IEA
ZFIN|ZDB-GENE-081104-434 si:dkey-79p17.2 "si:dkey-79p17.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NAN4 LCT "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PDK6 LCT "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P09848 LCT "Lactase-phlorizin hydrolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L7V1 LOC100625897 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|620823 Lct "lactase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1N923 KL "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3B9 KL "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BAI2 KL "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.2.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query241
pfam00232 454 pfam00232, Glyco_hydro_1, Glycosyl hydrolase famil 2e-27
PLN02849 503 PLN02849, PLN02849, beta-glucosidase 5e-11
PLN02814 504 PLN02814, PLN02814, beta-glucosidase 7e-10
PLN02998 497 PLN02998, PLN02998, beta-glucosidase 2e-08
pfam00232454 pfam00232, Glyco_hydro_1, Glycosyl hydrolase famil 7e-06
COG2723 460 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glu 5e-05
TIGR03356426 TIGR03356, BGL, beta-galactosidase 5e-05
TIGR03356426 TIGR03356, BGL, beta-galactosidase 1e-04
COG2723460 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glu 7e-04
>gnl|CDD|215809 pfam00232, Glyco_hydro_1, Glycosyl hydrolase family 1 Back     alignment and domain information 
 Score =  108 bits (273), Expect = 2e-27
 Identities = 52/142 (36%), Positives = 75/142 (52%), Gaps = 11/142 (7%)

Query: 100 KALKGKVSITLDSSNYYPHNATSKEDQEAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIV 159
              KG++ I L+ S  YP + +  +D EAAER  QF  G F  P++   GDYP  +R+IV
Sbjct: 210 HYQKGQIGIVLNLSWAYPLSPSPPDDVEAAERADQFHNGWFLDPVFR--GDYPEEMREIV 267

Query: 160 DQNSAKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSILIANNNQSSNAPPSIINDRA 219
                     R  LP FTEE+ + +KG +DF  LN+YTS  + N+ + SN  PS      
Sbjct: 268 --------GERGGLPNFTEEDKELIKGPYDFLGLNYYTSRRVRNDPEPSN-IPSYTEGIG 318

Query: 220 ATYSQDPNWPSSNSPWLKRSIG 241
                +P+WPS++  W+    G
Sbjct: 319 MDSEVNPSWPSTDWGWIIYPEG 340

Length = 454
>gnl|CDD|215455 PLN02849, PLN02849, beta-glucosidase Back     alignment and domain information
>gnl|CDD|215435 PLN02814, PLN02814, beta-glucosidase Back     alignment and domain information
>gnl|CDD|215539 PLN02998, PLN02998, beta-glucosidase Back     alignment and domain information
>gnl|CDD|215809 pfam00232, Glyco_hydro_1, Glycosyl hydrolase family 1 Back     alignment and domain information
>gnl|CDD|225343 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta- galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|234180 TIGR03356, BGL, beta-galactosidase Back     alignment and domain information
>gnl|CDD|234180 TIGR03356, BGL, beta-galactosidase Back     alignment and domain information
>gnl|CDD|225343 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta- galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 241
KOG0626|consensus 524 100.0
PLN02998 497 beta-glucosidase 100.0
COG2723 460 BglB Beta-glucosidase/6-phospho-beta-glucosidase/b 100.0
PLN02814 504 beta-glucosidase 100.0
TIGR01233 467 lacG 6-phospho-beta-galactosidase. This enzyme is 100.0
PLN02849 503 beta-glucosidase 100.0
PF00232 455 Glyco_hydro_1: Glycosyl hydrolase family 1; InterP 100.0
PRK13511 469 6-phospho-beta-galactosidase; Provisional 100.0
PRK09593 478 arb 6-phospho-beta-glucosidase; Reviewed 100.0
PRK09589 476 celA 6-phospho-beta-glucosidase; Reviewed 100.0
PRK09852 474 cryptic 6-phospho-beta-glucosidase; Provisional 100.0
PRK15014 477 6-phospho-beta-glucosidase BglA; Provisional 100.0
TIGR03356427 BGL beta-galactosidase. 100.0
PLN02998497 beta-glucosidase 97.48
PLN02814504 beta-glucosidase 97.45
PRK13511469 6-phospho-beta-galactosidase; Provisional 97.45
PLN02849503 beta-glucosidase 97.44
TIGR01233467 lacG 6-phospho-beta-galactosidase. This enzyme is 97.43
PRK09589476 celA 6-phospho-beta-glucosidase; Reviewed 97.41
PRK09852474 cryptic 6-phospho-beta-glucosidase; Provisional 97.31
PRK09593478 arb 6-phospho-beta-glucosidase; Reviewed 97.22
PRK15014477 6-phospho-beta-glucosidase BglA; Provisional 97.18
COG2723460 BglB Beta-glucosidase/6-phospho-beta-glucosidase/b 97.09
PF00232455 Glyco_hydro_1: Glycosyl hydrolase family 1; InterP 97.09
KOG0626|consensus524 96.72
>KOG0626|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.8e-51  Score=376.34  Aligned_cols=226  Identities=28%  Similarity=0.410  Sum_probs=198.7

Q ss_pred             ChhhhhhCCC-ceeeEeeccccccccC-CCCCcccc----ccCcCCCCCCC----CCcccceeccccccCccccCCCCCC
Q psy14903          1 MQKALVNDKC-NIIGYTAWSILDNFEW-LDGYTISQ----ADDLRSLGSPP----AGSWVPISMISKSAHPIYSETGDYP   70 (241)
Q Consensus         1 ~~~~~~~~g~-~~~~~~~w~~~~~~~~-~~~~~~~~----f~dy~~~~~~~----VkyW~TfNEpn~~~~~~y~~~G~~p   70 (241)
                      |.+.|++.|| |.||++||++|++++. ++||.+++    |.+|+++||++    ||+|+|||||++++..+|. .|..|
T Consensus       138 LI~eL~~nGI~P~VTLfHwDlPq~LeDeYgGwLn~~ivedF~~yA~~CF~~fGDrVK~WiT~NEP~v~s~~gY~-~G~~a  216 (524)
T KOG0626|consen  138 LIDELLANGIEPFVTLFHWDLPQALEDEYGGWLNPEIVEDFRDYADLCFQEFGDRVKHWITFNEPNVFSIGGYD-TGTKA  216 (524)
T ss_pred             HHHHHHHcCCeEEEEEecCCCCHHHHHHhccccCHHHHHHHHHHHHHHHHHhcccceeeEEecccceeeeehhc-cCCCC
Confidence            3578889999 9999999999999998 88898884    99999999997    9999999999999999998 99999


Q ss_pred             hhHHh-------------HHHHHHHHhcccccccchhhHHHHh-hcCCcEEEEecCCcceeCCCCCHHhHHHHHHHHHHh
Q psy14903         71 PIVRQ-------------IVDQNSAKEGRARSRLPRFTEEEIK-ALKGKVSITLDSSNYYPHNATSKEDQEAAERVFQFT  136 (241)
Q Consensus        71 pg~~~-------------~~~q~~hn~llAHa~a~~~~k~~~~-~~~~kIG~~~~~~~~~P~~~~~~~D~~aa~~~~~~~  136 (241)
                      ||+..             ..+.+.||++||||+||++||+.++ .++|+||++++..|++|.++ +++|++||+|+++|.
T Consensus       217 PGrCs~~~~~c~~g~s~~epYiv~HNllLAHA~Av~~yr~kyk~~Q~G~IGi~~~~~w~eP~~~-s~~D~~Aa~Ra~~F~  295 (524)
T KOG0626|consen  217 PGRCSKYVGNCSAGNSGTEPYIVAHNLLLAHAAAVDLYRKKYKKKQGGKIGIALSARWFEPYDD-SKEDKEAAERALDFF  295 (524)
T ss_pred             CCCCCcccccCCCCCCCCCcchHHHHHHHHHHHHHHHHHHhhhhhcCCeEeEEEeeeeeccCCC-ChHHHHHHHHHHHhh
Confidence            99742             1247999999999999999999876 68999999999999999997 799999999999999


Q ss_pred             cCcccccccccCCCCChHHHHHHhhhhhccccCCCCCCCCCHHHHHHhcCCccEEEEccccccccccCCCCC-CCCCCcc
Q psy14903        137 LGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSILIANNNQSS-NAPPSII  215 (241)
Q Consensus       137 ~~~~~dp~~~~~G~YP~~~~~~l~~~~~~~~~~~~~~p~~~~~d~~~i~~~~DFiG~NYYts~~v~~~~~~~-~~~~~~~  215 (241)
                      .+|+++|+..  |+||+.|++.++          ++||.||++|.+.|||+.||+|||||++.++++...+. ...+++.
T Consensus       296 ~gw~l~p~~~--GdYP~~Mk~~vg----------~rLP~FT~ee~~~lKGS~DFvGiNyYts~~~~~~~~~~~~~~~~~~  363 (524)
T KOG0626|consen  296 LGWFLEPLTF--GDYPDEMKERVG----------SRLPKFTEEESKLLKGSYDFVGINYYTSRYVKHLKPPPDPSQPGWS  363 (524)
T ss_pred             hhhhhccccc--CCcHHHHHHHhc----------ccCCCCCHHHHHHhcCchhhceeehhhhhhhhccCCCCCCCCcccc
Confidence            9999999666  999999999998          57999999999999999999999999999999865422 2234566


Q ss_pred             ccccccc--c-cCCCCCCCCCCceeecc
Q psy14903        216 NDRAATY--S-QDPNWPSSNSPWLKRSI  240 (241)
Q Consensus       216 ~~~~~~~--~-~~~~~~~~~~~w~~~~~  240 (241)
                      .|.++..  . ....+..+.+.|+.++|
T Consensus       364 ~d~~~~~~~~~~~~~~~~~~~~~~~v~P  391 (524)
T KOG0626|consen  364 TDSGVDWTLEGNDLIGPKAGSDWLPVYP  391 (524)
T ss_pred             cccceeeeecccccccccccccceeecc
Confidence            6666554  2 24677888899999987

>PLN02998 beta-glucosidase Back     alignment and domain information
>COG2723 BglB Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02814 beta-glucosidase Back     alignment and domain information
>TIGR01233 lacG 6-phospho-beta-galactosidase Back     alignment and domain information
>PLN02849 beta-glucosidase Back     alignment and domain information
>PF00232 Glyco_hydro_1: Glycosyl hydrolase family 1; InterPro: IPR001360 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK13511 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>PRK09593 arb 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PRK09589 celA 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>PRK15014 6-phospho-beta-glucosidase BglA; Provisional Back     alignment and domain information
>TIGR03356 BGL beta-galactosidase Back     alignment and domain information
>PLN02998 beta-glucosidase Back     alignment and domain information
>PLN02814 beta-glucosidase Back     alignment and domain information
>PRK13511 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>PLN02849 beta-glucosidase Back     alignment and domain information
>TIGR01233 lacG 6-phospho-beta-galactosidase Back     alignment and domain information
>PRK09589 celA 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>PRK09593 arb 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PRK15014 6-phospho-beta-glucosidase BglA; Provisional Back     alignment and domain information
>COG2723 BglB Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00232 Glyco_hydro_1: Glycosyl hydrolase family 1; InterPro: IPR001360 O-Glycosyl hydrolases 3 Back     alignment and domain information
>KOG0626|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query241
1wcg_A 464 Aphid Myrosinase Length = 464 1e-24
3vik_A 487 Crystal Structure Of Beta-Glucosidase From Termite 2e-24
3vij_A 487 Crystal Structure Of Beta-Glucosidase From Termite 2e-24
3ai0_A 487 Crystal Structure Of Beta-Glucosidase From Termite 2e-24
3ahz_A 487 Crystal Structure Of Beta-Glucosidase From Termite 2e-24
2jfe_X 469 The Crystal Structure Of Human Cytosolic Beta-Gluco 6e-18
2zox_A 469 Crystal Structure Of The Covalent Intermediate Of H 7e-18
2e9l_A 469 Crystal Structure Of Human Cytosolic Neutral Beta-G 7e-18
2e3z_A 465 Crystal Structure Of Intracellular Family 1 Beta- G 5e-14
4gxp_A 467 Chimeric Family 1 Beta-Glucosidase Made With Non-Co 3e-13
4a3y_A 540 Crystal Structure Of Raucaffricine Glucosidase From 2e-12
3ptk_A 505 The Crystal Structure Of Rice (Oryza Sativa L.) Os4 2e-12
4atd_A 513 Crystal Structure Of Native Raucaffricine Glucosida 2e-12
3u57_A 513 Structures Of Alkaloid Biosynthetic Glucosidases De 2e-12
3scv_A 481 Crystal Structure Of Rice Bglu1 E386gS334A MUTANT C 3e-12
3scr_A 481 Crystal Structure Of Rice Bglu1 E386s Mutant Length 3e-12
3scn_A 481 Crystal Structure Of Rice Bglu1 E386g Mutant Length 3e-12
3scp_A 481 Crystal Structure Of Rice Bglu1 E386a Mutant Length 3e-12
3f4v_A 481 Semi-Active E176q Mutant Of Rice Bglu1, A Plant Exo 3e-12
2rgl_A 481 Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBE 3e-12
3ahy_A 473 Crystal Structure Of Beta-Glucosidase 2 From Fungus 3e-12
3scw_A 481 Crystal Structure Of Rice Bglu1 E386gY341A MUTANT C 2e-11
1cbg_A 490 The Crystal Structure Of A Cyanogenic Beta-Glucosid 3e-11
3gno_A 488 Crystal Structure Of A Rice Os3bglu6 Beta-glucosida 7e-11
1myr_A 501 Myrosinase From Sinapis Alba Length = 501 3e-09
2jf6_A 532 Structure Of Inactive Mutant Of Strictosidine Gluco 6e-09
1dwa_M 499 Study On Radiation Damage On A Cryocooled Crystal. 1e-08
1e6q_M 501 Myrosinase From Sinapis Alba With The Bound Transit 1e-08
1h49_A 512 Crystal Structure Of The Inactive Double Mutant Of 1e-07
1e4l_A 512 Crystal Structure Of The Inactive Mutant Monocot (M 1e-07
1e1e_A 512 Crystal Structure Of A Monocot (Maize Zmglu1) Beta- 1e-07
1hxj_A 507 Crystal Structure Of The Maize Zm-P60.1 Beta-Glucos 1e-07
2dga_A 565 Crystal Structure Of Hexameric Beta-Glucosidase In 2e-07
3ais_A 565 Crystal Structure Of A Mutant Beta-Glucosidase In W 2e-07
3aiu_A 564 Crystal Structure Of Beta-Glucosidase In Rye Length 2e-07
1v03_A 565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 2e-07
1v02_E 565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 2e-07
1v02_A 565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 2e-07
1od0_A 468 Family 1 B-Glucosidase From Thermotoga Maritima Len 3e-05
>pdb|1WCG|A Chain A, Aphid Myrosinase Length = 464 Back     alignment and structure 
Iteration: 1

 Score =  110 bits (274), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 76/115 (66%), Gaps = 3/115 (2%)
Query: 87  ARSRLPRFTEEEIKALK-GKVSITLDSSNYYPHNATSKEDQEAAERVFQFTLGLFAHPIY 145
           A  +  R  EE  K  + GK+SI++    + P NA S +D E AER  QF  G F HP+Y
Sbjct: 201 AHGKAYRLYEEMFKPTQNGKISISISGVFFMPKNAESDDDIETAERANQFERGWFGHPVY 260
Query: 146 SEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSIL 200
              GDYPPI+++ VDQ S +EG   S+LP+FT++EIK LKG+ DF+ALNHY+S L
Sbjct: 261 K--GDYPPIMKKWVDQKSKEEGLPWSKLPKFTKDEIKLLKGTADFYALNHYSSRL 313
>pdb|3VIK|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Cellobiose Length = 487 Back     alignment and structure
>pdb|3VIJ|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Glucose Length = 487 Back     alignment and structure
>pdb|3AI0|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Para-Nitrophenyl-Beta-D-Glucopyranoside Length = 487 Back     alignment and structure
>pdb|3AHZ|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Tris Length = 487 Back     alignment and structure
>pdb|2JFE|X Chain X, The Crystal Structure Of Human Cytosolic Beta-Glucosidase Length = 469 Back     alignment and structure
>pdb|2ZOX|A Chain A, Crystal Structure Of The Covalent Intermediate Of Human Cytosolic Beta-Glucosidase Length = 469 Back     alignment and structure
>pdb|2E9L|A Chain A, Crystal Structure Of Human Cytosolic Neutral Beta-Glycosylceramidase (Klotho-Related Prote:klrp) Complex With Glucose And Fatty Acids Length = 469 Back     alignment and structure
>pdb|2E3Z|A Chain A, Crystal Structure Of Intracellular Family 1 Beta- Glucosidase Bgl1a From The Basidiomycete Phanerochaete Chrysosporium In Substrate-Free Form Length = 465 Back     alignment and structure
>pdb|4GXP|A Chain A, Chimeric Family 1 Beta-Glucosidase Made With Non-Contiguous Schema Length = 467 Back     alignment and structure
>pdb|4A3Y|A Chain A, Crystal Structure Of Raucaffricine Glucosidase From Ajmaline Biosynthesis Pathway Length = 540 Back     alignment and structure
>pdb|3PTK|A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 Length = 505 Back     alignment and structure
>pdb|4ATD|A Chain A, Crystal Structure Of Native Raucaffricine Glucosidase Length = 513 Back     alignment and structure
>pdb|3U57|A Chain A, Structures Of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity Length = 513 Back     alignment and structure
>pdb|3SCV|A Chain A, Crystal Structure Of Rice Bglu1 E386gS334A MUTANT COMPLEXED WITH Cellotetraose Length = 481 Back     alignment and structure
>pdb|3SCR|A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant Length = 481 Back     alignment and structure
>pdb|3SCN|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Length = 481 Back     alignment and structure
>pdb|3SCP|A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant Length = 481 Back     alignment and structure
>pdb|3F4V|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- Glucosidase Length = 481 Back     alignment and structure
>pdb|2RGL|A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase Length = 481 Back     alignment and structure
>pdb|3AHY|A Chain A, Crystal Structure Of Beta-Glucosidase 2 From Fungus Trichoderma Reesei In Complex With Tris Length = 473 Back     alignment and structure
>pdb|3SCW|A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose Length = 481 Back     alignment and structure
>pdb|1CBG|A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase Length = 490 Back     alignment and structure
>pdb|3GNO|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase Length = 488 Back     alignment and structure
>pdb|1MYR|A Chain A, Myrosinase From Sinapis Alba Length = 501 Back     alignment and structure
>pdb|2JF6|A Chain A, Structure Of Inactive Mutant Of Strictosidine Glucosidase In Complex With Strictosidine Length = 532 Back     alignment and structure
>pdb|1DWA|M Chain M, Study On Radiation Damage On A Cryocooled Crystal. Part 1: Structure Prior To Irradiation Length = 499 Back     alignment and structure
>pdb|1E6Q|M Chain M, Myrosinase From Sinapis Alba With The Bound Transition State Analogue Gluco-Tetrazole Length = 501 Back     alignment and structure
>pdb|1H49|A Chain A, Crystal Structure Of The Inactive Double Mutant Of The Maize Beta-Glucosidase Zmglu1-E191d-F198v In Complex With Dimboa-Glucoside Length = 512 Back     alignment and structure
>pdb|1E4L|A Chain A, Crystal Structure Of The Inactive Mutant Monocot (Maize Zmglu1) Beta-Glucosidase Zm Glu191asp Length = 512 Back     alignment and structure
>pdb|1E1E|A Chain A, Crystal Structure Of A Monocot (Maize Zmglu1) Beta-Glucosidase Length = 512 Back     alignment and structure
>pdb|1HXJ|A Chain A, Crystal Structure Of The Maize Zm-P60.1 Beta-Glucosidase Length = 507 Back     alignment and structure
>pdb|2DGA|A Chain A, Crystal Structure Of Hexameric Beta-Glucosidase In Wheat Length = 565 Back     alignment and structure
>pdb|3AIS|A Chain A, Crystal Structure Of A Mutant Beta-Glucosidase In Wheat Complexed With Dimboa-Glc Length = 565 Back     alignment and structure
>pdb|3AIU|A Chain A, Crystal Structure Of Beta-Glucosidase In Rye Length = 564 Back     alignment and structure
>pdb|1V03|A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|1V02|E Chain E, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|1V02|A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|1OD0|A Chain A, Family 1 B-Glucosidase From Thermotoga Maritima Length = 468 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query241
3vii_A 487 Beta-glucosidase; cellulases, glycosyl hydrolase, 5e-48
3vii_A487 Beta-glucosidase; cellulases, glycosyl hydrolase, 1e-12
3vii_A487 Beta-glucosidase; cellulases, glycosyl hydrolase, 2e-11
2e9l_A 469 Cytosolic beta-glucosidase; novel cytosolic neutra 2e-45
2e9l_A469 Cytosolic beta-glucosidase; novel cytosolic neutra 3e-11
2e9l_A469 Cytosolic beta-glucosidase; novel cytosolic neutra 7e-11
1wcg_A 464 Thioglucosidase, myrosinase; aphid, beta-glucosida 3e-45
1wcg_A464 Thioglucosidase, myrosinase; aphid, beta-glucosida 2e-11
1wcg_A464 Thioglucosidase, myrosinase; aphid, beta-glucosida 3e-10
3ptm_A 505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 1e-40
3ptm_A505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 4e-10
3ptm_A505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 2e-06
3f5l_A 481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 2e-40
3f5l_A481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 7e-10
3f5l_A481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 2e-06
1cbg_A 490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 2e-40
1cbg_A490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 3e-10
1cbg_A490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 2e-06
2jf7_A 532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 1e-39
2jf7_A532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 5e-10
2jf7_A532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 3e-06
1v08_A 512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 1e-39
1v08_A512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 5e-10
1v08_A512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 1e-06
3ahy_A 473 Beta-glucosidase; cellulases, glycosyl hydrolase, 3e-39
3ahy_A473 Beta-glucosidase; cellulases, glycosyl hydrolase, 9e-11
3ahy_A473 Beta-glucosidase; cellulases, glycosyl hydrolase, 4e-06
2dga_A 565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 1e-38
2dga_A565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 5e-10
2dga_A565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 2e-06
1v02_A 565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 1e-38
1v02_A565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 5e-10
1v02_A565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 2e-06
2e3z_A 465 Beta-glucosidase; TIM barrel, glycoside hydrolase 4e-38
2e3z_A465 Beta-glucosidase; TIM barrel, glycoside hydrolase 8e-11
2e3z_A465 Beta-glucosidase; TIM barrel, glycoside hydrolase 3e-06
4a3y_A 540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 4e-38
4a3y_A540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 2e-10
4a3y_A540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 1e-06
3gnp_A 488 OS03G0212800 protein; beta-alpha barrel, glycosida 1e-37
3gnp_A488 OS03G0212800 protein; beta-alpha barrel, glycosida 3e-11
3gnp_A488 OS03G0212800 protein; beta-alpha barrel, glycosida 4e-06
1e4m_M 501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 5e-37
1e4m_M501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 1e-11
1e4m_M501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 4e-06
1qox_A 449 Beta-glucosidase; hydrolase, cellulose degradation 2e-29
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 3e-09
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 8e-04
2j78_A 468 Beta-glucosidase A; family 1, hydrolase, inhibitor 2e-27
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 3e-09
3ahx_A 453 Beta-glucosidase A; cellulases, glycosyl hydrolase 4e-27
3ahx_A453 Beta-glucosidase A; cellulases, glycosyl hydrolase 1e-08
2o9p_A 454 Beta-glucosidase B; family 1 glycoside hydrolase; 9e-27
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 6e-09
1e4i_A 447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 6e-26
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 5e-09
1gnx_A 479 Beta-glucosidase; hydrolase, glycosyltransferase, 8e-26
1gnx_A479 Beta-glucosidase; hydrolase, glycosyltransferase, 8e-09
3ta9_A 458 Glycoside hydrolase family 1; TIM barrel, glucosid 2e-24
3ta9_A458 Glycoside hydrolase family 1; TIM barrel, glucosid 1e-08
1pbg_A 468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 2e-24
1pbg_A468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 2e-08
3fj0_A 465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 2e-23
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 8e-09
4eam_A 489 Lactase, beta-galactosidase; glycoside hydrolase, 5e-21
4eam_A489 Lactase, beta-galactosidase; glycoside hydrolase, 9e-09
1qvb_A 481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 1e-20
1qvb_A481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 3e-09
1ug6_A 431 Beta-glycosidase; glucosidase, atomic resolution, 2e-20
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 1e-08
1vff_A 423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 5e-14
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 1e-07
3apg_A 473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 2e-09
3apg_A473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 8e-09
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Length = 487 Back     alignment and structure
 Score =  163 bits (416), Expect = 5e-48
 Identities = 57/135 (42%), Positives = 80/135 (59%), Gaps = 3/135 (2%)

Query: 103 KGKVSITLDSSNYYPHNATSKEDQEAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQN 162
            GKV I+L+ +   P    S ED+ + E   QF LGL+AHPI++E GDYP +++  V +N
Sbjct: 226 GGKVGISLNINWCEPAT-NSAEDRASCENYQQFNLGLYAHPIFTEEGDYPAVLKDRVSRN 284

Query: 163 SAKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSILIANNNQSSNAPPSIINDRAATY 222
           SA EG   SRLP+FT EE++ ++G+ DF  +N YT++L  +        PS   D     
Sbjct: 285 SADEGYTDSRLPQFTAEEVEYIRGTHDFLGINFYTALLGKSG--VEGYEPSRYRDSGVIL 342

Query: 223 SQDPNWPSSNSPWLK 237
           +QD  WP S S WLK
Sbjct: 343 TQDAAWPISASSWLK 357
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Length = 487 Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Length = 487 Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Length = 469 Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Length = 469 Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Length = 469 Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Length = 464 Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Length = 464 Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Length = 464 Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Length = 505 Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Length = 505 Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Length = 505 Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Length = 481 Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Length = 481 Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Length = 481 Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Length = 490 Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Length = 490 Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Length = 490 Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Length = 532 Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Length = 532 Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Length = 532 Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Length = 512 Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Length = 512 Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Length = 512 Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Length = 473 Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Length = 473 Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Length = 473 Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Length = 565 Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Length = 565 Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Length = 565 Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Length = 565 Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Length = 565 Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Length = 565 Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Length = 465 Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Length = 465 Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Length = 465 Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Length = 540 Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Length = 540 Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Length = 540 Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Length = 488 Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Length = 488 Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Length = 488 Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Length = 501 Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Length = 501 Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Length = 501 Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Length = 449 Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Length = 449 Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Length = 449 Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Length = 468 Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Length = 468 Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Length = 453 Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Length = 453 Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Length = 454 Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Length = 454 Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Length = 447 Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Length = 447 Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Length = 479 Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Length = 479 Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Length = 458 Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Length = 458 Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Length = 468 Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Length = 468 Back     alignment and structure
>4eam_A Lactase, beta-galactosidase; glycoside hydrolase, chemical biology, allosteric activation switchable enzyme, chemical rescue; 1.70A {Sulfolobus solfataricus P2} PDB: 4ean_A 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 1gow_A 1uwi_A Length = 489 Back     alignment and structure
>4eam_A Lactase, beta-galactosidase; glycoside hydrolase, chemical biology, allosteric activation switchable enzyme, chemical rescue; 1.70A {Sulfolobus solfataricus P2} PDB: 4ean_A 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 1gow_A 1uwi_A Length = 489 Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Length = 481 Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Length = 481 Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Length = 431 Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Length = 431 Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Length = 423 Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Length = 423 Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Length = 473 Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Length = 473 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query241
3vii_A 487 Beta-glucosidase; cellulases, glycosyl hydrolase, 100.0
3ptm_A 505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 100.0
4atd_A 513 Raucaffricine-O-beta-D-glucosidase; alkaloid, hydr 100.0
3f5l_A 481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 100.0
1wcg_A 464 Thioglucosidase, myrosinase; aphid, beta-glucosida 100.0
3ta9_A 458 Glycoside hydrolase family 1; TIM barrel, glucosid 100.0
3gnp_A 488 OS03G0212800 protein; beta-alpha barrel, glycosida 100.0
4b3l_A 479 Beta-glucosidase; hydrolase, glycosidase, carbohyd 100.0
2e9l_A 469 Cytosolic beta-glucosidase; novel cytosolic neutra 100.0
4dde_A 480 6-phospho-beta-glucosidase; structural genomics, P 100.0
1cbg_A 490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 100.0
4a3y_A 540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 100.0
3qom_A 481 6-phospho-beta-glucosidase; structural genomics, P 100.0
2jf7_A 532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 100.0
1v02_A 565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 100.0
1gnx_A 479 Beta-glucosidase; hydrolase, glycosyltransferase, 100.0
1v08_A 512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 100.0
2e3z_A 465 Beta-glucosidase; TIM barrel, glycoside hydrolase 100.0
2dga_A 565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 100.0
4hz8_A 444 Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba 100.0
1e4m_M 501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 100.0
3ahy_A 473 Beta-glucosidase; cellulases, glycosyl hydrolase, 100.0
1e4i_A 447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 100.0
1qox_A 449 Beta-glucosidase; hydrolase, cellulose degradation 100.0
3ahx_A 453 Beta-glucosidase A; cellulases, glycosyl hydrolase 100.0
1pbg_A 468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 100.0
2o9p_A 454 Beta-glucosidase B; family 1 glycoside hydrolase; 100.0
3fj0_A 465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 100.0
2xhy_A 479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 100.0
2j78_A 468 Beta-glucosidase A; family 1, hydrolase, inhibitor 100.0
1ug6_A 431 Beta-glycosidase; glucosidase, atomic resolution, 100.0
1uwi_A 489 Beta-galactosidase; hydrolase, beta-glycosidase, g 100.0
4ha4_A 489 Beta-galactosidase; TIM barrel, beta-glycosidase, 100.0
1qvb_A 481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 100.0
1vff_A 423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 100.0
3apg_A 473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 99.97
1fob_A334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 97.66
1uwi_A489 Beta-galactosidase; hydrolase, beta-glycosidase, g 97.55
4ha4_A489 Beta-galactosidase; TIM barrel, beta-glycosidase, 97.54
4a3y_A540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 97.54
3vii_A487 Beta-glucosidase; cellulases, glycosyl hydrolase, 97.47
4b3l_A479 Beta-glucosidase; hydrolase, glycosidase, carbohyd 97.42
4dde_A480 6-phospho-beta-glucosidase; structural genomics, P 97.39
2jf7_A532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 97.37
3qom_A481 6-phospho-beta-glucosidase; structural genomics, P 97.35
1v08_A512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 97.35
2e3z_A465 Beta-glucosidase; TIM barrel, glycoside hydrolase 97.34
3ahy_A473 Beta-glucosidase; cellulases, glycosyl hydrolase, 97.33
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 97.33
1pbg_A468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 97.32
4hz8_A444 Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba 97.31
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 97.3
2dga_A565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 97.3
3ta9_A458 Glycoside hydrolase family 1; TIM barrel, glucosid 97.3
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 97.29
3ahx_A453 Beta-glucosidase A; cellulases, glycosyl hydrolase 97.29
1qvb_A481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 97.29
1gnx_A479 Beta-glucosidase; hydrolase, glycosyltransferase, 97.27
1v02_A565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 97.27
3apg_A473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 97.24
4atd_A513 Raucaffricine-O-beta-D-glucosidase; alkaloid, hydr 97.23
1wcg_A464 Thioglucosidase, myrosinase; aphid, beta-glucosida 97.22
2e9l_A469 Cytosolic beta-glucosidase; novel cytosolic neutra 97.22
3ptm_A505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 97.21
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 97.19
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 97.18
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 97.18
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 97.17
3gnp_A488 OS03G0212800 protein; beta-alpha barrel, glycosida 97.17
3f5l_A481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 97.16
2xhy_A479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 97.16
1cbg_A490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 97.13
1uhv_A 500 Beta-xylosidase; family 39 glycoside hydrolase, xy 97.05
1e4m_M501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 96.95
1w91_A 503 Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 96.35
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 85.82
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 81.82
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Back     alignment and structure
Probab=100.00  E-value=1e-51  Score=385.19  Aligned_cols=235  Identities=29%  Similarity=0.491  Sum_probs=204.5

Q ss_pred             ChhhhhhCCC-ceeeEeeccccccccCCCCCcccc----ccCcCCCCCCC----CCcccceeccccccCccccCCCC-CC
Q psy14903          1 MQKALVNDKC-NIIGYTAWSILDNFEWLDGYTISQ----ADDLRSLGSPP----AGSWVPISMISKSAHPIYSETGD-YP   70 (241)
Q Consensus         1 ~~~~~~~~g~-~~~~~~~w~~~~~~~~~~~~~~~~----f~dy~~~~~~~----VkyW~TfNEpn~~~~~~y~~~G~-~p   70 (241)
                      |.++|++.|| |+|||+||++|+++..++||.++.    |++|++.|+++    ||||+||||| +++..+|. .|. +|
T Consensus       112 lId~Ll~~GIeP~VTL~H~DlP~~L~~~GGW~nr~~v~~F~~YA~~~f~~fgdrVk~W~T~NEp-~~~~~gy~-~g~~~~  189 (487)
T 3vii_A          112 LINELLANGIEPMVTMYHWDLPQALQDLGGWPNLVLAKYSENYARVLFKNFGDRVKLWLTFNEP-LTFMDGYA-SEIGMA  189 (487)
T ss_dssp             HHHHHHHTTCEEEEEEESSCCBHHHHTTTSTTSTHHHHHHHHHHHHHHHHHTTTCCEEEEEECH-HHHGGGGB-CTTSST
T ss_pred             HHHHHHHCCCEEEEEEecCCCcHHHHHcCCCCCHHHHHHHHHHHHHHHHHhcCCCCeEEEecCc-hhhhcccc-cccccC
Confidence            4578999999 999999999999999888888874    99999999876    9999999999 88888998 788 99


Q ss_pred             hhHHh---HHHHHHHHhcccccccchhhHHHHh-hcCCcEEEEecCCcceeCCCCCHHhHHHHHHHHHHhcCcccccccc
Q psy14903         71 PIVRQ---IVDQNSAKEGRARSRLPRFTEEEIK-ALKGKVSITLDSSNYYPHNATSKEDQEAAERVFQFTLGLFAHPIYS  146 (241)
Q Consensus        71 pg~~~---~~~q~~hn~llAHa~a~~~~k~~~~-~~~~kIG~~~~~~~~~P~~~~~~~D~~aa~~~~~~~~~~~~dp~~~  146 (241)
                      |+..+   ...|+.||+++|||+|++++|++.+ .++++||++++..++||.++ +|+|++||+++++|.++||+||++.
T Consensus       190 Pg~~~~~~~~~~~~h~~llAha~Av~~~r~~~~~~~~~~IGi~l~~~~~~P~~~-~p~D~~Aa~~~~~~~~~~f~dpi~~  268 (487)
T 3vii_A          190 PSINTPGIGDYLAAHTVIHAHARIYHLYDQEFRAEQGGKVGISLNINWCEPATN-SAEDRASCENYQQFNLGLYAHPIFT  268 (487)
T ss_dssp             TCCBCTTTHHHHHHHHHHHHHHHHHHHHHHHTHHHHCCEEEEEEECCEEEESSS-CHHHHHHHHHHHHHHTHHHHHHHHS
T ss_pred             CcccccHHHHHHHHHHHHHHHHHHHHHHHHhcccCCCCeEEEEecCCccCCCCc-CHHHHHHHHHHHHHhhhhhhhhHhc
Confidence            99653   2569999999999999999999863 46899999999999999997 9999999999999999999999993


Q ss_pred             cCCCCChHHHHHHhhhhhccccCCCCCCCCCHHHHHHhcCCccEEEEccccccccccCCCCCCCCCCcccccccccccCC
Q psy14903        147 EAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSILIANNNQSSNAPPSIINDRAATYSQDP  226 (241)
Q Consensus       147 ~~G~YP~~~~~~l~~~~~~~~~~~~~~p~~~~~d~~~i~~~~DFiG~NYYts~~v~~~~~~~~~~~~~~~~~~~~~~~~~  226 (241)
                      +.|+||+.|++.+++++..+|++.+++|.|+++|+++|++++||||||||+|.+|+......  .+++..+..+....+|
T Consensus       269 ~~G~YP~~~~~~~~~~~~~~g~~~~~~p~~~~~d~~~i~~~~DFlGiNyY~~~~v~~~~~~~--~~~~~~~~~~~~~~~~  346 (487)
T 3vii_A          269 EEGDYPAVLKDRVSRNSADEGYTDSRLPQFTAEEVEYIRGTHDFLGINFYTALLGKSGVEGY--EPSRYRDSGVILTQDA  346 (487)
T ss_dssp             SSCSSCHHHHHHHHHHHHHTTCSSCSSCCCCHHHHHHHTTCCSCEEEECCCEEEEESSCCSC--SSCHHHHHTCEEECCT
T ss_pred             cCCCCCHHHHHHHHhhccccccccccCCCCCHHHHHHhcCCCcEEEEecccceeeccCCCCC--CCCcccccccccccCC
Confidence            23999999999999887778888788999999999999999999999999999998654211  1333344445556778


Q ss_pred             CCCCCCCCceeecc
Q psy14903        227 NWPSSNSPWLKRSI  240 (241)
Q Consensus       227 ~~~~~~~~w~~~~~  240 (241)
                      .|+.|.++||.++|
T Consensus       347 ~~~~t~~gW~~i~P  360 (487)
T 3vii_A          347 AWPISASSWLKVVP  360 (487)
T ss_dssp             TSCCCSSTTCCCCH
T ss_pred             CCCCCcCcccccCH
Confidence            99999999998877
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Back     alignment and structure
>4atd_A Raucaffricine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.10A {Rauvolfia serpentina} PDB: 4a3y_A 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scr_A* 3scs_A* 3scp_A* 3scq_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Back     alignment and structure
>4b3l_A Beta-glucosidase; hydrolase, glycosidase, carbohydrate-active enzyme; 2.51A {Streptococcus pyogenes} PDB: 4b3k_A Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} SCOP: c.1.8.0 PDB: 4gze_A Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Back     alignment and structure
>4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Back     alignment and structure
>1uwi_A Beta-galactosidase; hydrolase, beta-glycosidase, glycosidase; 2.55A {Sulfolobus solfataricus} SCOP: c.1.8.4 PDB: 1gow_A Back     alignment and structure
>4ha4_A Beta-galactosidase; TIM barrel, beta-glycosidase, hydrolase; HET: GOL PG6; 1.37A {Acidilobus saccharovorans} PDB: 4ha3_A* 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 4eam_A 4ean_A Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>1uwi_A Beta-galactosidase; hydrolase, beta-glycosidase, glycosidase; 2.55A {Sulfolobus solfataricus} SCOP: c.1.8.4 PDB: 1gow_A Back     alignment and structure
>4ha4_A Beta-galactosidase; TIM barrel, beta-glycosidase, hydrolase; HET: GOL PG6; 1.37A {Acidilobus saccharovorans} PDB: 4ha3_A* 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 4eam_A 4ean_A Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Back     alignment and structure
>4b3l_A Beta-glucosidase; hydrolase, glycosidase, carbohydrate-active enzyme; 2.51A {Streptococcus pyogenes} PDB: 4b3k_A Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} SCOP: c.1.8.0 PDB: 4gze_A Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Back     alignment and structure
>4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Back     alignment and structure
>4atd_A Raucaffricine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.10A {Rauvolfia serpentina} PDB: 4a3y_A 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scr_A* 3scs_A* 3scp_A* 3scq_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Back     alignment and structure
>1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Back     alignment and structure
>1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 241
d1wcga1 462 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid ( 8e-16
d1wcga1462 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid ( 9e-10
d1e4mm_499 c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) { 6e-10
d1e4mm_ 499 c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) { 1e-08
d1cbga_ 490 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 7e-10
d1cbga_490 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 1e-08
d1e4ia_447 c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa 5e-09
d1e4ia_ 447 c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa 3e-04
d1qoxa_449 c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulan 5e-09
d1qoxa_ 449 c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulan 1e-05
d1pbga_468 c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL 6e-09
d1pbga_ 468 c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL 6e-08
d1gnxa_464 c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. 7e-09
d1gnxa_ 464 c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. 2e-06
d2j78a1443 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga m 7e-09
d2j78a1 443 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga m 2e-07
d1uwsa_489 c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus 8e-09
d1ug6a_426 c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophi 9e-09
d1vffa1423 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyr 9e-09
d1v02a_484 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 9e-09
d1qvba_481 c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermospha 1e-08
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Length = 462 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Family 1 of glycosyl hydrolase
domain: Thioglucosidase
species: Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]

 Score = 73.7 bits (180), Expect = 8e-16
 Identities = 64/185 (34%), Positives = 92/185 (49%), Gaps = 7/185 (3%)

Query: 51  PISMISKSAHPIYSETGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGKVSITL 110
           PI++    +   Y+   +       +             RL    E       GK+SI++
Sbjct: 166 PIAVCKGYSIKAYAPNLNLKTTGHYLAGHTQLIAHGKAYRLYE--EMFKPTQNGKISISI 223

Query: 111 DSSNYYPHNATSKEDQEAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRAR 170
               + P NA S +D E AER  QF  G F HP+Y   GDYPPI+++ VDQ S +EG   
Sbjct: 224 SGVFFMPKNAESDDDIETAERANQFERGWFGHPVYK--GDYPPIMKKWVDQKSKEEGLPW 281

Query: 171 SRLPRFTEEEIKALKGSFDFFALNHYTSILIANNNQSSNAPPSIINDRAATYSQDPNWPS 230
           S+LP+FT++EIK LKG+ DF+ALNHY+S L+   +   +  P+   D +   S D  W  
Sbjct: 282 SKLPKFTKDEIKLLKGTADFYALNHYSSRLVTFGS---DPNPNFNPDASYVTSVDEAWLK 338

Query: 231 SNSPW 235
            N   
Sbjct: 339 PNETP 343
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Length = 462 Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Length = 499 Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Length = 499 Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Length = 490 Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Length = 490 Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Length = 447 Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Length = 447 Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Length = 449 Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Length = 449 Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Length = 468 Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Length = 468 Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Length = 464 Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Length = 464 Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Length = 443 Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Length = 443 Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 489 Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Length = 426 Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 423 Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Length = 484 Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Length = 481 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query241
d1qoxa_ 449 Beta-glucosidase A {Bacillus circulans, subsp. alk 100.0
d1wcga1 462 Thioglucosidase {Cabbage aphid (Brevicoryne brassi 100.0
d1v02a_ 484 Plant beta-glucosidase (myrosinase) {Sorghum bicol 100.0
d1gnxa_ 464 Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] 100.0
d1e4ia_ 447 Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 100.0
d1pbga_ 468 6-phospho-beta-D-galactosidase, PGAL {Lactococcus 100.0
d1cbga_ 490 Plant beta-glucosidase (myrosinase) {Creeping whit 100.0
d2j78a1 443 Beta-glucosidase A {Thermotoga maritima [TaxId: 23 100.0
d1e4mm_ 499 Plant beta-glucosidase (myrosinase) {White mustard 100.0
d1ug6a_ 426 Beta-glucosidase A {Thermus thermophilus [TaxId: 2 100.0
d1uwsa_ 489 beta-Glycosidase {Archaeon Sulfolobus solfataricus 100.0
d1vffa1 423 Beta-glucosidase A {Archaeon Pyrococcus horikoshii 100.0
d1qvba_ 481 beta-Glycosidase {Archaeon Thermosphaera aggregans 99.98
d1wcga1462 Thioglucosidase {Cabbage aphid (Brevicoryne brassi 97.66
d1qoxa_449 Beta-glucosidase A {Bacillus circulans, subsp. alk 97.56
d1e4ia_447 Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 97.5
d1vffa1423 Beta-glucosidase A {Archaeon Pyrococcus horikoshii 97.5
d1pbga_468 6-phospho-beta-D-galactosidase, PGAL {Lactococcus 97.46
d2j78a1443 Beta-glucosidase A {Thermotoga maritima [TaxId: 23 97.4
d1uwsa_489 beta-Glycosidase {Archaeon Sulfolobus solfataricus 97.37
d1e4mm_499 Plant beta-glucosidase (myrosinase) {White mustard 97.37
d1gnxa_464 Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] 97.37
d1qvba_481 beta-Glycosidase {Archaeon Thermosphaera aggregans 97.32
d1cbga_490 Plant beta-glucosidase (myrosinase) {Creeping whit 97.25
d1v02a_484 Plant beta-glucosidase (myrosinase) {Sorghum bicol 97.22
d1ug6a_426 Beta-glucosidase A {Thermus thermophilus [TaxId: 2 97.1
d1kwga2393 A4 beta-galactosidase {Thermus thermophilus [TaxId 95.78
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Family 1 of glycosyl hydrolase
domain: Beta-glucosidase A
species: Bacillus circulans, subsp. alkalophilus [TaxId: 1397]

Probab=100.00  E-value=1.2e-45  Score=340.71  Aligned_cols=218  Identities=18%  Similarity=0.247  Sum_probs=188.8

Q ss_pred             ChhhhhhCCC-ceeeEeeccccccccCCCCCcccc----ccCcCCCCCCC----CCcccceeccccccCccccCCCCCCh
Q psy14903          1 MQKALVNDKC-NIIGYTAWSILDNFEWLDGYTISQ----ADDLRSLGSPP----AGSWVPISMISKSAHPIYSETGDYPP   71 (241)
Q Consensus         1 ~~~~~~~~g~-~~~~~~~w~~~~~~~~~~~~~~~~----f~dy~~~~~~~----VkyW~TfNEpn~~~~~~y~~~G~~pp   71 (241)
                      |.++|++.|| |+|||+||++|.|+...+||.++.    |++|++.|+++    |++|+||||||+++..+|. .|.+||
T Consensus       103 ~i~~l~~~gi~P~vTL~H~d~P~~l~~~gGw~~~~~~~~F~~Ya~~v~~~fgd~V~~W~T~NEP~~~~~~gy~-~g~~~P  181 (449)
T d1qoxa_         103 LVDELLANGIEPFCTLYHWDLPQALQDQGGWGSRITIDAFAEYAELMFKELGGKIKQWITFNEPWCMAFLSNY-LGVHAP  181 (449)
T ss_dssp             HHHHHHHTTCEEEEEEESSCCBHHHHTTTGGGSTHHHHHHHHHHHHHHHHHTTTCCEEEEEECHHHHHHHHHT-SCSSTT
T ss_pred             HHHHHHhcCCeEEEEEecccccchhccccCcCCHHHHHHHHHHHHHHHHHhcccccceEEecCcceecccccc-ccccCc
Confidence            4678999999 999999999999999999999884    99999988876    9999999999999999998 899999


Q ss_pred             hHHhHH--HHHHHHhcccccccchhhHHHHhhcCCcEEEEecCCcceeCCCCCHHhHHHHHHHHHHhcCcccccccccCC
Q psy14903         72 IVRQIV--DQNSAKEGRARSRLPRFTEEEIKALKGKVSITLDSSNYYPHNATSKEDQEAAERVFQFTLGLFAHPIYSEAG  149 (241)
Q Consensus        72 g~~~~~--~q~~hn~llAHa~a~~~~k~~~~~~~~kIG~~~~~~~~~P~~~~~~~D~~aa~~~~~~~~~~~~dp~~~~~G  149 (241)
                      +.++..  .+++||+++||++|++++|+..  ++++||++++..+++|.++ +++|+.||++++.+.++||+||++.  |
T Consensus       182 g~~~~~~~~~~~~~~~~Aha~a~~~~~~~~--~~~~vgi~~~~~~~~p~~~-~~~d~~Aa~~~~~~~~~~~~dp~~~--G  256 (449)
T d1qoxa_         182 GNKDLQLAIDVSHHLLVAHGRAVTLFRELG--ISGEIGIAPNTSWAVPYRR-TKEDMEACLRVNGWSGDWYLDPIYF--G  256 (449)
T ss_dssp             CCCCHHHHHHHHHHHHHHHHHHHHHHHHTT--CCSEEEEECCCCEEEESSS-CHHHHHHHHHHHHTTTHHHHHHHHT--S
T ss_pred             ccccHHHHHHHHHHHHHHHHHHHHHHHhhC--CCceeeeeccccccccCCh-HHHHHHHHHHHHHhhcccccCceec--C
Confidence            987653  4999999999999999999874  6899999999999999996 9999999999999999999999999  9


Q ss_pred             CCChHHHHHHhhhhhccccCCCCCCCCCHHHHHHhcCCccEEEEccccccccccCCCCCCCCCCcccccccccccCCCCC
Q psy14903        150 DYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSILIANNNQSSNAPPSIINDRAATYSQDPNWP  229 (241)
Q Consensus       150 ~YP~~~~~~l~~~~~~~~~~~~~~p~~~~~d~~~i~~~~DFiG~NYYts~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~  229 (241)
                      +||..+++.++..        +.+|.++++|++.+++++||||+|||++.+|+.......   ...    ......+.++
T Consensus       257 ~yp~~~~~~~~~~--------~~~p~~~~~d~~~i~~~~DFlGiNyYt~~~v~~~~~~~~---~~~----~~~~~~~~~~  321 (449)
T d1qoxa_         257 EYPKFMLDWYENL--------GYKPPIVDGDMELIHQPIDFIGINYYTSSMNRYNPGEAG---GML----SSEAISMGAP  321 (449)
T ss_dssp             SCCHHHHHHHHHH--------TCCCCCCTTHHHHHCCCCSEEEEECSCEEEEEECSSGGG---TTT----TEEECCCCCC
T ss_pred             CCcHHHHHHHHhc--------cccccCCHHHHHHhcCCcccceecccccceeecCCcccc---Ccc----cccccCCCCc
Confidence            9999999999876        588999999999999999999999999999987553211   000    1122344567


Q ss_pred             CCCCCceeecc
Q psy14903        230 SSNSPWLKRSI  240 (241)
Q Consensus       230 ~~~~~w~~~~~  240 (241)
                      .|.++| .++|
T Consensus       322 ~td~gw-ei~P  331 (449)
T d1qoxa_         322 KTDIGW-EIYA  331 (449)
T ss_dssp             BCTTSC-BCCT
T ss_pred             cCCCCC-eeec
Confidence            777777 4444
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure