Psyllid ID: psy15003

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------
MSRISHLELVPGYEIDKVTPPSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFYKEINAEKSQTFVRERNIEILIKKTDDDKTYWPHLTKEKNKYHWLKVDFNKWKDEDDSDDENNGGNFEDVAGFLLENSPAWDILYQIVYNFNSLVVSRSTYYQPKAVTPPSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFYKEINAEKSQTFVRERNIEILIKKTDDDKTYWPHLTKEKNKYHWLKVDFNKWKDEDDSDDENNGGNFEDVSISFLIFISTCTYL
ccccccccccccccccccccccEEEEEEccEEEEEEEEcccccccEEEEEcEEEEEEEEcccccEEEEEEcccccccccccEEEEEccEEEEEEEEccccccccccccccccccccEEEccccccccccccccccccccccHHHHHHccccccHHHHHHHccccccccccccccccccccccccEEEEEccEEEEEEEEcccccccEEEEEcEEEEEEEEcccccEEEEEEEccccccccccEEEEEccEEEEEEEEccccccccccccccccccccEEEccccccccccccccccccccccccccccccEEccccc
cccEEEEEEcccccccccccHHHHHHHHHHEEEEEEEEccccccEEEEcccEEEEEEEcccccEEEEEEEEEEccccccHccEEccccEEEEEEEEcccccccccccEccccccccEEEcccccccccccccccccccHHHHHHHHHccccccccHHHccccccEEEEEccccccccccccccEEEEEcccEEEEEEEEccccccEEEEcccEEEEEEEccccccEEEEEEEEEccccccHccEcccccEEEEEEEEcccccccccccEccccccccEEEccccccccccccccccccccccccccHHHHHHccccc
msrishlelvpgyeidkvtppsvawaqRNHCIFLTICledcknptinldknqlyfdgiggtekkhhqvtipfYKEINAEKSQTFVRERNIEILIKktdddktywphltkeknkYHWLKVdfnkwkdeddsddennggnfedvagfllenspawdILYQIVYNFNSLVVsrstyyqpkavtppsvawaqRNHCIFLTICledcknptinldknqlyfdgiggtekkhhqvtipfYKEINAEKSQTFVRERNIEILIKktdddktywphltkeknkYHWLKVdfnkwkdeddsddennggnfedvsISFLIFISTCTYL
msrishlelvpgyeidKVTPPSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFYkeinaeksqtfvRERNIEIlikktdddktywphltkeknkyhwLKVDFNKWKDEDDSDDENNGGNFEDVAGFLLENSPAWDILYQIVYNFNSLVVSRSTYYQPKAVTPPSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFYkeinaeksqtfvRERNIEIlikktdddktywphltkeknkyhwLKVDFNKWKDEDDSDDennggnfedvsiSFLIFISTCTYL
MSRISHLELVPGYEIDKVTPPSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFYKEINAEKSQTFVRERNIEILIKKTDDDKTYWPHLTKEKNKYHWLKVdfnkwkdeddsddennggnfedVAGFLLENSPAWDILYQIVYNFNSLVVSRSTYYQPKAVTPPSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFYKEINAEKSQTFVRERNIEILIKKTDDDKTYWPHLTKEKNKYHWLKVdfnkwkdeddsddennggnfedVSISFLIFISTCTYL
******LELVPGYEIDKVTPPSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFYKEINAEKSQTFVRERNIEILIKKTDDDKTYWPHLTKEKNKYHWLKVDFNKWK************NFEDVAGFLLENSPAWDILYQIVYNFNSLVVSRSTYYQPKAVTPPSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFYKEINAEKSQTFVRERNIEILIKKTDDDKTYWPHLTKEKNKYHWLKVDFNKWK*************FEDVSISFLIFISTCTY*
*****************VTPPSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFYKEINAEKSQTFVRERNIEILIKKTDDDKTYWPHLTKEKNKYHWLKVDFNKWKDEDDSDDENNGGNFED*************************************VTPPSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFYKEINAEKSQTFVRERNIEILIKKTDDDKTYWPHLTKEKNKYHWLKVDFNKWKDE****************ISFLIFISTCTYL
MSRISHLELVPGYEIDKVTPPSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFYKEINAEKSQTFVRERNIEILIKKTDDDKTYWPHLTKEKNKYHWLKVDFNKWKD********NGGNFEDVAGFLLENSPAWDILYQIVYNFNSLVVSRSTYYQPKAVTPPSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFYKEINAEKSQTFVRERNIEILIKKTDDDKTYWPHLTKEKNKYHWLKVDFNKWKD********NGGNFEDVSISFLIFISTCTYL
*SRISHLELVPGYEIDKVTPPSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFYKEINAEKSQTFVRERNIEILIKKTDDDKTYWPHLTKEKNKYHWLKVDFNKWKDE********GGNFEDVAGFLLENSPAWDILYQIVYNFNSLVVSRSTYYQPKAVTPPSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFYKEINAEKSQTFVRERNIEILIKKTDDDKTYWPHLTKEKNKYHWLKVDFNKWKDE**********NFEDVSISFLIFISTCTYL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRISHLELVPGYEIDKVTPPSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFYKEINAEKSQTFVRERNIEILIKKTDDDKTYWPHLTKEKNKYHWLKVDFNKWKDEDDSDDENNGGNFEDVAGFLLENSPAWDILYQIVYNFNSLVVSRSTYYQPKAVTPPSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFYKEINAEKSQTFVRERNIEILIKKTDDDKTYWPHLTKEKNKYHWLKVDFNKWKDEDDSDDENNGGNFEDVSISFLIFISTCTYL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query317 2.2.26 [Sep-21-2011]
Q11118186 Protein wos2 OS=Schizosac yes N/A 0.347 0.591 0.389 2e-17
Q5NVM4160 Prostaglandin E synthase yes N/A 0.397 0.787 0.352 8e-16
Q6PWL5160 Prostaglandin E synthase N/A N/A 0.397 0.787 0.352 8e-16
Q15185160 Prostaglandin E synthase yes N/A 0.397 0.787 0.352 8e-16
Q3ZBF7160 Prostaglandin E synthase yes N/A 0.397 0.787 0.352 8e-16
P83868160 Prostaglandin E synthase yes N/A 0.362 0.718 0.367 3e-15
Q9R0Q7160 Prostaglandin E synthase yes N/A 0.362 0.718 0.367 3e-15
P28707216 Co-chaperone protein SBA1 yes N/A 0.388 0.569 0.360 1e-14
Q23280175 Uncharacterized protein Z yes N/A 0.318 0.577 0.386 2e-13
Q90955146 Prostaglandin E synthase yes N/A 0.353 0.767 0.352 3e-13
>sp|Q11118|WOS2_SCHPO Protein wos2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wos2 PE=2 SV=1 Back     alignment and function desciption
 Score = 90.1 bits (222), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 69/118 (58%), Gaps = 8/118 (6%)

Query: 21  PSVAWAQRNH-------CIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFY 73
           P V WAQR++        I+LT+ + D  +P INL   +L  D   G    H+ V I F+
Sbjct: 8   PEVLWAQRSNKDDAEKNVIYLTVLIPDAVDPKINLTPEKLVIDSKSGA-NAHYAVQIDFF 66

Query: 74  KEINAEKSQTFVRERNIEILIKKTDDDKTYWPHLTKEKNKYHWLKVDFNKWKDEDDSD 131
           K+I+ EKS+  V  R I  ++ K +  + +WP LTKEK + HWL+ DF++W DED+ +
Sbjct: 67  KDIDVEKSKYSVTGRYIFFVLYKKELQEEFWPRLTKEKLRLHWLRTDFDRWVDEDEQE 124
Cell cycle regulatory protein that interacts with cdc2 in the control of the M-G1 transition.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|Q5NVM4|TEBP_PONAB Prostaglandin E synthase 3 OS=Pongo abelii GN=PTGES3 PE=2 SV=1 Back     alignment and function description
>sp|Q6PWL5|TEBP_MACFA Prostaglandin E synthase 3 OS=Macaca fascicularis GN=PTGES3 PE=1 SV=1 Back     alignment and function description
>sp|Q15185|TEBP_HUMAN Prostaglandin E synthase 3 OS=Homo sapiens GN=PTGES3 PE=1 SV=1 Back     alignment and function description
>sp|Q3ZBF7|TEBP_BOVIN Prostaglandin E synthase 3 OS=Bos taurus GN=PTGES3 PE=1 SV=1 Back     alignment and function description
>sp|P83868|TEBP_RAT Prostaglandin E synthase 3 OS=Rattus norvegicus GN=Ptges3 PE=1 SV=2 Back     alignment and function description
>sp|Q9R0Q7|TEBP_MOUSE Prostaglandin E synthase 3 OS=Mus musculus GN=Ptges3 PE=1 SV=1 Back     alignment and function description
>sp|P28707|SBA1_YEAST Co-chaperone protein SBA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SBA1 PE=1 SV=3 Back     alignment and function description
>sp|Q23280|YOCA_CAEEL Uncharacterized protein ZC395.10 OS=Caenorhabditis elegans GN=ZC395.10 PE=3 SV=1 Back     alignment and function description
>sp|Q90955|TEBP_CHICK Prostaglandin E synthase 3 (Fragment) OS=Gallus gallus GN=PTGES3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query317
345497202179 PREDICTED: protein wos2-like isoform 2 [ 0.397 0.703 0.550 7e-35
156541996178 PREDICTED: protein wos2-like isoform 1 [ 0.416 0.741 0.525 1e-34
91082187172 PREDICTED: similar to conserved hypothet 0.359 0.662 0.587 3e-33
193716233210 PREDICTED: protein wos2-like [Acyrthosip 0.356 0.538 0.548 4e-30
324455341164 nuclear progesterone receptor [Penaeus m 0.328 0.634 0.588 5e-30
386376741164 cytosolic prostaglandin E synthase [Pena 0.331 0.640 0.566 1e-29
357239882164 P23 [Litopenaeus vannamei] 0.331 0.640 0.556 1e-29
410591541180 progesterone-like protein 2, partial [Po 0.340 0.6 0.550 2e-29
321457269169 hypothetical protein DAPPUDRAFT_203299 [ 0.381 0.715 0.483 3e-29
307199051170 Uncharacterized protein CG16817 [Harpegn 0.403 0.752 0.480 4e-29
>gi|345497202|ref|XP_003427934.1| PREDICTED: protein wos2-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  154 bits (388), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 98/129 (75%), Gaps = 3/129 (2%)

Query: 12  GYEIDKVTPPSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIP 71
           G + D VTPP V WAQR++ +F+TICLEDCKNPTI ++ +++YF G+GGTEKK H+VTI 
Sbjct: 2   GDQADVVTPPPVMWAQRSNLLFVTICLEDCKNPTIRIEADKVYFKGVGGTEKKEHEVTIN 61

Query: 72  FYKEINAEKSQTFVRERNIEILIKKTDDDKTYWPHLTKEKNKYHWLKVDFNKWKDEDDSD 131
            YKEI+++K+    + RN E+++ K  +   +WP LTKE  K+HWLK DFNKW+DEDDS+
Sbjct: 62  LYKEIDSDKAVQSPKGRNFELVLYKK-ESGPFWPRLTKENKKFHWLKSDFNKWQDEDDSE 120

Query: 132 DENNGGNFE 140
           +E  GGN +
Sbjct: 121 EE--GGNMD 127

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|156541996|ref|XP_001600168.1| PREDICTED: protein wos2-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|91082187|ref|XP_971460.1| PREDICTED: similar to conserved hypothetical protein [Tribolium castaneum] gi|270007441|gb|EFA03889.1| hypothetical protein TcasGA2_TC014013 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|193716233|ref|XP_001951884.1| PREDICTED: protein wos2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|324455341|gb|ADY38993.1| nuclear progesterone receptor [Penaeus monodon] Back     alignment and taxonomy information
>gi|386376741|gb|AFJ11394.1| cytosolic prostaglandin E synthase [Penaeus monodon] Back     alignment and taxonomy information
>gi|357239882|gb|AET71738.1| P23 [Litopenaeus vannamei] Back     alignment and taxonomy information
>gi|410591541|gb|AFV74662.1| progesterone-like protein 2, partial [Portunus trituberculatus] Back     alignment and taxonomy information
>gi|321457269|gb|EFX68359.1| hypothetical protein DAPPUDRAFT_203299 [Daphnia pulex] Back     alignment and taxonomy information
>gi|307199051|gb|EFN79775.1| Uncharacterized protein CG16817 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query317
POMBASE|SPAC9E9.13186 wos2 "p23 homolog, predicted c 0.305 0.521 0.380 3e-14
WB|WBGene00022599175 ZC395.10.2 [Caenorhabditis ele 0.299 0.542 0.36 2.7e-12
UNIPROTKB|Q3ZBF7160 PTGES3 "Prostaglandin E syntha 0.312 0.618 0.32 1e-11
UNIPROTKB|B4DP11139 PTGES3 "cDNA FLJ59942, highly 0.312 0.712 0.32 1e-11
UNIPROTKB|Q15185160 PTGES3 "Prostaglandin E syntha 0.312 0.618 0.32 1e-11
UNIPROTKB|F1SL99160 LOC100155956 "Uncharacterized 0.312 0.618 0.32 1e-11
RGD|1561913160 Ptges3 "prostaglandin E syntha 0.312 0.618 0.32 1e-11
UNIPROTKB|G4MKS2209 MGG_06669 "Uncharacterized pro 0.321 0.488 0.339 3.1e-11
UNIPROTKB|Q90955146 PTGES3 "Prostaglandin E syntha 0.274 0.595 0.318 4.3e-10
SGD|S000001600216 SBA1 "Co-chaperone that binds 0.324 0.476 0.344 4.8e-10
POMBASE|SPAC9E9.13 wos2 "p23 homolog, predicted co-chaperone Wos2" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
 Score = 183 (69.5 bits), Expect = 3.0e-14, P = 3.0e-14
 Identities = 40/105 (38%), Positives = 59/105 (56%)

Query:    21 PSVAWAQRNH-------CIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFY 73
             P V WAQR++        I+LT+ + D  +P INL   +L  D   G    H+ V I F+
Sbjct:     8 PEVLWAQRSNKDDAEKNVIYLTVLIPDAVDPKINLTPEKLVIDSKSGANA-HYAVQIDFF 66

Query:    74 KEINAEKSQTFVRERNIEILIKKTDDDKTYWPHLTKEKNKYHWLK 118
             K+I+ EKS+  V  R I  ++ K +  + +WP LTKEK + HWL+
Sbjct:    67 KDIDVEKSKYSVTGRYIFFVLYKKELQEEFWPRLTKEKLRLHWLR 111
GO:0005515 "protein binding" evidence=IPI
GO:0005634 "nucleus" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0006457 "protein folding" evidence=ISO
GO:0007346 "regulation of mitotic cell cycle" evidence=IGI
GO:0032212 "positive regulation of telomere maintenance via telomerase" evidence=ISO
GO:0051087 "chaperone binding" evidence=ISO
WB|WBGene00022599 ZC395.10.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBF7 PTGES3 "Prostaglandin E synthase 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B4DP11 PTGES3 "cDNA FLJ59942, highly similar to Prostaglandin E synthase 3 (EC 5.3.99.3)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q15185 PTGES3 "Prostaglandin E synthase 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SL99 LOC100155956 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1561913 Ptges3 "prostaglandin E synthase 3 (cytosolic)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G4MKS2 MGG_06669 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|Q90955 PTGES3 "Prostaglandin E synthase 3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
SGD|S000001600 SBA1 "Co-chaperone that binds to and regulates Hsp90 family chaperones" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query317
cd06465108 cd06465, p23_hB-ind1_like, p23_like domain found i 4e-44
cd06465108 cd06465, p23_hB-ind1_like, p23_like domain found i 4e-44
cd00237106 cd00237, p23, p23 binds heat shock protein (Hsp)90 5e-15
cd00237106 cd00237, p23, p23 binds heat shock protein (Hsp)90 5e-15
cd0646384 cd06463, p23_like, Proteins containing this p23_li 2e-11
cd0646384 cd06463, p23_like, Proteins containing this p23_li 2e-11
pfam0496978 pfam04969, CS, CS domain 3e-05
pfam0496978 pfam04969, CS, CS domain 3e-05
cd0029880 cd00298, ACD_sHsps_p23-like, This domain family in 6e-04
cd0029880 cd00298, ACD_sHsps_p23-like, This domain family in 6e-04
>gnl|CDD|107222 cd06465, p23_hB-ind1_like, p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins Back     alignment and domain information 
 Score =  146 bits (370), Expect = 4e-44
 Identities = 52/109 (47%), Positives = 69/109 (63%), Gaps = 1/109 (0%)

Query: 21  PSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFYKEINAEK 80
           P V WAQR+  ++LTI L D K+P I L+   L F   GG   K ++  + FYKEI+ E+
Sbjct: 1   PPVLWAQRSDVVYLTIELPDAKDPKIKLEPTSLSFKAKGGGGGKKYEFDLEFYKEIDPEE 60

Query: 81  SQTFVRERNIEILIKKTDDDKTYWPHLTKEKNKYHWLKVDFNKWKDEDD 129
           S+  V  R IE +++K  +   YWP LTKEK K  WLKVDF+KW DED+
Sbjct: 61  SKYKVTGRQIEFVLRK-KEAGEYWPRLTKEKGKLPWLKVDFDKWVDEDE 108

hB-ind1 participates in signaling by the small GTPase Rac1. It binds to Rac1 and enhances different Rac1 effects including activation of nuclear factor (NF) kappaB and activation of c-Jun N-terminal kinase (JNK). hB-ind1 also plays a part in the RNA replication and particle production of Hepatitis C virus (HCV) through its interaction with heat shock protein Hsp90, HCV nonstructural protein 5A (NS5A), and the immunophilin FKBP8. hB-ind1 is upregulated in the outer layer of Chinese hamster V79 cells grown as multicell spheroids, versus in the same cells grown as monolayers. This group includes the Saccharomyces cerevisiae Sba1, a co-chaperone of the Hsp90. Sba1 has been shown to be is required for telomere length maintenance, and may modulate telomerase DNA-binding activity. Length = 108
>gnl|CDD|107222 cd06465, p23_hB-ind1_like, p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins Back     alignment and domain information
>gnl|CDD|107218 cd00237, p23, p23 binds heat shock protein (Hsp)90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor Back     alignment and domain information
>gnl|CDD|107218 cd00237, p23, p23 binds heat shock protein (Hsp)90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor Back     alignment and domain information
>gnl|CDD|107220 cd06463, p23_like, Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>gnl|CDD|107220 cd06463, p23_like, Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>gnl|CDD|218355 pfam04969, CS, CS domain Back     alignment and domain information
>gnl|CDD|218355 pfam04969, CS, CS domain Back     alignment and domain information
>gnl|CDD|107219 cd00298, ACD_sHsps_p23-like, This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>gnl|CDD|107219 cd00298, ACD_sHsps_p23-like, This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 317
KOG3158|consensus180 100.0
cd00237106 p23 p23 binds heat shock protein (Hsp)90 and parti 100.0
cd00237106 p23 p23 binds heat shock protein (Hsp)90 and parti 99.97
KOG3158|consensus180 99.96
cd06465108 p23_hB-ind1_like p23_like domain found in human (h 99.95
cd06465108 p23_hB-ind1_like p23_like domain found in human (h 99.94
cd0648887 p23_melusin_like p23_like domain similar to the C- 99.82
cd0648984 p23_CS_hSgt1_like p23_like domain similar to the C 99.82
cd0648984 p23_CS_hSgt1_like p23_like domain similar to the C 99.81
cd0648887 p23_melusin_like p23_like domain similar to the C- 99.81
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.78
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.76
cd0646892 p23_CacyBP p23_like domain found in proteins simil 99.73
KOG1309|consensus196 99.72
cd0646892 p23_CacyBP p23_like domain found in proteins simil 99.72
cd0646684 p23_CS_SGT1_like p23_like domain similar to the C- 99.72
cd0646684 p23_CS_SGT1_like p23_like domain similar to the C- 99.72
KOG1309|consensus196 99.66
PF0496979 CS: CS domain; InterPro: IPR017447 The function of 99.64
PF0496979 CS: CS domain; InterPro: IPR017447 The function of 99.61
cd0646384 p23_like Proteins containing this p23_like domain 99.61
cd0646978 p23_DYX1C1_like p23_like domain found in proteins 99.61
cd0646978 p23_DYX1C1_like p23_like domain found in proteins 99.61
cd0649385 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear 99.6
cd0646785 p23_NUDC_like p23_like domain of NUD (nuclear dist 99.6
cd0646384 p23_like Proteins containing this p23_like domain 99.6
cd0649287 p23_mNUDC_like p23-like NUD (nuclear distribution) 99.53
cd0646785 p23_NUDC_like p23_like domain of NUD (nuclear dist 99.53
KOG1667|consensus320 99.53
cd06495102 p23_NUDCD3_like p23-like NUD (nuclear distribution 99.53
cd0649087 p23_NCB5OR p23_like domain found in NAD(P)H cytoch 99.52
cd0649087 p23_NCB5OR p23_like domain found in NAD(P)H cytoch 99.52
cd0649493 p23_NUDCD2_like p23-like NUD (nuclear distribution 99.49
cd0649385 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear 99.49
KOG1667|consensus320 99.42
KOG2265|consensus179 99.28
cd0649287 p23_mNUDC_like p23-like NUD (nuclear distribution) 99.18
cd0649493 p23_NUDCD2_like p23-like NUD (nuclear distribution 99.13
cd06495102 p23_NUDCD3_like p23-like NUD (nuclear distribution 98.94
KOG3260|consensus224 98.92
cd0029880 ACD_sHsps_p23-like This domain family includes the 98.89
cd0029880 ACD_sHsps_p23-like This domain family includes the 98.89
COG5091368 SGT1 Suppressor of G2 allele of skp1 and related p 98.63
COG5091368 SGT1 Suppressor of G2 allele of skp1 and related p 98.46
KOG3260|consensus224 98.44
KOG2265|consensus179 97.93
COG0071146 IbpA Molecular chaperone (small heat shock protein 97.52
KOG4379|consensus 596 97.36
COG0071146 IbpA Molecular chaperone (small heat shock protein 97.36
cd0647292 ACD_ScHsp26_like Alpha crystallin domain (ACD) fou 97.21
cd0647292 ACD_ScHsp26_like Alpha crystallin domain (ACD) fou 97.13
cd0647193 ACD_LpsHSP_like Group of bacterial proteins contai 96.92
cd0647193 ACD_LpsHSP_like Group of bacterial proteins contai 96.89
KOG4379|consensus596 96.75
cd0646488 ACD_sHsps-like Alpha-crystallin domain (ACD) of al 96.7
cd0646488 ACD_sHsps-like Alpha-crystallin domain (ACD) of al 96.53
PF00011102 HSP20: Hsp20/alpha crystallin family This prints e 96.5
PF00011102 HSP20: Hsp20/alpha crystallin family This prints e 96.11
cd0652683 metazoan_ACD Alpha-crystallin domain (ACD) of meta 95.11
cd0647586 ACD_HspB1_like Alpha crystallin domain (ACD) found 95.1
cd0649786 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domai 95.05
cd0647090 ACD_IbpA-B_like Alpha-crystallin domain (ACD) foun 94.98
cd0647981 ACD_HspB7_like Alpha crystallin domain (ACD) found 94.9
PRK10743137 heat shock protein IbpA; Provisional 94.79
cd0649884 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domai 94.58
cd0652683 metazoan_ACD Alpha-crystallin domain (ACD) of meta 94.49
cd0647586 ACD_HspB1_like Alpha crystallin domain (ACD) found 94.37
cd0647090 ACD_IbpA-B_like Alpha-crystallin domain (ACD) foun 94.16
cd0647883 ACD_HspB4-5-6 Alpha-crystallin domain found in alp 94.03
cd0649786 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domai 93.97
cd0647981 ACD_HspB7_like Alpha crystallin domain (ACD) found 93.85
PRK10743137 heat shock protein IbpA; Provisional 93.32
PRK11597142 heat shock chaperone IbpB; Provisional 93.24
PRK11597142 heat shock chaperone IbpB; Provisional 92.9
cd0649884 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domai 92.37
cd0647683 ACD_HspB2_like Alpha crystallin domain (ACD) found 92.16
cd0647883 ACD_HspB4-5-6 Alpha-crystallin domain found in alp 91.96
cd0648187 ACD_HspB9_like Alpha crystallin domain (ACD) found 91.13
cd0647683 ACD_HspB2_like Alpha crystallin domain (ACD) found 89.23
PF08190328 PIH1: pre-RNA processing PIH1/Nop17 88.35
cd0648187 ACD_HspB9_like Alpha crystallin domain (ACD) found 87.33
PF08190328 PIH1: pre-RNA processing PIH1/Nop17 85.21
cd0648287 ACD_HspB10 Alpha crystallin domain (ACD) found in 84.64
cd0647783 ACD_HspB3_Like Alpha crystallin domain (ACD) found 83.1
>KOG3158|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.3e-34  Score=247.34  Aligned_cols=118  Identities=42%  Similarity=0.832  Sum_probs=110.8

Q ss_pred             cccCCCceEEEEeCCEEEEEEEecCCCCCeEEEeeCEEEEEEEeCCCCceEEEEEecccccccCCceEEeeCCeEEEEEE
Q psy15003         16 DKVTPPSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFYKEINAEKSQTFVRERNIEILIK   95 (317)
Q Consensus        16 ~~~~~p~v~W~Q~~~~V~ltI~~kd~~d~~V~~~~~~l~f~~~~~~~~~~y~~~l~L~~~I~pe~S~~~v~~rkIei~L~   95 (317)
                      ..+.+|.|.||||.+.|||||++.++++++|++++.+|+|+|+++++++.|.++|+||++|+|++|++++++|.|.+.|+
T Consensus         3 ~~~~~p~v~Waqr~~~vyltv~Ved~~d~~v~~e~~~l~fs~k~~~d~~~~~~~ief~~eIdpe~sk~k~~~r~if~i~~   82 (180)
T KOG3158|consen    3 AGMQPPEVKWAQRRDLVYLTVCVEDAKDVHVNLEPSKLTFSCKSGADNHKYENEIEFFDEIDPEKSKHKRTSRSIFCILR   82 (180)
T ss_pred             ccccCCcchhhhhcCeEEEEEEeccCccceeeccccEEEEEeccCCCceeeEEeeehhhhcCHhhccccccceEEEEEEE
Confidence            45679999999999999999999999999999999999999999888999999999999999999999999999999999


Q ss_pred             ecCCCCCCCCCcccccccccceeecCCCeeecCCCCcCC
Q psy15003         96 KTDDDKTYWPHLTKEKNKYHWLKVDFNKWKDEDDSDDEN  134 (317)
Q Consensus        96 K~~~~g~~WprL~k~~~K~~~l~~Dwdkw~~~dd~~~~~  134 (317)
                      |+++ +++||||++++.|||||++|||||+||||+++++
T Consensus        83 K~e~-~~~WprLtkeK~K~hwLkvDFdkW~Dededde~~  120 (180)
T KOG3158|consen   83 KKEL-GEYWPRLTKEKAKLHWLKVDFDKWVDEDEDDEAE  120 (180)
T ss_pred             cccc-ccccchhhhcccccceEEcchhhccccccccchh
Confidence            9995 5799999999999999999999999999665544

>cd00237 p23 p23 binds heat shock protein (Hsp)90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor Back     alignment and domain information
>cd00237 p23 p23 binds heat shock protein (Hsp)90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor Back     alignment and domain information
>KOG3158|consensus Back     alignment and domain information
>cd06465 p23_hB-ind1_like p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins Back     alignment and domain information
>cd06465 p23_hB-ind1_like p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins Back     alignment and domain information
>cd06488 p23_melusin_like p23_like domain similar to the C-terminal (tail) domain of vertebrate Melusin and related proteins Back     alignment and domain information
>cd06489 p23_CS_hSgt1_like p23_like domain similar to the C-terminal CS (CHORD-SGT1) domain of human (h) Sgt1 and related proteins Back     alignment and domain information
>cd06489 p23_CS_hSgt1_like p23_like domain similar to the C-terminal CS (CHORD-SGT1) domain of human (h) Sgt1 and related proteins Back     alignment and domain information
>cd06488 p23_melusin_like p23_like domain similar to the C-terminal (tail) domain of vertebrate Melusin and related proteins Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>cd06468 p23_CacyBP p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP) Back     alignment and domain information
>KOG1309|consensus Back     alignment and domain information
>cd06468 p23_CacyBP p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP) Back     alignment and domain information
>cd06466 p23_CS_SGT1_like p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>cd06466 p23_CS_SGT1_like p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>KOG1309|consensus Back     alignment and domain information
>PF04969 CS: CS domain; InterPro: IPR017447 The function of the CS domain is unknown Back     alignment and domain information
>PF04969 CS: CS domain; InterPro: IPR017447 The function of the CS domain is unknown Back     alignment and domain information
>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1 Back     alignment and domain information
>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1 Back     alignment and domain information
>cd06493 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear distribution) C-like domain found in human NUD (nuclear distribution) C domain-containing protein 1, NUDCD1 (also known as CML66), and similar proteins Back     alignment and domain information
>cd06467 p23_NUDC_like p23_like domain of NUD (nuclear distribution) C and similar proteins Back     alignment and domain information
>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>cd06492 p23_mNUDC_like p23-like NUD (nuclear distribution) C-like domain of mammalian(m) NUDC and similar proteins Back     alignment and domain information
>cd06467 p23_NUDC_like p23_like domain of NUD (nuclear distribution) C and similar proteins Back     alignment and domain information
>KOG1667|consensus Back     alignment and domain information
>cd06495 p23_NUDCD3_like p23-like NUD (nuclear distribution) C-like domain found in human NUDC domain-containing protein 3 (NUDCD3) and similar proteins Back     alignment and domain information
>cd06490 p23_NCB5OR p23_like domain found in NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR) and similar proteins Back     alignment and domain information
>cd06490 p23_NCB5OR p23_like domain found in NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR) and similar proteins Back     alignment and domain information
>cd06494 p23_NUDCD2_like p23-like NUD (nuclear distribution) C-like found in human NUDC domain-containing protein 2 (NUDCD2) and similar proteins Back     alignment and domain information
>cd06493 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear distribution) C-like domain found in human NUD (nuclear distribution) C domain-containing protein 1, NUDCD1 (also known as CML66), and similar proteins Back     alignment and domain information
>KOG1667|consensus Back     alignment and domain information
>KOG2265|consensus Back     alignment and domain information
>cd06492 p23_mNUDC_like p23-like NUD (nuclear distribution) C-like domain of mammalian(m) NUDC and similar proteins Back     alignment and domain information
>cd06494 p23_NUDCD2_like p23-like NUD (nuclear distribution) C-like found in human NUDC domain-containing protein 2 (NUDCD2) and similar proteins Back     alignment and domain information
>cd06495 p23_NUDCD3_like p23-like NUD (nuclear distribution) C-like domain found in human NUDC domain-containing protein 3 (NUDCD3) and similar proteins Back     alignment and domain information
>KOG3260|consensus Back     alignment and domain information
>cd00298 ACD_sHsps_p23-like This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>cd00298 ACD_sHsps_p23-like This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>COG5091 SGT1 Suppressor of G2 allele of skp1 and related proteins [General function prediction only] Back     alignment and domain information
>COG5091 SGT1 Suppressor of G2 allele of skp1 and related proteins [General function prediction only] Back     alignment and domain information
>KOG3260|consensus Back     alignment and domain information
>KOG2265|consensus Back     alignment and domain information
>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4379|consensus Back     alignment and domain information
>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>KOG4379|consensus Back     alignment and domain information
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>PF00011 HSP20: Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry Back     alignment and domain information
>PF00011 HSP20: Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry Back     alignment and domain information
>cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06475 ACD_HspB1_like Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins Back     alignment and domain information
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins Back     alignment and domain information
>PRK10743 heat shock protein IbpA; Provisional Back     alignment and domain information
>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa) Back     alignment and domain information
>cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06475 ACD_HspB1_like Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins Back     alignment and domain information
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information
>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins Back     alignment and domain information
>PRK10743 heat shock protein IbpA; Provisional Back     alignment and domain information
>PRK11597 heat shock chaperone IbpB; Provisional Back     alignment and domain information
>PRK11597 heat shock chaperone IbpB; Provisional Back     alignment and domain information
>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa) Back     alignment and domain information
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>cd06481 ACD_HspB9_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins Back     alignment and domain information
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>PF08190 PIH1: pre-RNA processing PIH1/Nop17 Back     alignment and domain information
>cd06481 ACD_HspB9_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins Back     alignment and domain information
>PF08190 PIH1: pre-RNA processing PIH1/Nop17 Back     alignment and domain information
>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins Back     alignment and domain information
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query317
1ejf_A125 Crystal Structure Of The Human Co-Chaperone P23 Len 9e-11
1ejf_A125 Crystal Structure Of The Human Co-Chaperone P23 Len 9e-11
2cg9_X134 Crystal Structure Of An Hsp90-Sba1 Closed Chaperone 6e-09
2cg9_X134 Crystal Structure Of An Hsp90-Sba1 Closed Chaperone 8e-08
2kmw_A150 Solution Structure Of At3g03773.1 Protein From Arab 7e-05
2kmw_A150 Solution Structure Of At3g03773.1 Protein From Arab 7e-05
>pdb|1EJF|A Chain A, Crystal Structure Of The Human Co-Chaperone P23 Length = 125 Back     alignment and structure 
Iteration: 1

 Score = 64.3 bits (155), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 56/102 (54%), Gaps = 1/102 (0%)
Query: 18  VTPPSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFYKEIN 77
           + P S  W  R   +F+  C+ED K+  +N +K++L F  +GG++   H   I  +  I+
Sbjct: 1   MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCID 60
Query: 78  AEKSQTFVRERNIEILIKKTDDDKTYWPHLTKEKNKYHWLKV 119
              S+    +R+I   ++K +  ++ WP LTKE+ K +WL V
Sbjct: 61  PNDSKHKRTDRSILCCLRKGESGQS-WPRLTKERAKLNWLSV 101
>pdb|1EJF|A Chain A, Crystal Structure Of The Human Co-Chaperone P23 Length = 125 Back     alignment and structure
>pdb|2CG9|X Chain X, Crystal Structure Of An Hsp90-Sba1 Closed Chaperone Complex Length = 134 Back     alignment and structure
>pdb|2CG9|X Chain X, Crystal Structure Of An Hsp90-Sba1 Closed Chaperone Complex Length = 134 Back     alignment and structure
>pdb|2KMW|A Chain A, Solution Structure Of At3g03773.1 Protein From Arabidopsis Thaliana Length = 150 Back     alignment and structure
>pdb|2KMW|A Chain A, Solution Structure Of At3g03773.1 Protein From Arabidopsis Thaliana Length = 150 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query317
1ejf_A125 Progesterone receptor P23; chaperone, CO-chaperone 1e-36
1ejf_A125 Progesterone receptor P23; chaperone, CO-chaperone 1e-36
2cg9_X134 CO-chaperone protein SBA1; chaperone complex, HSP9 2e-34
2cg9_X134 CO-chaperone protein SBA1; chaperone complex, HSP9 1e-33
2kmw_A150 Uncharacterized protein AT3G03773; protein structu 4e-34
2kmw_A150 Uncharacterized protein AT3G03773; protein structu 9e-34
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 8e-12
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 8e-12
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 8e-06
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 8e-06
>1ejf_A Progesterone receptor P23; chaperone, CO-chaperone, beta-sandwich; 2.49A {Homo sapiens} SCOP: b.15.1.2 Length = 125 Back     alignment and structure
 Score =  127 bits (320), Expect = 1e-36
 Identities = 43/126 (34%), Positives = 70/126 (55%), Gaps = 2/126 (1%)

Query: 179 VTPPSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFYKEIN 238
           + P S  W  R   +F+  C+ED K+  +N +K++L F  +GG++   H   I  +  I+
Sbjct: 1   MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCID 60

Query: 239 AEKSQTFVRERNIEILIKKTDDDKTYWPHLTKEKNKYHWLKVDFNKWKDEDDSDDENNGG 298
              S+    +R+I   ++K +  +  WP LTKE+ K +WL VDFN WKD +D D + +  
Sbjct: 61  PNDSKHKRTDRSILCCLRKGESGQ-SWPRLTKERAKLNWLSVDFNNWKDWED-DSDEDMS 118

Query: 299 NFEDVS 304
           NF+  S
Sbjct: 119 NFDRFS 124
>1ejf_A Progesterone receptor P23; chaperone, CO-chaperone, beta-sandwich; 2.49A {Homo sapiens} SCOP: b.15.1.2 Length = 125 Back     alignment and structure
>2cg9_X CO-chaperone protein SBA1; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Length = 134 Back     alignment and structure
>2cg9_X CO-chaperone protein SBA1; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Length = 134 Back     alignment and structure
>2kmw_A Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} Length = 150 Back     alignment and structure
>2kmw_A Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} Length = 150 Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Length = 114 Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Length = 114 Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Length = 92 Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Length = 92 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query317
2kmw_A150 Uncharacterized protein AT3G03773; protein structu 99.97
1ejf_A125 Progesterone receptor P23; chaperone, CO-chaperone 99.97
1ejf_A125 Progesterone receptor P23; chaperone, CO-chaperone 99.97
2cg9_X134 CO-chaperone protein SBA1; chaperone complex, HSP9 99.97
2kmw_A150 Uncharacterized protein AT3G03773; protein structu 99.96
2cg9_X134 CO-chaperone protein SBA1; chaperone complex, HSP9 99.96
1wgv_A124 KIAA1068 protein; CS domain, HSP20-like fold, stru 99.84
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 99.83
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 99.83
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 99.82
3qor_A121 Nuclear migration protein NUDC; beta-sandwich, cha 99.81
1wfi_A131 Nuclear distribution gene C homolog; NUDC, riken s 99.81
1x5m_A127 Calcyclin-binding protein; CS domain, structural g 99.8
1x5m_A127 Calcyclin-binding protein; CS domain, structural g 99.8
1wh0_A134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS 99.8
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 99.79
1wh0_A134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS 99.79
2o30_A131 Nuclear movement protein; MCSG, structural genomic 99.78
1wgv_A124 KIAA1068 protein; CS domain, HSP20-like fold, stru 99.73
1wfi_A131 Nuclear distribution gene C homolog; NUDC, riken s 99.7
2o30_A131 Nuclear movement protein; MCSG, structural genomic 99.69
2rh0_A157 NUDC domain-containing protein 2; 13542905, nuclea 99.69
2rh0_A157 NUDC domain-containing protein 2; 13542905, nuclea 99.59
3qor_A121 Nuclear migration protein NUDC; beta-sandwich, cha 99.57
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 98.15
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 97.92
4fei_A102 Heat shock protein-related protein; stress respons 97.87
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 97.86
4fei_A102 Heat shock protein-related protein; stress respons 97.84
2k8q_A134 Protein SHQ1; beta-sandwich, CS domain, nucleus, s 97.8
3eud_A115 Protein SHQ1; CS domain HSP20-like domain SHQ1 H/A 97.77
2k8q_A134 Protein SHQ1; beta-sandwich, CS domain, nucleus, s 97.68
3eud_A115 Protein SHQ1; CS domain HSP20-like domain SHQ1 H/A 97.65
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 97.46
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 97.36
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 97.27
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 97.24
1gme_A151 Heat shock protein 16.9B; small heat shock protein 97.09
1gme_A151 Heat shock protein 16.9B; small heat shock protein 96.92
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 96.74
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 96.49
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 96.37
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 96.26
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 96.23
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 95.88
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 95.67
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 95.31
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 95.26
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 95.05
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 94.72
>2kmw_A Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
Probab=99.97  E-value=1.2e-31  Score=229.53  Aligned_cols=114  Identities=31%  Similarity=0.611  Sum_probs=105.2

Q ss_pred             ccCCCceEEEEeCCEEEEEEEecCCCCCeEEEe-eCEEEEEEEeCCCCceEEEEEecccccccCCceEEeeCCeEEEEEE
Q psy15003         17 KVTPPSVAWAQRNHCIFLTICLEDCKNPTINLD-KNQLYFDGIGGTEKKHHQVTIPFYKEINAEKSQTFVRERNIEILIK   95 (317)
Q Consensus        17 ~~~~p~v~W~Q~~~~V~ltI~~kd~~d~~V~~~-~~~l~f~~~~~~~~~~y~~~l~L~~~I~pe~S~~~v~~rkIei~L~   95 (317)
                      ++++|+++||||.+.|+|||+++++++++|+|+ +++|+|++. +.+++.|.++|+||++|+|+ |++++++|+|+|+|+
T Consensus         1 m~~~P~~~W~Qt~~~V~ltI~l~~~~~v~V~~~~~~~l~~~~~-~~~~~~y~~~l~L~~~Idpe-S~~~v~~~kIei~L~   78 (150)
T 2kmw_A            1 SSRNPEVLWAQRSDKVYLTVALPDAKDISVKCEPQGLFSFSAL-GAQGERFEFSLELYGKIMTE-YRKNVGLRNIIFSIQ   78 (150)
T ss_dssp             CEECCCEEEEECSSEEEEEECCSSEEEEEECCCTTEEEEEEEE-TTTTEEEEEEEEBSSCEEEE-EEEEEESSSEEEEEE
T ss_pred             CCcCCcEEEEeCCCEEEEEEEeCCCCceEEEEecCCEEEEEEE-cCCCceEEEEeEhhhccccc-ceEEecCCEEEEEEE
Confidence            457899999999999999999999999999999 789999988 44678899999999999999 999999999999999


Q ss_pred             ecCCCCCCCCCccccccc-ccceeecCCCeeecCCCCcCC
Q psy15003         96 KTDDDKTYWPHLTKEKNK-YHWLKVDFNKWKDEDDSDDEN  134 (317)
Q Consensus        96 K~~~~g~~WprL~k~~~K-~~~l~~Dwdkw~~~dd~~~~~  134 (317)
                      |+++ + +||||++++.| ++|+++|||||+||||++++.
T Consensus        79 K~e~-~-~W~rL~k~~~K~~~~lk~Dwdkw~dedeeee~~  116 (150)
T 2kmw_A           79 KEER-S-WWTRLLKSEEKPAPYIKVDWNKWCDEDEEVNSE  116 (150)
T ss_dssp             ECCS-S-CCSCSBSCCSSCCTTEEECSSSSCCSSCCCCSS
T ss_pred             ECCC-C-cCcccccCCcccCccccccchhcCCchhccccc
Confidence            9994 4 99999999889 999999999999998877655
>1ejf_A Progesterone receptor P23; chaperone, CO-chaperone, beta-sandwich; 2.49A {Homo sapiens} SCOP: b.15.1.2 Back     alignment and structure
>1ejf_A Progesterone receptor P23; chaperone, CO-chaperone, beta-sandwich; 2.49A {Homo sapiens} SCOP: b.15.1.2 Back     alignment and structure
>2cg9_X CO-chaperone protein SBA1; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>2kmw_A Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2cg9_X CO-chaperone protein SBA1; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>1wgv_A KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4 Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>3qor_A Nuclear migration protein NUDC; beta-sandwich, chaperone, protein cell cycle; HET: OCS; 1.75A {Homo sapiens} PDB: 3qor_B* 2cr0_A Back     alignment and structure
>1wfi_A Nuclear distribution gene C homolog; NUDC, riken structural genomics/proteomics initiative, RSGI, structural genomics, transport protein; NMR {Mus musculus} SCOP: b.15.1.4 Back     alignment and structure
>1x5m_A Calcyclin-binding protein; CS domain, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5m_A Calcyclin-binding protein; CS domain, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi} Back     alignment and structure
>1wgv_A KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4 Back     alignment and structure
>1wfi_A Nuclear distribution gene C homolog; NUDC, riken structural genomics/proteomics initiative, RSGI, structural genomics, transport protein; NMR {Mus musculus} SCOP: b.15.1.4 Back     alignment and structure
>2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi} Back     alignment and structure
>2rh0_A NUDC domain-containing protein 2; 13542905, nuclear movement protein, structural genomics, joint center for structural genomics, JCSG; 1.95A {Mus musculus} Back     alignment and structure
>2rh0_A NUDC domain-containing protein 2; 13542905, nuclear movement protein, structural genomics, joint center for structural genomics, JCSG; 1.95A {Mus musculus} Back     alignment and structure
>3qor_A Nuclear migration protein NUDC; beta-sandwich, chaperone, protein cell cycle; HET: OCS; 1.75A {Homo sapiens} PDB: 3qor_B* 2cr0_A Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Back     alignment and structure
>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Back     alignment and structure
>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>2k8q_A Protein SHQ1; beta-sandwich, CS domain, nucleus, structural protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3eud_A Protein SHQ1; CS domain HSP20-like domain SHQ1 H/ACA snoRNP ribosome biogenesis, nucleus, nuclear protein; HET: MSE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2k8q_A Protein SHQ1; beta-sandwich, CS domain, nucleus, structural protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3eud_A Protein SHQ1; CS domain HSP20-like domain SHQ1 H/ACA snoRNP ribosome biogenesis, nucleus, nuclear protein; HET: MSE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Back     alignment and structure
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Back     alignment and structure
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 317
d1ejfa_110 b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapien 4e-25
d1ejfa_110 b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapien 4e-25
d1rl1a_92 b.15.1.3 (A:) Suppressor of G2 allele of skp1 homo 2e-11
d1rl1a_92 b.15.1.3 (A:) Suppressor of G2 allele of skp1 homo 2e-11
d1wh0a_134 b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolas 3e-06
d1wh0a_134 b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolas 3e-06
>d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure

class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: Co-chaperone p23-like
domain: Co-chaperone p23
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 95.1 bits (236), Expect = 4e-25
 Identities = 38/109 (34%), Positives = 61/109 (55%), Gaps = 1/109 (0%)

Query: 20  PPSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFYKEINAE 79
           P S  W  R   +F+  C+ED K+  +N +K++L F  +GG++   H   I  +  I+  
Sbjct: 3   PASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPN 62

Query: 80  KSQTFVRERNIEILIKKTDDDKTYWPHLTKEKNKYHWLKVDFNKWKDED 128
            S+    +R+I   ++K +  +  WP LTKE+ K +WL VDFN WKD +
Sbjct: 63  DSKHKRTDRSILCCLRKGESGQ-SWPRLTKERAKLNWLSVDFNNWKDWE 110
>d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Length = 134 Back     information, alignment and structure
>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Length = 134 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query317
d1ejfa_110 Co-chaperone p23 {Human (Homo sapiens) [TaxId: 960 99.96
d1ejfa_110 Co-chaperone p23 {Human (Homo sapiens) [TaxId: 960 99.95
d1rl1a_92 Suppressor of G2 allele of skp1 homolog, gst1 {Hum 99.84
d1rl1a_92 Suppressor of G2 allele of skp1 homolog, gst1 {Hum 99.83
d1wh0a_134 Ubiquitin carboxyl-terminal hydrolase 19, USP19 {H 99.72
d1wh0a_134 Ubiquitin carboxyl-terminal hydrolase 19, USP19 {H 99.72
d1wgva_124 NudC domain containing protein 3, NUDCD3 (KIAA1068 99.7
d1wfia_131 Nuclear migration protein nudC {Mouse (Mus musculu 99.53
d1wgva_124 NudC domain containing protein 3, NUDCD3 (KIAA1068 99.48
d1wfia_131 Nuclear migration protein nudC {Mouse (Mus musculu 99.15
d1shsa_115 Small heat shock protein {Archaeon Methanococcus j 97.17
d1shsa_115 Small heat shock protein {Archaeon Methanococcus j 96.92
d1gmea_150 Small heat shock protein {Wheat (Triticum aestivum 96.55
d1gmea_150 Small heat shock protein {Wheat (Triticum aestivum 96.48
>d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: Co-chaperone p23-like
domain: Co-chaperone p23
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=5.8e-29  Score=199.89  Aligned_cols=109  Identities=35%  Similarity=0.740  Sum_probs=103.0

Q ss_pred             CCCceEEEEeCCEEEEEEEecCCCCCeEEEeeCEEEEEEEeCCCCceEEEEEecccccccCCceEEeeCCeEEEEEEecC
Q psy15003         19 TPPSVAWAQRNHCIFLTICLEDCKNPTINLDKNQLYFDGIGGTEKKHHQVTIPFYKEINAEKSQTFVRERNIEILIKKTD   98 (317)
Q Consensus        19 ~~p~v~W~Q~~~~V~ltI~~kd~~d~~V~~~~~~l~f~~~~~~~~~~y~~~l~L~~~I~pe~S~~~v~~rkIei~L~K~~   98 (317)
                      .+|++.||||.+.|+|+|.++++++++|+|+.+++.|++.+..++..|.++++||++|+|++|++++.+++|+|+|+|++
T Consensus         2 ~p~~~~W~Qt~~~V~i~I~v~~~~~~~v~i~~~~l~~~~~~~~~~~~y~l~~~L~~~I~~~~s~~~v~~~kiei~L~K~~   81 (110)
T d1ejfa_           2 QPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGE   81 (110)
T ss_dssp             BCCCEEEEECSSEEEEEECCTTEEEEEEEEETTEEEEEEEETTTTEEEEEEEEBSSCEEEEEEEEEECSSCEEEEEEESS
T ss_pred             CCCCcEEEECCCEEEEEEEeCCCCCceEEEEeceEEEEEEecCCCceEEEEEEcccCcccCccEEEEeCCEEEEEEEEcC
Confidence            47889999999999999999999999999999999999887767788999999999999999999999999999999999


Q ss_pred             CCCCCCCCcccccccccceeecCCCeeecC
Q psy15003         99 DDKTYWPHLTKEKNKYHWLKVDFNKWKDED  128 (317)
Q Consensus        99 ~~g~~WprL~k~~~K~~~l~~Dwdkw~~~d  128 (317)
                      + |.+||||++++.|++|+++|||||+|++
T Consensus        82 ~-~~~W~~L~~~~~K~~~~kvD~dkw~d~~  110 (110)
T d1ejfa_          82 S-GQSWPRLTKERAKLNWLSVDFNNWKDWE  110 (110)
T ss_dssp             T-TCCCSSSBSSCCCCTTEEECTTTCCCCC
T ss_pred             C-CCCCCceecCCCCcCcEEccchheEcCC
Confidence            4 7799999999999999999999999984
>d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgva_ b.15.1.4 (A:) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfia_ b.15.1.4 (A:) Nuclear migration protein nudC {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgva_ b.15.1.4 (A:) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfia_ b.15.1.4 (A:) Nuclear migration protein nudC {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure