Psyllid ID: psy15017
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 97 | ||||||
| 328701148 | 1495 | PREDICTED: kinesin-like protein KIF21A-l | 0.896 | 0.058 | 0.781 | 1e-35 | |
| 328701146 | 1481 | PREDICTED: kinesin-like protein KIF21A-l | 0.896 | 0.058 | 0.781 | 1e-35 | |
| 158297459 | 1033 | AGAP007815-PA [Anopheles gambiae str. PE | 0.896 | 0.084 | 0.735 | 8e-34 | |
| 383863669 | 1484 | PREDICTED: kinesin-like protein KIF21A-l | 0.896 | 0.058 | 0.758 | 8e-34 | |
| 383863667 | 1486 | PREDICTED: kinesin-like protein KIF21A-l | 0.896 | 0.058 | 0.758 | 8e-34 | |
| 350421140 | 1486 | PREDICTED: kinesin-like protein KIF21A-l | 0.896 | 0.058 | 0.747 | 2e-33 | |
| 350421138 | 1484 | PREDICTED: kinesin-like protein KIF21A-l | 0.896 | 0.058 | 0.747 | 2e-33 | |
| 340713889 | 1484 | PREDICTED: kinesin-like protein KIF21A-l | 0.896 | 0.058 | 0.747 | 2e-33 | |
| 340713887 | 1486 | PREDICTED: kinesin-like protein KIF21A-l | 0.896 | 0.058 | 0.747 | 2e-33 | |
| 345495320 | 1504 | PREDICTED: kinesin-like protein KIF21B i | 0.896 | 0.057 | 0.735 | 2e-33 |
| >gi|328701148|ref|XP_003241507.1| PREDICTED: kinesin-like protein KIF21A-like isoform 3 [Acyrthosiphon pisum] gi|328701150|ref|XP_001949752.2| PREDICTED: kinesin-like protein KIF21A-like isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 153 bits (387), Expect = 1e-35, Method: Composition-based stats.
Identities = 68/87 (78%), Positives = 79/87 (90%)
Query: 3 KIRPQSAREVIDMCRVCTFVTPGEPQVTLGADKSFTFDYVFDMADVQTTIYELCAASLVA 62
+IRPQ AREVID CR+CT VTPGEPQVTLG+DKSFT+D+VFD + Q T+YE CA+SLVA
Sbjct: 15 RIRPQIAREVIDGCRICTNVTPGEPQVTLGSDKSFTYDFVFDTHENQQTLYENCASSLVA 74
Query: 63 GSLEGYNATILAYGQTGSGKTYTMGTG 89
G+L+GYNAT+LAYGQTGSGKTYTMGTG
Sbjct: 75 GALQGYNATVLAYGQTGSGKTYTMGTG 101
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328701146|ref|XP_003241506.1| PREDICTED: kinesin-like protein KIF21A-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|158297459|ref|XP_317685.4| AGAP007815-PA [Anopheles gambiae str. PEST] gi|157015205|gb|EAA12442.5| AGAP007815-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|383863669|ref|XP_003707302.1| PREDICTED: kinesin-like protein KIF21A-like isoform 2 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|383863667|ref|XP_003707301.1| PREDICTED: kinesin-like protein KIF21A-like isoform 1 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|350421140|ref|XP_003492746.1| PREDICTED: kinesin-like protein KIF21A-like isoform 2 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|350421138|ref|XP_003492745.1| PREDICTED: kinesin-like protein KIF21A-like isoform 1 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340713889|ref|XP_003395467.1| PREDICTED: kinesin-like protein KIF21A-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|340713887|ref|XP_003395466.1| PREDICTED: kinesin-like protein KIF21A-like isoform 1 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|345495320|ref|XP_003427480.1| PREDICTED: kinesin-like protein KIF21B isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 97 | ||||||
| FB|FBgn0032243 | 1048 | Klp31E "Kinesin-like protein a | 0.896 | 0.083 | 0.689 | 6.2e-28 | |
| RGD|1305126 | 556 | Kif21a "kinesin family member | 0.896 | 0.156 | 0.655 | 3.3e-27 | |
| UNIPROTKB|F1PRN6 | 1663 | KIF21A "Uncharacterized protei | 0.907 | 0.052 | 0.659 | 3.3e-27 | |
| UNIPROTKB|F1PPT2 | 1677 | KIF21A "Uncharacterized protei | 0.907 | 0.052 | 0.659 | 3.4e-27 | |
| UNIPROTKB|F1NU29 | 1638 | KIF21B "Uncharacterized protei | 0.969 | 0.057 | 0.617 | 5.4e-27 | |
| ZFIN|ZDB-GENE-110411-237 | 1647 | kif21a "kinesin family member | 0.896 | 0.052 | 0.666 | 6.9e-27 | |
| UNIPROTKB|F5H0C3 | 1621 | KIF21A "Kinesin-like protein K | 0.896 | 0.053 | 0.655 | 2.1e-26 | |
| UNIPROTKB|F5H219 | 1637 | KIF21A "Kinesin-like protein K | 0.896 | 0.053 | 0.655 | 2.2e-26 | |
| UNIPROTKB|Q7Z4S6 | 1674 | KIF21A "Kinesin-like protein K | 0.896 | 0.051 | 0.655 | 2.3e-26 | |
| UNIPROTKB|F8WCP6 | 1675 | KIF21A "Kinesin-like protein K | 0.896 | 0.051 | 0.655 | 2.3e-26 |
| FB|FBgn0032243 Klp31E "Kinesin-like protein at 31E" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 324 (119.1 bits), Expect = 6.2e-28, P = 6.2e-28
Identities = 60/87 (68%), Positives = 70/87 (80%)
Query: 3 KIRPQSAREVIDMCRVCTFVTPGEPQVTLGADKSFTFDYVFDMADVQTTIYELCAASLVA 62
+IRPQ++RE+IDMCR+CT VT GEPQ+ LG+DK+FTFDYVFD Q IY C LV
Sbjct: 19 RIRPQNSRELIDMCRICTTVTLGEPQIFLGSDKAFTFDYVFDTNSNQCDIYSDCVEKLVD 78
Query: 63 GSLEGYNATILAYGQTGSGKTYTMGTG 89
+L GYNAT+LAYGQTGSGKTYTMGTG
Sbjct: 79 STLHGYNATVLAYGQTGSGKTYTMGTG 105
|
|
| RGD|1305126 Kif21a "kinesin family member 21A" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PRN6 KIF21A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PPT2 KIF21A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NU29 KIF21B "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-110411-237 kif21a "kinesin family member 21A" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F5H0C3 KIF21A "Kinesin-like protein KIF21A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F5H219 KIF21A "Kinesin-like protein KIF21A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7Z4S6 KIF21A "Kinesin-like protein KIF21A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F8WCP6 KIF21A "Kinesin-like protein KIF21A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 97 | |||
| cd01372 | 341 | cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik | 1e-45 | |
| smart00129 | 335 | smart00129, KISc, Kinesin motor, catalytic domain | 7e-30 | |
| pfam00225 | 326 | pfam00225, Kinesin, Kinesin motor domain | 2e-28 | |
| cd01369 | 325 | cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine | 6e-26 | |
| cd00106 | 328 | cd00106, KISc, Kinesin motor domain | 3e-24 | |
| cd01371 | 333 | cd01371, KISc_KIF3, Kinesin motor domain, kinesins | 5e-24 | |
| cd01374 | 321 | cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E | 8e-21 | |
| cd01370 | 338 | cd01370, KISc_KIP3_like, Kinesin motor domain, KIP | 1e-20 | |
| cd01366 | 329 | cd01366, KISc_C_terminal, Kinesin motor domain, KI | 4e-20 | |
| cd01365 | 356 | cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K | 3e-19 | |
| cd01364 | 352 | cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC | 3e-19 | |
| cd01373 | 337 | cd01373, KISc_KLP2_like, Kinesin motor domain, KLP | 3e-17 | |
| COG5059 | 568 | COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | 9e-17 | |
| cd01375 | 334 | cd01375, KISc_KIF9_like, Kinesin motor domain, KIF | 2e-16 | |
| cd01367 | 322 | cd01367, KISc_KIF2_like, Kinesin motor domain, KIF | 1e-15 | |
| PLN03188 | 1320 | PLN03188, PLN03188, kinesin-12 family protein; Pro | 5e-15 | |
| cd01368 | 345 | cd01368, KISc_KIF23_like, Kinesin motor domain, KI | 3e-12 | |
| cd01376 | 319 | cd01376, KISc_KID_like, Kinesin motor domain, KIF2 | 7e-11 | |
| cd01363 | 186 | cd01363, Motor_domain, Myosin and Kinesin motor do | 1e-09 |
| >gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
Score = 148 bits (377), Expect = 1e-45
Identities = 55/87 (63%), Positives = 66/87 (75%)
Query: 3 KIRPQSAREVIDMCRVCTFVTPGEPQVTLGADKSFTFDYVFDMADVQTTIYELCAASLVA 62
++RP +E+++ C+VC V PGEPQVT+G DKSFTFDYVFD + Q +Y C A LV
Sbjct: 8 RVRPLLPKELLEGCQVCVSVVPGEPQVTVGTDKSFTFDYVFDPSTSQEEVYNTCVAPLVD 67
Query: 63 GSLEGYNATILAYGQTGSGKTYTMGTG 89
G EGYNAT+LAYGQTGSGKTYTMGT
Sbjct: 68 GLFEGYNATVLAYGQTGSGKTYTMGTA 94
|
Members of this group seem to perform a variety of functions, and have been implicated in neuronal organelle transport and chromosome segregation during mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 341 |
| >gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238054 cd00106, KISc, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 97 | |||
| cd01370 | 338 | KISc_KIP3_like Kinesin motor domain, KIP3-like sub | 99.96 | |
| cd01373 | 337 | KISc_KLP2_like Kinesin motor domain, KLP2-like sub | 99.96 | |
| cd01368 | 345 | KISc_KIF23_like Kinesin motor domain, KIF23-like s | 99.96 | |
| cd01367 | 322 | KISc_KIF2_like Kinesin motor domain, KIF2-like gro | 99.96 | |
| cd01372 | 341 | KISc_KIF4 Kinesin motor domain, KIF4-like subfamil | 99.96 | |
| KOG0243|consensus | 1041 | 99.96 | ||
| cd01365 | 356 | KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p | 99.95 | |
| cd01371 | 333 | KISc_KIF3 Kinesin motor domain, kinesins II or KIF | 99.95 | |
| KOG4280|consensus | 574 | 99.95 | ||
| cd01369 | 325 | KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy | 99.95 | |
| KOG0245|consensus | 1221 | 99.95 | ||
| cd01364 | 352 | KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind | 99.95 | |
| cd01376 | 319 | KISc_KID_like Kinesin motor domain, KIF22/Kid-like | 99.95 | |
| cd01374 | 321 | KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like | 99.95 | |
| KOG0240|consensus | 607 | 99.94 | ||
| KOG0242|consensus | 675 | 99.94 | ||
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 99.93 | |
| cd00106 | 328 | KISc Kinesin motor domain. This catalytic (head) d | 99.93 | |
| cd01366 | 329 | KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ | 99.93 | |
| smart00129 | 335 | KISc Kinesin motor, catalytic domain. ATPase. Micr | 99.93 | |
| cd01375 | 334 | KISc_KIF9_like Kinesin motor domain, KIF9-like sub | 99.93 | |
| PF00225 | 335 | Kinesin: Kinesin motor domain; InterPro: IPR001752 | 99.92 | |
| KOG0246|consensus | 676 | 99.92 | ||
| KOG0239|consensus | 670 | 99.92 | ||
| KOG0241|consensus | 1714 | 99.91 | ||
| KOG0247|consensus | 809 | 99.85 | ||
| KOG0244|consensus | 913 | 99.8 | ||
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 99.75 | |
| cd01363 | 186 | Motor_domain Myosin and Kinesin motor domain. Thes | 99.7 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 95.95 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 95.65 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 95.35 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 95.21 | |
| PRK06620 | 214 | hypothetical protein; Validated | 94.95 | |
| PRK09087 | 226 | hypothetical protein; Validated | 94.81 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 94.81 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 94.61 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 94.03 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 93.91 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 93.76 | |
| PF01935 | 229 | DUF87: Domain of unknown function DUF87; InterPro: | 93.43 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 93.43 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 93.4 | |
| PRK08116 | 268 | hypothetical protein; Validated | 93.16 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 93.13 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 93.09 | |
| PRK12377 | 248 | putative replication protein; Provisional | 93.0 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 92.81 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 92.68 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 92.28 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 92.09 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 92.06 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 92.02 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 91.97 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 91.84 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 91.69 | |
| PRK08727 | 233 | hypothetical protein; Validated | 91.52 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 91.51 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 91.43 | |
| PF00063 | 689 | Myosin_head: Myosin head (motor domain); InterPro: | 91.37 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 91.24 | |
| PRK08181 | 269 | transposase; Validated | 91.07 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 91.04 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 91.01 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 90.96 | |
| smart00242 | 677 | MYSc Myosin. Large ATPases. ATPase; molecular moto | 90.92 | |
| PF07693 | 325 | KAP_NTPase: KAP family P-loop domain; InterPro: IP | 90.9 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 90.88 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 90.88 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 90.83 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 90.62 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 90.53 | |
| PRK06526 | 254 | transposase; Provisional | 90.47 | |
| cd01377 | 693 | MYSc_type_II Myosin motor domain, type II myosins. | 90.36 | |
| cd01384 | 674 | MYSc_type_XI Myosin motor domain, plant-specific t | 90.27 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 90.22 | |
| cd00124 | 679 | MYSc Myosin motor domain. This catalytic (head) do | 90.21 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 90.2 | |
| cd01383 | 677 | MYSc_type_VIII Myosin motor domain, plant-specific | 90.13 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 90.05 | |
| cd01378 | 674 | MYSc_type_I Myosin motor domain, type I myosins. M | 90.01 | |
| cd01382 | 717 | MYSc_type_VI Myosin motor domain, type VI myosins. | 90.01 | |
| cd01381 | 671 | MYSc_type_VII Myosin motor domain, type VII myosin | 89.9 | |
| COG5008 | 375 | PilU Tfp pilus assembly protein, ATPase PilU [Cell | 89.87 | |
| cd01385 | 692 | MYSc_type_IX Myosin motor domain, type IX myosins. | 89.77 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 89.68 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 89.67 | |
| cd01387 | 677 | MYSc_type_XV Myosin motor domain, type XV myosins. | 89.53 | |
| cd01380 | 691 | MYSc_type_V Myosin motor domain, type V myosins. M | 89.52 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 89.41 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 89.38 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 89.31 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 89.19 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 89.02 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 88.84 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 88.8 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 88.39 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 88.21 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 88.02 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 87.98 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 87.9 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 87.8 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 87.65 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 87.62 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 87.48 | |
| cd01386 | 767 | MYSc_type_XVIII Myosin motor domain, type XVIII my | 87.27 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 86.62 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 86.52 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 86.41 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 86.25 | |
| PF10923 | 416 | DUF2791: P-loop Domain of unknown function (DUF279 | 86.09 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 85.92 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 85.65 | |
| PF06048 | 286 | DUF927: Domain of unknown function (DUF927); Inter | 84.95 | |
| PTZ00014 | 821 | myosin-A; Provisional | 84.87 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 84.62 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 84.56 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 84.15 | |
| KOG2543|consensus | 438 | 84.12 | ||
| KOG0989|consensus | 346 | 83.83 | ||
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 83.71 | |
| cd01379 | 653 | MYSc_type_III Myosin motor domain, type III myosin | 83.37 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 83.33 | |
| COG4962 | 355 | CpaF Flp pilus assembly protein, ATPase CpaF [Intr | 83.1 | |
| PRK13764 | 602 | ATPase; Provisional | 82.9 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 82.8 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 82.26 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 81.9 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 81.74 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 81.68 | |
| KOG1547|consensus | 336 | 81.59 | ||
| PRK10536 | 262 | hypothetical protein; Provisional | 80.85 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 80.83 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 80.77 | |
| PTZ00424 | 401 | helicase 45; Provisional | 80.74 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 80.65 | |
| COG3829 | 560 | RocR Transcriptional regulator containing PAS, AAA | 80.65 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 80.6 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 80.59 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 80.54 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 80.45 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 80.33 |
| >cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
Probab=99.96 E-value=1.6e-29 Score=180.72 Aligned_cols=95 Identities=36% Similarity=0.498 Sum_probs=81.8
Q ss_pred CEEecCCCchhhhcCCceEEEEcCCCCeEE---------------eCCCeeeeccEEecCCCcHHHHHHHHHHHHHHHHh
Q psy15017 1 MCKIRPQSAREVIDMCRVCTFVTPGEPQVT---------------LGADKSFTFDYVFDMADVQTTIYELCAASLVAGSL 65 (97)
Q Consensus 1 ~vRvRP~~~~e~~~~~~~~~~~~~~~~~~~---------------~~~~~~F~fd~vf~~~~~q~~v~~~~~~p~v~~~~ 65 (97)
+|||||++.+|..++...++.+.+++..+. ...++.|.||+||+++++|++||+.++.|+|+.++
T Consensus 5 ~vRvRP~~~~E~~~~~~~~v~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~f~Fd~vf~~~~~q~~vf~~~~~plv~~~~ 84 (338)
T cd01370 5 AVRVRPFNEKEKQEGTRRVVKVVDDRMLVFDPKDEEDAFRNLRARRNKELKYSFDRVFDETSTQEEVYENTTKPLVDGVL 84 (338)
T ss_pred EEEcCCCChhhhhcCCceEEEEcCCCEEEEcCCcccccccchhcccCCceEEEeccccCCCCCHHHHHHHHHHHHHHHHH
Confidence 699999999998888888887765432221 11358899999999999999999999999999999
Q ss_pred CCCCEEEEeeccCCCccceeecCCCCCCCC
Q psy15017 66 EGYNATILAYGQTGSGKTYTMGTGTFSPIS 95 (97)
Q Consensus 66 ~g~n~~v~ayG~t~sGKt~T~~G~~~~~~~ 95 (97)
+|+|+||||||+|||||||||+|+.++|+.
T Consensus 85 ~G~n~~i~ayGqtGSGKTyTm~G~~~~~Gi 114 (338)
T cd01370 85 NGYNATVFAYGATGAGKTHTMLGTDSDPGL 114 (338)
T ss_pred CCCCceEEeeCCCCCCCeEEEcCCCCCCch
Confidence 999999999999999999999999887754
|
The yeast kinesin KIP3 plays a role in positioning the mitotic spindle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a sec |
| >cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >KOG4280|consensus | Back alignment and domain information |
|---|
| >cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >KOG0245|consensus | Back alignment and domain information |
|---|
| >cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >KOG0240|consensus | Back alignment and domain information |
|---|
| >KOG0242|consensus | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >cd00106 KISc Kinesin motor domain | Back alignment and domain information |
|---|
| >cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >smart00129 KISc Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >KOG0246|consensus | Back alignment and domain information |
|---|
| >KOG0239|consensus | Back alignment and domain information |
|---|
| >KOG0241|consensus | Back alignment and domain information |
|---|
| >KOG0247|consensus | Back alignment and domain information |
|---|
| >KOG0244|consensus | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01363 Motor_domain Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >smart00242 MYSc Myosin | Back alignment and domain information |
|---|
| >PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >cd01377 MYSc_type_II Myosin motor domain, type II myosins | Back alignment and domain information |
|---|
| >cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >cd00124 MYSc Myosin motor domain | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >cd01378 MYSc_type_I Myosin motor domain, type I myosins | Back alignment and domain information |
|---|
| >cd01382 MYSc_type_VI Myosin motor domain, type VI myosins | Back alignment and domain information |
|---|
| >cd01381 MYSc_type_VII Myosin motor domain, type VII myosins | Back alignment and domain information |
|---|
| >COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd01385 MYSc_type_IX Myosin motor domain, type IX myosins | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >cd01387 MYSc_type_XV Myosin motor domain, type XV myosins | Back alignment and domain information |
|---|
| >cd01380 MYSc_type_V Myosin motor domain, type V myosins | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >PF10923 DUF2791: P-loop Domain of unknown function (DUF2791); InterPro: IPR021228 This is a family of proteins found in archaea and bacteria | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF06048 DUF927: Domain of unknown function (DUF927); InterPro: IPR009270 This entry is represented by Bacteriophage PT1028, Orf1 | Back alignment and domain information |
|---|
| >PTZ00014 myosin-A; Provisional | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >KOG2543|consensus | Back alignment and domain information |
|---|
| >KOG0989|consensus | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >cd01379 MYSc_type_III Myosin motor domain, type III myosins | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >KOG1547|consensus | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 97 | ||||
| 4a14_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 2e-16 | ||
| 2xt3_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 2e-16 | ||
| 2kin_A | 238 | Kinesin (Monomeric) From Rattus Norvegicus Length = | 5e-14 | ||
| 1mkj_A | 349 | Human Kinesin Motor Domain With Docked Neck Linker | 2e-12 | ||
| 1bg2_A | 325 | Human Ubiquitous Kinesin Motor Domain Length = 325 | 2e-12 | ||
| 1n6m_A | 409 | Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY | 4e-12 | ||
| 1cz7_A | 406 | The Crystal Structure Of A Minus-End Directed Micro | 4e-12 | ||
| 2ncd_A | 420 | Ncd (Non-Claret Disjunctional) Dimer From D. Melano | 4e-12 | ||
| 3u06_A | 412 | Crystal Structure Of The Kinesin-14 Ncdg347d Length | 4e-12 | ||
| 4atx_C | 340 | Rigor Kinesin Motor Domain With An Ordered Neck-Lin | 6e-12 | ||
| 3l1c_A | 383 | Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | 9e-12 | ||
| 1goj_A | 355 | Structure Of A Fast Kinesin: Implications For Atpas | 1e-11 | ||
| 2vvg_A | 350 | Crystal Structure Of The G.Intestinalis Kinesin 2 G | 3e-11 | ||
| 3b6v_A | 395 | Crystal Structure Of The Motor Domain Of Human Kine | 4e-11 | ||
| 1t5c_A | 349 | Crystal Structure Of The Motor Domain Of Human Kine | 5e-11 | ||
| 2wbe_C | 373 | Kinesin-5-Tubulin Complex With Amppnp Length = 373 | 2e-10 | ||
| 3b6u_A | 372 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-10 | ||
| 4aqv_C | 373 | Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma | 6e-10 | ||
| 4gkr_A | 371 | Structure Of The C-Terminal Motor Domain Of Kar3 Fr | 8e-10 | ||
| 3t0q_A | 349 | Motor Domain Structure Of The Kar3-Like Kinesin Fro | 1e-09 | ||
| 2y5w_A | 365 | Crystal Structure Of Drosophila Melanogaster Kinesi | 1e-09 | ||
| 3lre_A | 355 | Crystal Structure Analysis Of Human Kinesin-8 Motor | 2e-09 | ||
| 4etp_A | 403 | C-Terminal Motor And Motor Homology Domain Of Kar3v | 2e-09 | ||
| 1vfv_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 2e-09 | ||
| 1i6i_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 2e-09 | ||
| 1f9v_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 2e-09 | ||
| 1f9u_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 2e-09 | ||
| 1f9t_A | 358 | Crystal Structures Of Kinesin Mutants Reveal A Sign | 2e-09 | ||
| 1f9w_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 2e-09 | ||
| 3kar_A | 346 | The Motor Domain Of Kinesin-Like Protein Kar3, A Sa | 2e-09 | ||
| 1ia0_K | 394 | Kif1a Head-Microtubule Complex Structure In Atp-For | 3e-09 | ||
| 3nwn_A | 359 | Crystal Structure Of The Human Kif9 Motor Domain In | 3e-09 | ||
| 1i5s_A | 367 | Crystal Structure Of The Kif1a Motor Domain Complex | 4e-09 | ||
| 1v8j_A | 410 | The Crystal Structure Of The Minimal Functional Dom | 4e-09 | ||
| 2heh_A | 387 | Crystal Structure Of The Kif2c Motor Domain (Casp T | 5e-09 | ||
| 3edl_D | 331 | Kinesin13-Microtubule Ring Complex Length = 331 | 6e-09 | ||
| 1x88_A | 359 | Human Eg5 Motor Domain Bound To Mg-Adp And Monastro | 8e-09 | ||
| 3hqd_A | 369 | Human Kinesin Eg5 Motor Domain In Complex With Ampp | 9e-09 | ||
| 4a28_A | 368 | Eg5-2 Length = 368 | 9e-09 | ||
| 1q0b_A | 367 | Crystal Structure Of The Motor Protein Ksp In Compl | 9e-09 | ||
| 1ii6_A | 368 | Crystal Structure Of The Mitotic Kinesin Eg5 In Com | 9e-09 | ||
| 4a1z_A | 368 | Eg5-1 Length = 368 | 9e-09 | ||
| 4ap0_A | 370 | The Mitotic Kinesin Eg5 In Complex With Mg-Adp And | 9e-09 | ||
| 2gry_A | 420 | Crystal Structure Of The Human Kif2 Motor Domain In | 1e-08 | ||
| 3zcw_A | 348 | Eg5 - New Allosteric Binding Site Length = 348 | 1e-08 | ||
| 3h4s_A | 386 | Structure Of The Complex Of A Mitotic Kinesin With | 3e-08 | ||
| 3pxn_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 2e-07 | ||
| 3dc4_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 2e-07 | ||
| 1sdm_A | 369 | Crystal Structure Of Kinesin-Like Calmodulin Bindin | 2e-07 | ||
| 2rep_A | 376 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-07 | ||
| 3gbj_A | 354 | Crystal Structure Of The Motor Domain Of Kinesin Ki | 4e-07 | ||
| 2h58_A | 330 | Crystal Structure Of The Kifc3 Motor Domain In Comp | 7e-07 | ||
| 2owm_A | 443 | Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 | 1e-06 | ||
| 4h1g_A | 715 | Structure Of Candida Albicans Kar3 Motor Domain Fus | 2e-06 | ||
| 3bfn_A | 388 | Crystal Structure Of The Motor Domain Of Human Kine | 1e-05 | ||
| 1ry6_A | 360 | Crystal Structure Of Internal Kinesin Motor Domain | 3e-04 |
| >pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
|
| >pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 | Back alignment and structure |
| >pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 | Back alignment and structure |
| >pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 | Back alignment and structure |
| >pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 | Back alignment and structure |
| >pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 | Back alignment and structure |
| >pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 | Back alignment and structure |
| >pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 | Back alignment and structure |
| >pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 | Back alignment and structure |
| >pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | Back alignment and structure |
| >pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 | Back alignment and structure |
| >pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 | Back alignment and structure |
| >pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 | Back alignment and structure |
| >pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 | Back alignment and structure |
| >pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 | Back alignment and structure |
| >pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 | Back alignment and structure |
| >pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 | Back alignment and structure |
| >pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 | Back alignment and structure |
| >pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 | Back alignment and structure |
| >pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 | Back alignment and structure |
| >pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 | Back alignment and structure |
| >pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 | Back alignment and structure |
| >pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 | Back alignment and structure |
| >pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 | Back alignment and structure |
| >pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 | Back alignment and structure |
| >pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 | Back alignment and structure |
| >pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 | Back alignment and structure |
| >pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 | Back alignment and structure |
| >pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 | Back alignment and structure |
| >pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 | Back alignment and structure |
| >pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 | Back alignment and structure |
| >pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 | Back alignment and structure |
| >pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 | Back alignment and structure |
| >pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 | Back alignment and structure |
| >pdb|4A28|A Chain A, Eg5-2 Length = 368 | Back alignment and structure |
| >pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 | Back alignment and structure |
| >pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 | Back alignment and structure |
| >pdb|4A1Z|A Chain A, Eg5-1 Length = 368 | Back alignment and structure |
| >pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 | Back alignment and structure |
| >pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 | Back alignment and structure |
| >pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 | Back alignment and structure |
| >pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 | Back alignment and structure |
| >pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 | Back alignment and structure |
| >pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 | Back alignment and structure |
| >pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 | Back alignment and structure |
| >pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 | Back alignment and structure |
| >pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 | Back alignment and structure |
| >pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 | Back alignment and structure |
| >pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 | Back alignment and structure |
| >pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 | Back alignment and structure |
| >pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 | Back alignment and structure |
| >pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 97 | |||
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 6e-45 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 8e-41 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 2e-39 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 8e-39 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 3e-38 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 1e-36 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 9e-35 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 2e-34 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 3e-34 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 4e-33 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 6e-33 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 8e-33 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 8e-32 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 9e-32 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 2e-31 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 7e-31 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 7e-31 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 9e-31 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 1e-29 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 3e-29 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 4e-29 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 8e-29 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 1e-28 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 2e-28 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 2e-28 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 5e-26 |
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 | Back alignment and structure |
|---|
Score = 146 bits (371), Expect = 6e-45
Identities = 38/95 (40%), Positives = 54/95 (56%)
Query: 1 MCKIRPQSAREVIDMCRVCTFVTPGEPQVTLGADKSFTFDYVFDMADVQTTIYELCAASL 60
++RP +E++ + C V PG +VTLG D+ F F V Q +Y+ C L
Sbjct: 16 ALRVRPLLPKELLHGHQSCLQVEPGLGRVTLGRDRHFGFHVVLAEDAGQEAVYQACVQPL 75
Query: 61 VAGSLEGYNATILAYGQTGSGKTYTMGTGTFSPIS 95
+ EG+NAT+ AYGQTGSGKTYTMG + + +
Sbjct: 76 LEAFFEGFNATVFAYGQTGSGKTYTMGEASVASLL 110
|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 97 | |||
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 99.97 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 99.97 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 99.97 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 99.97 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 99.97 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 99.97 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 99.97 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 99.97 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 99.96 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 99.96 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 99.96 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 99.96 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 99.96 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 99.96 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 99.96 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 99.96 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 99.96 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 99.96 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 99.96 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 99.96 | |
| 3nwn_A | 359 | Kinesin-like protein KIF9; motor domain, ADP, stru | 99.95 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 99.95 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 99.95 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 99.95 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 99.94 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 99.94 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 99.93 | |
| 4h1g_A | 715 | Maltose binding protein-cakar3 motor domain fusio; | 99.89 | |
| 2o0a_A | 298 | S.cerevisiae chromosome XVI reading frame ORF YPL2 | 99.63 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 96.13 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 94.96 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 94.81 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 94.0 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 93.61 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 93.22 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 92.63 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 92.14 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 90.87 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 90.26 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 90.0 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 89.51 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 89.38 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 89.19 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 89.19 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 89.04 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 88.84 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 88.62 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 88.59 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 88.56 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 88.49 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 88.35 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 88.25 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 87.85 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 87.47 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 87.15 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 86.98 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 86.92 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 86.91 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 86.89 | |
| 1lkx_A | 697 | Myosin IE heavy chain; myosin motor domain, lever | 86.88 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 86.87 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 86.76 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 86.51 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 86.49 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 86.38 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 86.16 | |
| 2v26_A | 784 | Myosin VI; calmodulin-binding, nucleotide-binding, | 86.15 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 86.0 | |
| 1w9i_A | 770 | Myosin II heavy chain; molecular motor, ATPase, mo | 85.93 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 85.52 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 85.37 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 85.35 | |
| 1w7j_A | 795 | Myosin VA; motor protein, unconventional myosin, m | 85.25 | |
| 4db1_A | 783 | Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb | 85.05 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 84.95 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 84.91 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 84.82 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 84.67 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 84.65 | |
| 4anj_A | 1052 | Unconventional myosin-VI, green fluorescent prote; | 84.53 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 84.49 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 84.4 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 84.4 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 84.32 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 84.12 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 84.11 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 84.06 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 84.04 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 84.01 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 83.98 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 83.77 | |
| 4etp_B | 333 | Spindle POLE BODY-associated protein VIK1; kinesin | 83.71 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 83.48 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 83.01 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 82.99 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 82.95 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 82.94 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 82.73 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 82.67 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 82.6 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 82.52 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 82.03 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 81.82 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 81.63 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 81.53 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 81.37 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 81.13 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 80.97 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 80.88 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 80.84 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 80.83 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 80.8 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 80.75 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 80.54 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 80.24 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 80.13 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 80.08 |
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* | Back alignment and structure |
|---|
Probab=99.97 E-value=5.7e-32 Score=192.76 Aligned_cols=90 Identities=42% Similarity=0.753 Sum_probs=84.1
Q ss_pred CEEecCCCchhhhcCCceEEEEcCCCCeEEeCCCeeeeccEEecCCCcHHHHHHHHHHHHHHHHhCCCCEEEEeeccCCC
Q psy15017 1 MCKIRPQSAREVIDMCRVCTFVTPGEPQVTLGADKSFTFDYVFDMADVQTTIYELCAASLVAGSLEGYNATILAYGQTGS 80 (97)
Q Consensus 1 ~vRvRP~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~F~fd~vf~~~~~q~~v~~~~~~p~v~~~~~g~n~~v~ayG~t~s 80 (97)
+|||||++.+|...+...|+.+.++...+.+..++.|.||+||+++++|++||+.++.|+|+.+++|+|+||||||||||
T Consensus 16 ~vRvRP~~~~E~~~~~~~~~~~~~~~~~~~~~~~~~f~FD~Vf~~~~~Q~~vy~~~~~plv~~~l~G~n~tifAYGqTGS 95 (344)
T 4a14_A 16 ALRVRPLLPKELLHGHQSCLQVEPGLGRVTLGRDRHFGFHVVLAEDAGQEAVYQACVQPLLEAFFEGFNATVFAYGQTGS 95 (344)
T ss_dssp EEEECCCCHHHHHTTCCBCEEEEGGGTEEEETTTEEEECSEEECTTCCHHHHHHHHTHHHHHHHHTTCCEEEEEESSTTS
T ss_pred EEEecccchHHHhccCeeEEEEcCCCceEEecccceEEEEEEEecCcchhHHHHHHHHHHHHHHHhhcCeeEEEecccCC
Confidence 59999999999988888898888888888888999999999999999999999999999999999999999999999999
Q ss_pred ccceeecCCC
Q psy15017 81 GKTYTMGTGT 90 (97)
Q Consensus 81 GKt~T~~G~~ 90 (97)
||||||+|+.
T Consensus 96 GKTyTm~G~~ 105 (344)
T 4a14_A 96 GKTYTMGEAS 105 (344)
T ss_dssp SHHHHHCC--
T ss_pred CceEeecccc
Confidence 9999999874
|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* | Back alignment and structure |
|---|
| >3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A | Back alignment and structure |
|---|
| >4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 | Back alignment and structure |
|---|
| >4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >4etp_B Spindle POLE BODY-associated protein VIK1; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 97 | ||||
| d1goja_ | 354 | c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 | 1e-18 | |
| d1bg2a_ | 323 | c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId | 2e-17 | |
| d1x88a1 | 345 | c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), | 3e-17 | |
| d1ry6a_ | 330 | c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu | 1e-16 | |
| d1sdma_ | 364 | c.37.1.9 (A:) Kinesin heavy chain-like protein {Po | 3e-16 | |
| d2ncda_ | 368 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 6e-16 | |
| d1v8ka_ | 362 | c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c | 7e-16 | |
| d2zfia1 | 349 | c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), | 1e-13 | |
| d1f9va_ | 342 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 9e-11 |
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin species: Neurospora crassa [TaxId: 5141]
Score = 76.1 bits (186), Expect = 1e-18
Identities = 33/88 (37%), Positives = 46/88 (52%), Gaps = 2/88 (2%)
Query: 1 MCKIRPQSAREVIDMCRVCTFVTPGEPQVTLG--ADKSFTFDYVFDMADVQTTIYELCAA 58
+ + RPQ+ E+ + + A SFTFD VFDM+ Q+ I++
Sbjct: 10 VARFRPQNRVEIESGGQPIVTFQGPDTCTVDSKEAQGSFTFDRVFDMSCKQSDIFDFSIK 69
Query: 59 SLVAGSLEGYNATILAYGQTGSGKTYTM 86
V L GYN T+ AYGQTG+GK+YTM
Sbjct: 70 PTVDDILNGYNGTVFAYGQTGAGKSYTM 97
|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 97 | |||
| d1x88a1 | 345 | Kinesin {Human (Homo sapiens), mitotic kinesin eg5 | 99.96 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 99.96 | |
| d1v8ka_ | 362 | Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 | 99.96 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 99.96 | |
| d1sdma_ | 364 | Kinesin heavy chain-like protein {Potato (Solanum | 99.95 | |
| d2zfia1 | 349 | Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 | 99.95 | |
| d1ry6a_ | 330 | Kinesin {Malaria parasite (Plasmodium falciparum) | 99.95 | |
| d2ncda_ | 368 | Kinesin motor Ncd (non-claret disjunctional) {Frui | 99.94 | |
| d1f9va_ | 342 | Kinesin motor Ncd (non-claret disjunctional) {Bake | 99.93 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 95.43 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 95.06 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 93.74 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 92.17 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 92.05 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 92.03 | |
| d1d0xa2 | 712 | Myosin S1, motor domain {Dictyostelium discoideum | 92.03 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 91.89 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 91.82 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 91.71 | |
| d1br2a2 | 710 | Myosin S1, motor domain {Chicken (Gallus gallus), | 91.46 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 91.32 | |
| d1lkxa_ | 684 | Myosin S1, motor domain {Dictyostelium discoideum, | 91.2 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 91.13 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 91.05 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 90.48 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 90.26 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 90.2 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 90.15 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 90.03 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 89.92 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 89.87 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 89.14 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 89.1 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 88.75 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 88.69 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 88.12 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 87.69 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 87.43 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 87.39 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 87.27 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 87.08 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 86.87 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 86.71 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 86.43 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 86.41 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 86.11 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 85.72 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 85.57 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 85.14 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 84.96 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 84.57 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 84.21 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 83.5 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 83.44 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 82.82 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 82.44 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 81.63 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 81.36 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 81.33 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 80.86 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 80.59 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 80.4 |
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin species: Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]
Probab=99.96 E-value=6e-30 Score=180.16 Aligned_cols=92 Identities=32% Similarity=0.515 Sum_probs=82.9
Q ss_pred CEEecCCCchhhhcCCceEEEEcCCCCeEEeC--------CCeeeeccEEecCCCcHHHHHHHHHHHHHHHHhCCCCEEE
Q psy15017 1 MCKIRPQSAREVIDMCRVCTFVTPGEPQVTLG--------ADKSFTFDYVFDMADVQTTIYELCAASLVAGSLEGYNATI 72 (97)
Q Consensus 1 ~vRvRP~~~~e~~~~~~~~~~~~~~~~~~~~~--------~~~~F~fd~vf~~~~~q~~v~~~~~~p~v~~~~~g~n~~v 72 (97)
+|||||++..|...+...++.+++....+.+. ..+.|+||+|||++++|++||+.++.|+|+.+++|+|+||
T Consensus 5 ~vRvRP~~~~e~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~f~FD~vf~~~~~q~~vy~~~~~~lv~~~l~G~n~~i 84 (345)
T d1x88a1 5 VVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLADKSSRKTYTFDMVFGASTKQIDVYRSVVCPILDEVIMGYNCTI 84 (345)
T ss_dssp EEEECCCCHHHHHTTCCCCEEEETTTTEEEEEEEEETTEEEEEEEECSEEECTTCCHHHHHHHHHHHHHHHHHTTCEEEE
T ss_pred EEEECCCChhhhccCCCeEEEEcCCCceEEEecCCCCCCCCcceEecCEEeCCCCCHHHHHHHHHHHhHHHHhccCCceE
Confidence 59999999999888888888887777766552 2478999999999999999999999999999999999999
Q ss_pred EeeccCCCccceeecCCCCC
Q psy15017 73 LAYGQTGSGKTYTMGTGTFS 92 (97)
Q Consensus 73 ~ayG~t~sGKt~T~~G~~~~ 92 (97)
||||+|||||||||+|+...
T Consensus 85 ~aYGqtgSGKTyTm~G~~~~ 104 (345)
T d1x88a1 85 FAYGQTGTGKTFTMEGERSP 104 (345)
T ss_dssp EEEECTTSSHHHHHTBCCCG
T ss_pred EeeeeccccceEEeeecCCc
Confidence 99999999999999998765
|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|