Psyllid ID: psy15024
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 130 | ||||||
| 189236651 | 564 | PREDICTED: similar to n-acetylgalactosam | 0.9 | 0.207 | 0.641 | 1e-41 | |
| 405973911 | 581 | Polypeptide N-acetylgalactosaminyltransf | 0.907 | 0.203 | 0.618 | 8e-40 | |
| 345319818 | 628 | PREDICTED: polypeptide N-acetylgalactosa | 0.9 | 0.186 | 0.589 | 3e-39 | |
| 449497211 | 669 | PREDICTED: polypeptide N-acetylgalactosa | 0.907 | 0.176 | 0.584 | 2e-38 | |
| 363731636 | 566 | PREDICTED: polypeptide N-acetylgalactosa | 0.907 | 0.208 | 0.584 | 2e-38 | |
| 390477336 | 571 | PREDICTED: LOW QUALITY PROTEIN: polypept | 0.907 | 0.206 | 0.584 | 2e-38 | |
| 13938114 | 526 | Galnt2 protein, partial [Mus musculus] | 0.907 | 0.224 | 0.584 | 3e-38 | |
| 149758073 | 539 | PREDICTED: polypeptide N-acetylgalactosa | 0.907 | 0.218 | 0.584 | 3e-38 | |
| 74195843 | 544 | unnamed protein product [Mus musculus] | 0.907 | 0.216 | 0.584 | 3e-38 | |
| 345798845 | 588 | PREDICTED: polypeptide N-acetylgalactosa | 0.907 | 0.200 | 0.584 | 3e-38 |
| >gi|189236651|ref|XP_969621.2| PREDICTED: similar to n-acetylgalactosaminyltransferase [Tribolium castaneum] gi|270005204|gb|EFA01652.1| hypothetical protein TcasGA2_TC007223 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 174 bits (440), Expect = 1e-41, Method: Compositional matrix adjust.
Identities = 75/117 (64%), Positives = 91/117 (77%)
Query: 1 MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPELQVPSSSQITIG 60
MD+YKH+YYA VPLAK IPFGDIS+R+ LR LQCKPFKWYL+HVYPEL +P ++ +G
Sbjct: 384 MDDYKHFYYAAVPLAKNIPFGDISERLELRRNLQCKPFKWYLQHVYPELAIPQATSAHVG 443
Query: 61 IIHQGAWCLDTLGNVNDGVVGLYPCHHTGGNQAWSLTKEGFIKHHDTCLTIVNEMPG 117
+ QG +CLDT+G++ DG V LY CHHTGGNQ W LT G IKHHD CLT+ + M G
Sbjct: 444 ELRQGMYCLDTMGHLIDGTVALYQCHHTGGNQEWGLTSGGLIKHHDLCLTLDDYMKG 500
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|405973911|gb|EKC38600.1| Polypeptide N-acetylgalactosaminyltransferase 2 [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|345319818|ref|XP_001521442.2| PREDICTED: polypeptide N-acetylgalactosaminyltransferase 2-like [Ornithorhynchus anatinus] | Back alignment and taxonomy information |
|---|
| >gi|449497211|ref|XP_002190803.2| PREDICTED: polypeptide N-acetylgalactosaminyltransferase 2 [Taeniopygia guttata] | Back alignment and taxonomy information |
|---|
| >gi|363731636|ref|XP_419581.3| PREDICTED: polypeptide N-acetylgalactosaminyltransferase 2 [Gallus gallus] | Back alignment and taxonomy information |
|---|
| >gi|390477336|ref|XP_003735278.1| PREDICTED: LOW QUALITY PROTEIN: polypeptide N-acetylgalactosaminyltransferase 2 [Callithrix jacchus] | Back alignment and taxonomy information |
|---|
| >gi|13938114|gb|AAH07172.1| Galnt2 protein, partial [Mus musculus] | Back alignment and taxonomy information |
|---|
| >gi|149758073|ref|XP_001496259.1| PREDICTED: polypeptide N-acetylgalactosaminyltransferase 2 [Equus caballus] | Back alignment and taxonomy information |
|---|
| >gi|74195843|dbj|BAE30483.1| unnamed protein product [Mus musculus] | Back alignment and taxonomy information |
|---|
| >gi|345798845|ref|XP_003434499.1| PREDICTED: polypeptide N-acetylgalactosaminyltransferase 2 [Canis lupus familiaris] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 130 | ||||||
| UNIPROTKB|F1NDK8 | 530 | GALNT2 "Uncharacterized protei | 0.907 | 0.222 | 0.584 | 2.6e-38 | |
| UNIPROTKB|E1BB48 | 571 | GALNT2 "Uncharacterized protei | 0.907 | 0.206 | 0.584 | 2.6e-38 | |
| UNIPROTKB|F1P835 | 533 | GALNT2 "Uncharacterized protei | 0.907 | 0.221 | 0.584 | 2.6e-38 | |
| UNIPROTKB|J9P017 | 504 | GALNT2 "Uncharacterized protei | 0.907 | 0.234 | 0.584 | 2.6e-38 | |
| UNIPROTKB|G3V1S6 | 533 | GALNT2 "UDP-N-acetyl-alpha-D-g | 0.907 | 0.221 | 0.584 | 2.6e-38 | |
| UNIPROTKB|Q10471 | 571 | GALNT2 "Polypeptide N-acetylga | 0.907 | 0.206 | 0.584 | 2.6e-38 | |
| UNIPROTKB|F1RG44 | 549 | GALNT2 "Uncharacterized protei | 0.907 | 0.214 | 0.584 | 2.6e-38 | |
| RGD|1310692 | 530 | Galnt2 "UDP-N-acetyl-alpha-D-g | 0.907 | 0.222 | 0.576 | 3.4e-38 | |
| FB|FBgn0031530 | 633 | pgant2 "polypeptide GalNAc tra | 0.892 | 0.183 | 0.579 | 1.4e-35 | |
| ZFIN|ZDB-GENE-041111-110 | 565 | galnt2 "UDP-N-acetyl-alpha-D-g | 0.907 | 0.208 | 0.524 | 3.9e-34 |
| UNIPROTKB|F1NDK8 GALNT2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 410 (149.4 bits), Expect = 2.6e-38, P = 2.6e-38
Identities = 69/118 (58%), Positives = 89/118 (75%)
Query: 1 MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPELQVPSSSQITIG 60
MD YK++YYA VP A+ +P+G+I R+ LR+RL CKPFKWYLE+VYPEL+VP I G
Sbjct: 348 MDEYKNFYYAAVPSARNVPYGNIQSRMELRKRLSCKPFKWYLENVYPELRVPDHQDIAFG 407
Query: 61 IIHQGAWCLDTLGNVNDGVVGLYPCHHTGGNQAWSLTKEGFIKHHDTCLTIVNEMPGT 118
+ QG CLDTLG+ DGVVG+Y CH+ GGNQ W+LTK+ +KH D CLT+V+ PG+
Sbjct: 408 ALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKDKSVKHMDLCLTVVDRAPGS 465
|
|
| UNIPROTKB|E1BB48 GALNT2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P835 GALNT2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P017 GALNT2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V1S6 GALNT2 "UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2), isoform CRA_b" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q10471 GALNT2 "Polypeptide N-acetylgalactosaminyltransferase 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RG44 GALNT2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|1310692 Galnt2 "UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0031530 pgant2 "polypeptide GalNAc transferase 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041111-110 galnt2 "UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 130 | |||
| cd02510 | 299 | cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the fo | 8e-21 | |
| cd00161 | 124 | cd00161, RICIN, Ricin-type beta-trefoil; Carbohydr | 5e-12 | |
| smart00458 | 118 | smart00458, RICIN, Ricin-type beta-trefoil | 2e-09 | |
| pfam00652 | 124 | pfam00652, Ricin_B_lectin, Ricin-type beta-trefoil | 3e-09 | |
| cd00161 | 124 | cd00161, RICIN, Ricin-type beta-trefoil; Carbohydr | 4e-08 | |
| pfam00652 | 124 | pfam00652, Ricin_B_lectin, Ricin-type beta-trefoil | 2e-07 | |
| smart00458 | 118 | smart00458, RICIN, Ricin-type beta-trefoil | 4e-07 |
| >gnl|CDD|133004 cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the formation of mucin-type O-linked glycans | Back alignment and domain information |
|---|
Score = 84.6 bits (210), Expect = 8e-21
Identities = 28/46 (60%), Positives = 35/46 (76%)
Query: 1 MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVY 46
MD YK Y+Y P + I +GD+S+R ALRERL+CK FKWYLE+VY
Sbjct: 254 MDEYKEYFYKARPELRNIDYGDLSERKALRERLKCKSFKWYLENVY 299
|
UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferases (pp-GalNAc-T) initiate the formation of mucin-type, O-linked glycans by catalyzing the transfer of alpha-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to hydroxyl groups of Ser or Thr residues of core proteins to form the Tn antigen (GalNAc-a-1-O-Ser/Thr). These enzymes are type II membrane proteins with a GT-A type catalytic domain and a lectin domain located on the lumen side of the Golgi apparatus. In human, there are 15 isozymes of pp-GalNAc-Ts, representing the largest of all glycosyltransferase families. Each isozyme has unique but partially redundant substrate specificity for glycosylation sites on acceptor proteins. Length = 299 |
| >gnl|CDD|238092 cd00161, RICIN, Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication | Back alignment and domain information |
|---|
| >gnl|CDD|214672 smart00458, RICIN, Ricin-type beta-trefoil | Back alignment and domain information |
|---|
| >gnl|CDD|216044 pfam00652, Ricin_B_lectin, Ricin-type beta-trefoil lectin domain | Back alignment and domain information |
|---|
| >gnl|CDD|238092 cd00161, RICIN, Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication | Back alignment and domain information |
|---|
| >gnl|CDD|216044 pfam00652, Ricin_B_lectin, Ricin-type beta-trefoil lectin domain | Back alignment and domain information |
|---|
| >gnl|CDD|214672 smart00458, RICIN, Ricin-type beta-trefoil | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 130 | |||
| KOG3738|consensus | 559 | 100.0 | ||
| KOG3736|consensus | 578 | 100.0 | ||
| KOG3737|consensus | 603 | 99.97 | ||
| cd02510 | 299 | pp-GalNAc-T pp-GalNAc-T initiates the formation of | 99.06 | |
| PF00652 | 124 | Ricin_B_lectin: Ricin-type beta-trefoil lectin dom | 98.9 | |
| cd00161 | 124 | RICIN Ricin-type beta-trefoil; Carbohydrate-bindin | 98.83 | |
| cd00161 | 124 | RICIN Ricin-type beta-trefoil; Carbohydrate-bindin | 98.68 | |
| smart00458 | 117 | RICIN Ricin-type beta-trefoil. Carbohydrate-bindin | 98.61 | |
| PF00652 | 124 | Ricin_B_lectin: Ricin-type beta-trefoil lectin dom | 98.53 | |
| smart00458 | 117 | RICIN Ricin-type beta-trefoil. Carbohydrate-bindin | 98.47 | |
| PF14200 | 105 | RicinB_lectin_2: Ricin-type beta-trefoil lectin do | 97.93 | |
| KOG3736|consensus | 578 | 97.77 | ||
| KOG3738|consensus | 559 | 95.83 | ||
| PF14200 | 105 | RicinB_lectin_2: Ricin-type beta-trefoil lectin do | 95.27 | |
| PLN02899 | 633 | alpha-galactosidase | 94.9 | |
| KOG3737|consensus | 603 | 89.13 | ||
| PF03498 | 150 | CDtoxinA: Cytolethal distending toxin A/C family; | 82.58 | |
| PF03002 | 18 | Somatostatin: Somatostatin/Cortistatin family; Int | 80.83 |
| >KOG3738|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-40 Score=265.88 Aligned_cols=125 Identities=46% Similarity=0.939 Sum_probs=118.8
Q ss_pred CcchhHHHhhhCCCCCCCCCCCchHHHHHHHHcCCcCchhhhhhhcCCCCCCCCCcceeceeecCceeeeccCCCCCCeE
Q psy15024 1 MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPELQVPSSSQITIGIIHQGAWCLDTLGNVNDGVV 80 (130)
Q Consensus 1 mDeyk~~~y~~~P~~~~~~~Gdis~r~~LR~~L~CksF~WyL~nV~pel~~p~~~~~~~G~i~~~~~CLD~~~~~~g~~v 80 (130)
|||||++||+++|.|+.+++|+|.+|++||++|+||||+|||+||||||.+|.....++|.|+++..|||+++..+.+.+
T Consensus 376 mDEYK~~yyaarPsAr~vpfg~i~~rL~~Rk~l~CksFkWYLenVyPeL~ip~~~~~~~g~lrqg~~Cl~s~~~~~~~~~ 455 (559)
T KOG3738|consen 376 MDEYKNYYYAARPSARRVPFGNIYDRLELRKKLRCKSFKWYLENVYPELRIPFKELIATGTLRQGDNCLDSQGQNSQEAL 455 (559)
T ss_pred HHHHHHHHHhcCchhhcCCCccHHHHHHHHhhcCCcchhhhhhhcCcceeccccccccccchhccchhhhhhhcccccCc
Confidence 89999999999999999999999999999999999999999999999999999888999999999999999988777789
Q ss_pred EEEecCCCCCceeEEE--ccCCeEeecCeeeEEeCCCCCCeeEEeec
Q psy15024 81 GLYPCHHTGGNQAWSL--TKEGFIKHHDTCLTIVNEMPGTGTHEEVR 125 (130)
Q Consensus 81 ~l~~C~~~~~~Q~W~~--t~~~~Ir~~~~CLd~~~~~~g~~V~l~~~ 125 (130)
+|+.||+.+++|.|.+ +++..|.+.++||++.+.++|++|.|+.-
T Consensus 456 gl~~C~~s~~nqqwa~~~t~~~~~~~~elCL~v~~~~pg~~v~l~~C 502 (559)
T KOG3738|consen 456 GLASCHGSGGNQQWAFLRTSTQLITHRELCLAVGSNTPGSPVALVPC 502 (559)
T ss_pred ceeecccCCCCcchhhhhhhhhHHHHHhhhheeecCCCCCeEEEEec
Confidence 9999999999999999 77778889999999999999999999864
|
|
| >KOG3736|consensus | Back alignment and domain information |
|---|
| >KOG3737|consensus | Back alignment and domain information |
|---|
| >cd02510 pp-GalNAc-T pp-GalNAc-T initiates the formation of mucin-type O-linked glycans | Back alignment and domain information |
|---|
| >PF00652 Ricin_B_lectin: Ricin-type beta-trefoil lectin domain; InterPro: IPR000772 Ricin is a legume lectin from the seeds of the castor bean plant, Ricinus communis | Back alignment and domain information |
|---|
| >cd00161 RICIN Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication | Back alignment and domain information |
|---|
| >cd00161 RICIN Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication | Back alignment and domain information |
|---|
| >smart00458 RICIN Ricin-type beta-trefoil | Back alignment and domain information |
|---|
| >PF00652 Ricin_B_lectin: Ricin-type beta-trefoil lectin domain; InterPro: IPR000772 Ricin is a legume lectin from the seeds of the castor bean plant, Ricinus communis | Back alignment and domain information |
|---|
| >smart00458 RICIN Ricin-type beta-trefoil | Back alignment and domain information |
|---|
| >PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A | Back alignment and domain information |
|---|
| >KOG3736|consensus | Back alignment and domain information |
|---|
| >KOG3738|consensus | Back alignment and domain information |
|---|
| >PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A | Back alignment and domain information |
|---|
| >PLN02899 alpha-galactosidase | Back alignment and domain information |
|---|
| >KOG3737|consensus | Back alignment and domain information |
|---|
| >PF03498 CDtoxinA: Cytolethal distending toxin A/C family; InterPro: IPR003558 Escherichia coli, Haemophilus spp and Campylobacter spp | Back alignment and domain information |
|---|
| >PF03002 Somatostatin: Somatostatin/Cortistatin family; InterPro: IPR018142 Somatostatin inhibits the release of the pituitary growth hormone, somatotropin and inhibits the release of glucagon and insulin from the pancreas of fasted animals | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 130 | ||||
| 2ffu_A | 501 | Crystal Structure Of Human Ppgalnact-2 Complexed Wi | 4e-41 | ||
| 1xhb_A | 472 | The Crystal Structure Of Udp-Galnac: Polypeptide Al | 2e-21 | ||
| 2d7i_A | 570 | Crsytal Structure Of Pp-Galnac-T10 With Udp, Galnac | 1e-06 |
| >pdb|2FFU|A Chain A, Crystal Structure Of Human Ppgalnact-2 Complexed With Udp And Ea2 Length = 501 | Back alignment and structure |
|
| >pdb|1XHB|A Chain A, The Crystal Structure Of Udp-Galnac: Polypeptide Alpha-N- Acetylgalactosaminyltransferase-T1 Length = 472 | Back alignment and structure |
| >pdb|2D7I|A Chain A, Crsytal Structure Of Pp-Galnac-T10 With Udp, Galnac And Mn2+ Length = 570 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 130 | |||
| 2ffu_A | 501 | Ppgalnact-2, polypeptide N-acetylgalactosaminyltra | 9e-40 | |
| 1xhb_A | 472 | Polypeptide N-acetylgalactosaminyltransferase 1; g | 2e-35 | |
| 2d7i_A | 570 | Polypeptide N-acetylgalactosaminyltransferase 10; | 4e-24 | |
| 2d7i_A | 570 | Polypeptide N-acetylgalactosaminyltransferase 10; | 4e-07 | |
| 2vlc_A | 570 | Cinnamomin, type 2 ribosome-inactivating protein c | 2e-09 | |
| 2vlc_A | 570 | Cinnamomin, type 2 ribosome-inactivating protein c | 2e-04 | |
| 1m2t_B | 263 | Mistletoe lectin I B chain; ribosome inactivation, | 5e-09 | |
| 2aai_B | 262 | Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG | 7e-09 | |
| 2aai_B | 262 | Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG | 7e-05 | |
| 2aai_B | 262 | Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG | 4e-04 | |
| 2aai_B | 262 | Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG | 8e-04 | |
| 1ggp_B | 254 | TKL-1, protein (lectin 1 B chain); sugar binding p | 9e-09 | |
| 1abr_B | 267 | Abrin-A; glycosidase/carbohydrate complex, lectin, | 1e-08 | |
| 1abr_B | 267 | Abrin-A; glycosidase/carbohydrate complex, lectin, | 7e-04 | |
| 1abr_B | 267 | Abrin-A; glycosidase/carbohydrate complex, lectin, | 8e-04 | |
| 1vcl_A | 432 | Hemolytic lectin CEL-III; hemolysis, hemagglutinat | 2e-07 | |
| 1vcl_A | 432 | Hemolytic lectin CEL-III; hemolysis, hemagglutinat | 2e-06 | |
| 1vcl_A | 432 | Hemolytic lectin CEL-III; hemolysis, hemagglutinat | 3e-06 | |
| 3c9z_A | 258 | Agglutinin II, SNA-II; beta-trefoil, ricin-B domai | 4e-07 | |
| 3a07_A | 118 | Actinohivin; carbohydrate-binding module family 13 | 2e-06 | |
| 3a07_A | 118 | Actinohivin; carbohydrate-binding module family 13 | 5e-05 | |
| 1xez_A | 721 | Hemolysin, cytolysin; pore-forming toxin, Pro-toxi | 1e-05 | |
| 1knl_A | 130 | Endo-1,4-beta-xylanase A; carbohydrate binding mod | 3e-05 | |
| 1knl_A | 130 | Endo-1,4-beta-xylanase A; carbohydrate binding mod | 6e-05 |
| >2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Length = 501 | Back alignment and structure |
|---|
Score = 137 bits (346), Expect = 9e-40
Identities = 69/118 (58%), Positives = 89/118 (75%)
Query: 1 MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPELQVPSSSQITIG 60
MD YK++YYA VP A+ +P+G+I R+ LR++L CKPFKWYLE+VYPEL+VP I G
Sbjct: 319 MDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFG 378
Query: 61 IIHQGAWCLDTLGNVNDGVVGLYPCHHTGGNQAWSLTKEGFIKHHDTCLTIVNEMPGT 118
+ QG CLDTLG+ DGVVG+Y CH+ GGNQ W+LTKE +KH D CLT+V+ PG+
Sbjct: 379 ALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGS 436
|
| >1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Length = 472 | Back alignment and structure |
|---|
| >2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Length = 570 | Back alignment and structure |
|---|
| >2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Length = 570 | Back alignment and structure |
|---|
| >2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} Length = 570 | Back alignment and structure |
|---|
| >2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} Length = 570 | Back alignment and structure |
|---|
| >1m2t_B Mistletoe lectin I B chain; ribosome inactivation, ribosome inhibitor, hydrolase; HET: NAG FUC ADE; 1.89A {Viscum album} SCOP: b.42.2.1 b.42.2.1 PDB: 2r9k_B* 3d7w_B* 3cef_B* 1sz6_B* 1pum_B* 1puu_B* 2rg9_B* 3o5w_B* 1onk_B* 1oql_B* 1tfm_B* 1pc8_B* 1yf8_B* 1ce7_B* 2mll_B* Length = 263 | Back alignment and structure |
|---|
| >2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* Length = 262 | Back alignment and structure |
|---|
| >2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* Length = 262 | Back alignment and structure |
|---|
| >2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* Length = 262 | Back alignment and structure |
|---|
| >2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* Length = 262 | Back alignment and structure |
|---|
| >1ggp_B TKL-1, protein (lectin 1 B chain); sugar binding protein; 2.70A {Trichosanthes kirilowii} SCOP: b.42.2.1 b.42.2.1 Length = 254 | Back alignment and structure |
|---|
| >1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* Length = 267 | Back alignment and structure |
|---|
| >1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* Length = 267 | Back alignment and structure |
|---|
| >1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* Length = 267 | Back alignment and structure |
|---|
| >1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* Length = 432 | Back alignment and structure |
|---|
| >1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* Length = 432 | Back alignment and structure |
|---|
| >1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* Length = 432 | Back alignment and structure |
|---|
| >3c9z_A Agglutinin II, SNA-II; beta-trefoil, ricin-B domain, glycosylation, glycoprotein, L sugar binding protein, plant protein; HET: NAG FUC SO4; 1.35A {Sambucus nigra} PDB: 3ca0_A* 3ca1_A* 3ca3_A* 3ca4_A* 3ca5_A* 3ca6_A* 3cah_A* 1hwm_B* 1hwn_B* 1hwo_B* 1hwp_B* Length = 258 | Back alignment and structure |
|---|
| >3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} Length = 118 | Back alignment and structure |
|---|
| >3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} Length = 118 | Back alignment and structure |
|---|
| >1xez_A Hemolysin, cytolysin; pore-forming toxin, Pro-toxin, water- soluble monomer, beta-prism, beta-trefoil; HET: BOG; 2.30A {Vibrio cholerae} PDB: 3o44_A Length = 721 | Back alignment and structure |
|---|
| >1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* Length = 130 | Back alignment and structure |
|---|
| >1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* Length = 130 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 130 | |||
| 2ffu_A | 501 | Ppgalnact-2, polypeptide N-acetylgalactosaminyltra | 100.0 | |
| 1xhb_A | 472 | Polypeptide N-acetylgalactosaminyltransferase 1; g | 100.0 | |
| 2d7i_A | 570 | Polypeptide N-acetylgalactosaminyltransferase 10; | 99.97 | |
| 3a21_A | 614 | Putative secreted alpha-galactosidase; beta-alpha- | 99.92 | |
| 1knl_A | 130 | Endo-1,4-beta-xylanase A; carbohydrate binding mod | 99.26 | |
| 1abr_B | 267 | Abrin-A; glycosidase/carbohydrate complex, lectin, | 99.14 | |
| 1vcl_A | 432 | Hemolytic lectin CEL-III; hemolysis, hemagglutinat | 99.08 | |
| 3c9z_A | 258 | Agglutinin II, SNA-II; beta-trefoil, ricin-B domai | 99.03 | |
| 3c9z_A | 258 | Agglutinin II, SNA-II; beta-trefoil, ricin-B domai | 99.02 | |
| 1abr_B | 267 | Abrin-A; glycosidase/carbohydrate complex, lectin, | 99.01 | |
| 1m2t_B | 263 | Mistletoe lectin I B chain; ribosome inactivation, | 98.99 | |
| 2aai_B | 262 | Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG | 98.98 | |
| 1ggp_B | 254 | TKL-1, protein (lectin 1 B chain); sugar binding p | 98.97 | |
| 1knl_A | 130 | Endo-1,4-beta-xylanase A; carbohydrate binding mod | 98.96 | |
| 1m2t_B | 263 | Mistletoe lectin I B chain; ribosome inactivation, | 98.95 | |
| 2aai_B | 262 | Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG | 98.92 | |
| 2d1z_A | 436 | Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en | 98.92 | |
| 1ggp_B | 254 | TKL-1, protein (lectin 1 B chain); sugar binding p | 98.91 | |
| 2ffu_A | 501 | Ppgalnact-2, polypeptide N-acetylgalactosaminyltra | 98.9 | |
| 1xhb_A | 472 | Polypeptide N-acetylgalactosaminyltransferase 1; g | 98.89 | |
| 2dry_A | 130 | 29-kDa galactose-binding lectin; earthworm lumbric | 98.86 | |
| 1vcl_A | 432 | Hemolytic lectin CEL-III; hemolysis, hemagglutinat | 98.86 | |
| 2ao3_A | 130 | 29-kDa galactose-binding lectin; earthworm lumbric | 98.85 | |
| 3a07_A | 118 | Actinohivin; carbohydrate-binding module family 13 | 98.83 | |
| 3a07_A | 118 | Actinohivin; carbohydrate-binding module family 13 | 98.81 | |
| 2vlc_A | 570 | Cinnamomin, type 2 ribosome-inactivating protein c | 98.8 | |
| 2vlc_A | 570 | Cinnamomin, type 2 ribosome-inactivating protein c | 98.79 | |
| 2dry_A | 130 | 29-kDa galactose-binding lectin; earthworm lumbric | 98.78 | |
| 2d7i_A | 570 | Polypeptide N-acetylgalactosaminyltransferase 10; | 98.69 | |
| 2d1z_A | 436 | Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en | 98.67 | |
| 3pg0_A | 165 | Threefoil; symmetric design, beta-trefoil, enginee | 98.65 | |
| 3pg0_A | 165 | Threefoil; symmetric design, beta-trefoil, enginee | 98.59 | |
| 3a21_A | 614 | Putative secreted alpha-galactosidase; beta-alpha- | 98.53 | |
| 2ao3_A | 130 | 29-kDa galactose-binding lectin; earthworm lumbric | 98.53 | |
| 3phz_A | 286 | Ricin B-related lectin; beta trefoil, saccharide b | 98.32 | |
| 3vsf_A | 526 | Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactana | 98.24 | |
| 3phz_A | 286 | Ricin B-related lectin; beta trefoil, saccharide b | 98.21 | |
| 3ef2_A | 293 | Agglutinin, lectin; beta-trefoil, calcium-binding, | 98.17 | |
| 3vsf_A | 526 | Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactana | 98.16 | |
| 3ef2_A | 293 | Agglutinin, lectin; beta-trefoil, calcium-binding, | 97.84 | |
| 3nbc_A | 148 | Ricin B-like lectin; lactose, sugar BIND protein; | 97.74 | |
| 1ybi_A | 288 | HA33A, HA33/A, non-toxin haemagglutinin HA34; beta | 97.39 | |
| 3nbc_A | 148 | Ricin B-like lectin; lactose, sugar BIND protein; | 97.38 | |
| 3aj6_A | 286 | Main hemagglutinin component; toxin, beta-trefoil; | 97.3 | |
| 2vse_A | 841 | MTX holotoxin, mosquitocidal toxin; ADP-ribosyltra | 97.07 | |
| 1ybi_A | 288 | HA33A, HA33/A, non-toxin haemagglutinin HA34; beta | 96.97 | |
| 3aj6_A | 286 | Main hemagglutinin component; toxin, beta-trefoil; | 96.95 | |
| 1dqg_A | 135 | Mannose receptor; beta trefoil, multilectin recept | 96.66 | |
| 1xez_A | 721 | Hemolysin, cytolysin; pore-forming toxin, Pro-toxi | 96.44 | |
| 2vse_A | 841 | MTX holotoxin, mosquitocidal toxin; ADP-ribosyltra | 95.88 | |
| 1sr4_A | 206 | CDT A, cytolethal distending toxin subunit A; bact | 90.47 |
| >2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=4.5e-37 Score=251.60 Aligned_cols=124 Identities=56% Similarity=1.120 Sum_probs=116.0
Q ss_pred CcchhHHHhhhCCCCCCCCCCCchHHHHHHHHcCCcCchhhhhhhcCCCCCCCCCcceeceeecCceeeeccCCCCCCeE
Q psy15024 1 MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPELQVPSSSQITIGIIHQGAWCLDTLGNVNDGVV 80 (130)
Q Consensus 1 mDeyk~~~y~~~P~~~~~~~Gdis~r~~LR~~L~CksF~WyL~nV~pel~~p~~~~~~~G~i~~~~~CLD~~~~~~g~~v 80 (130)
||+||++||.++|.++.+++|||++|++||++|+||+|+|||+|||||+.+|.+...++|+|+++++|||+.+...+++|
T Consensus 319 ~d~~~~~~y~~~p~~~~~~~g~~~~r~~lr~~l~c~~f~w~l~~v~p~~~~p~~~~~~~g~i~~~~~Cld~~~~~~~~~v 398 (501)
T 2ffu_A 319 MDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVV 398 (501)
T ss_dssp CGGGHHHHHHHCGGGGGCCCCCCHHHHHHHHHTTCCCHHHHHHHTCTTSCCCCCCCCCEEEEEETTEEEECTTCCTTCCC
T ss_pred HHHHHHHHhhcCcccccCCccchHHHHHHHHhcCCCCeEEehhccccccccccccccccccccccCccccccCCCCCCEE
Confidence 79999999999999999999999999999999999999999999999999998777889999999999999887778889
Q ss_pred EEEecCCCCCceeEEEccCCeEeecCeeeEEeCCCCCCeeEEee
Q psy15024 81 GLYPCHHTGGNQAWSLTKEGFIKHHDTCLTIVNEMPGTGTHEEV 124 (130)
Q Consensus 81 ~l~~C~~~~~~Q~W~~t~~~~Ir~~~~CLd~~~~~~g~~V~l~~ 124 (130)
++++||+.++||.|.++.+|+|+++++|||+.+.++|++|++..
T Consensus 399 ~l~~C~g~~~nQ~w~~~~~g~i~~~~~Cld~~~~~~g~~v~l~~ 442 (501)
T 2ffu_A 399 GVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQG 442 (501)
T ss_dssp EEEECCSSCGGGCEEECTTSCEEETTEEEECSCCSTTCBCEEEE
T ss_pred EEEEcCCCCcceEEEEecCCceeeccccceeccCCCCCeEEEEe
Confidence 99999998779999999999999999999998777888898753
|
| >1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 | Back alignment and structure |
|---|
| >2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* | Back alignment and structure |
|---|
| >3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* | Back alignment and structure |
|---|
| >1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* | Back alignment and structure |
|---|
| >1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* | Back alignment and structure |
|---|
| >1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* | Back alignment and structure |
|---|
| >3c9z_A Agglutinin II, SNA-II; beta-trefoil, ricin-B domain, glycosylation, glycoprotein, L sugar binding protein, plant protein; HET: NAG FUC SO4; 1.35A {Sambucus nigra} PDB: 3ca0_A* 3ca1_A* 3ca3_A* 3ca4_A* 3ca5_A* 3ca6_A* 3cah_A* 1hwm_B* 1hwn_B* 1hwo_B* 1hwp_B* | Back alignment and structure |
|---|
| >3c9z_A Agglutinin II, SNA-II; beta-trefoil, ricin-B domain, glycosylation, glycoprotein, L sugar binding protein, plant protein; HET: NAG FUC SO4; 1.35A {Sambucus nigra} PDB: 3ca0_A* 3ca1_A* 3ca3_A* 3ca4_A* 3ca5_A* 3ca6_A* 3cah_A* 1hwm_B* 1hwn_B* 1hwo_B* 1hwp_B* | Back alignment and structure |
|---|
| >1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* | Back alignment and structure |
|---|
| >1m2t_B Mistletoe lectin I B chain; ribosome inactivation, ribosome inhibitor, hydrolase; HET: NAG FUC ADE; 1.89A {Viscum album} SCOP: b.42.2.1 b.42.2.1 PDB: 2r9k_B* 3d7w_B* 3cef_B* 1sz6_B* 1pum_B* 1puu_B* 2rg9_B* 3o5w_B* 1onk_B* 1oql_B* 1tfm_B* 1pc8_B* 1yf8_B* 1ce7_B* 2mll_B* | Back alignment and structure |
|---|
| >2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* | Back alignment and structure |
|---|
| >1ggp_B TKL-1, protein (lectin 1 B chain); sugar binding protein; 2.70A {Trichosanthes kirilowii} SCOP: b.42.2.1 b.42.2.1 | Back alignment and structure |
|---|
| >1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* | Back alignment and structure |
|---|
| >1m2t_B Mistletoe lectin I B chain; ribosome inactivation, ribosome inhibitor, hydrolase; HET: NAG FUC ADE; 1.89A {Viscum album} SCOP: b.42.2.1 b.42.2.1 PDB: 2r9k_B* 3d7w_B* 3cef_B* 1sz6_B* 1pum_B* 1puu_B* 2rg9_B* 3o5w_B* 1onk_B* 1oql_B* 1tfm_B* 1pc8_B* 1yf8_B* 1ce7_B* 2mll_B* | Back alignment and structure |
|---|
| >2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* | Back alignment and structure |
|---|
| >2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A | Back alignment and structure |
|---|
| >1ggp_B TKL-1, protein (lectin 1 B chain); sugar binding protein; 2.70A {Trichosanthes kirilowii} SCOP: b.42.2.1 b.42.2.1 | Back alignment and structure |
|---|
| >2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* | Back alignment and structure |
|---|
| >1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 | Back alignment and structure |
|---|
| >2dry_A 29-kDa galactose-binding lectin; earthworm lumbricus terrestris, sialic acid, in vitro evolution, beta-trefoil fold, sugar binding protein; HET: PGE; 1.80A {Lumbricus terrestris} PDB: 2drz_A* 2ds0_A* 2zqn_A* 2zqo_A* | Back alignment and structure |
|---|
| >1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* | Back alignment and structure |
|---|
| >3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} | Back alignment and structure |
|---|
| >3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} | Back alignment and structure |
|---|
| >2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} | Back alignment and structure |
|---|
| >2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} | Back alignment and structure |
|---|
| >2dry_A 29-kDa galactose-binding lectin; earthworm lumbricus terrestris, sialic acid, in vitro evolution, beta-trefoil fold, sugar binding protein; HET: PGE; 1.80A {Lumbricus terrestris} PDB: 2drz_A* 2ds0_A* 2zqn_A* 2zqo_A* | Back alignment and structure |
|---|
| >2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* | Back alignment and structure |
|---|
| >2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A | Back alignment and structure |
|---|
| >3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} | Back alignment and structure |
|---|
| >3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} | Back alignment and structure |
|---|
| >3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* | Back alignment and structure |
|---|
| >3phz_A Ricin B-related lectin; beta trefoil, saccharide binding lectin, 2,6-sialyl-lactosam sugar binding protein; HET: NAG GAL SIA; 1.70A {Polyporus squamosus} | Back alignment and structure |
|---|
| >3vsf_A Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactanase, sugar binding protein; 2.76A {Clostridium thermocellum} PDB: 3vsz_A* 3vt0_A* 3vt1_B* 3vt2_A* | Back alignment and structure |
|---|
| >3phz_A Ricin B-related lectin; beta trefoil, saccharide binding lectin, 2,6-sialyl-lactosam sugar binding protein; HET: NAG GAL SIA; 1.70A {Polyporus squamosus} | Back alignment and structure |
|---|
| >3ef2_A Agglutinin, lectin; beta-trefoil, calcium-binding, carbohydrate-binding, sugar-binding, sugar binding protein; HET: FUC GAL GLA; 1.80A {Marasmius oreades} PDB: 2iho_A* | Back alignment and structure |
|---|
| >3vsf_A Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactanase, sugar binding protein; 2.76A {Clostridium thermocellum} PDB: 3vsz_A* 3vt0_A* 3vt1_B* 3vt2_A* | Back alignment and structure |
|---|
| >3ef2_A Agglutinin, lectin; beta-trefoil, calcium-binding, carbohydrate-binding, sugar-binding, sugar binding protein; HET: FUC GAL GLA; 1.80A {Marasmius oreades} PDB: 2iho_A* | Back alignment and structure |
|---|
| >3nbc_A Ricin B-like lectin; lactose, sugar BIND protein; HET: LAT; 1.01A {Clitocybe nebularis} PDB: 3nbd_A* 3nbe_A* | Back alignment and structure |
|---|
| >1ybi_A HA33A, HA33/A, non-toxin haemagglutinin HA34; beta-trefoil; 1.50A {Clostridium botulinum} | Back alignment and structure |
|---|
| >3nbc_A Ricin B-like lectin; lactose, sugar BIND protein; HET: LAT; 1.01A {Clitocybe nebularis} PDB: 3nbd_A* 3nbe_A* | Back alignment and structure |
|---|
| >3aj6_A Main hemagglutinin component; toxin, beta-trefoil; HET: NGA; 1.48A {Clostridium botulinum} PDB: 1qxm_A 3aj5_A* 2ehm_A* 2ehi_A* 2ehn_A* 3ah1_A* 3ah2_A* 3ah4_A* 2e4m_A | Back alignment and structure |
|---|
| >2vse_A MTX holotoxin, mosquitocidal toxin; ADP-ribosyltransferase, lectin, ricin-B-like domain; 2.5A {Lysinibacillus sphaericus} PDB: 2vsa_A | Back alignment and structure |
|---|
| >1ybi_A HA33A, HA33/A, non-toxin haemagglutinin HA34; beta-trefoil; 1.50A {Clostridium botulinum} | Back alignment and structure |
|---|
| >3aj6_A Main hemagglutinin component; toxin, beta-trefoil; HET: NGA; 1.48A {Clostridium botulinum} PDB: 1qxm_A 3aj5_A* 2ehm_A* 2ehi_A* 2ehn_A* 3ah1_A* 3ah2_A* 3ah4_A* 2e4m_A | Back alignment and structure |
|---|
| >1dqg_A Mannose receptor; beta trefoil, multilectin receptor, pituitary hormones, sulfated carbohydrate, sugar binding protein; 1.70A {Mus musculus} SCOP: b.42.2.2 PDB: 1dqo_A* 1fwu_A* 1fwv_A* | Back alignment and structure |
|---|
| >1xez_A Hemolysin, cytolysin; pore-forming toxin, Pro-toxin, water- soluble monomer, beta-prism, beta-trefoil; HET: BOG; 2.30A {Vibrio cholerae} PDB: 3o44_A | Back alignment and structure |
|---|
| >2vse_A MTX holotoxin, mosquitocidal toxin; ADP-ribosyltransferase, lectin, ricin-B-like domain; 2.5A {Lysinibacillus sphaericus} PDB: 2vsa_A | Back alignment and structure |
|---|
| >1sr4_A CDT A, cytolethal distending toxin subunit A; bacterial, virulence, DNA damage, genotoxin, cytotoxins, cell cycle, apoptosis, lectin; 2.00A {Haemophilus ducreyi} SCOP: b.42.2.1 PDB: 2f2f_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 130 | ||||
| d1xhba2 | 328 | c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosa | 8e-21 | |
| d1xhba1 | 131 | b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosa | 3e-09 | |
| d1rzob1 | 135 | b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (le | 3e-08 | |
| d1ggpb1 | 126 | b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lecti | 2e-06 | |
| d1m2tb1 | 136 | b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lect | 2e-06 | |
| d1vcla1 | 150 | b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domai | 3e-06 | |
| d1hwmb2 | 131 | b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lect | 4e-06 | |
| d2aaib2 | 127 | b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lect | 8e-06 | |
| d1ggpb2 | 128 | b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lect | 8e-06 | |
| d1abrb1 | 140 | b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin | 1e-05 | |
| d1hwmb1 | 133 | b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin | 1e-04 | |
| d1m2tb2 | 126 | b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lect | 4e-04 | |
| d1abrb2 | 127 | b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lect | 8e-04 | |
| d1knma_ | 129 | b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1, | 0.003 |
| >d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 328 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Nucleotide-diphospho-sugar transferases superfamily: Nucleotide-diphospho-sugar transferases family: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain domain: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 83.4 bits (205), Expect = 8e-21
Identities = 24/48 (50%), Positives = 35/48 (72%)
Query: 1 MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPE 48
MD +K+++Y P + +GDIS R+ LR +LQCKPF WYLE++YP+
Sbjct: 280 MDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPD 327
|
| >d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 131 | Back information, alignment and structure |
|---|
| >d1rzob1 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Length = 135 | Back information, alignment and structure |
|---|
| >d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Length = 126 | Back information, alignment and structure |
|---|
| >d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Length = 136 | Back information, alignment and structure |
|---|
| >d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Length = 150 | Back information, alignment and structure |
|---|
| >d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Length = 131 | Back information, alignment and structure |
|---|
| >d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Length = 127 | Back information, alignment and structure |
|---|
| >d1ggpb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Length = 128 | Back information, alignment and structure |
|---|
| >d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Length = 140 | Back information, alignment and structure |
|---|
| >d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Length = 133 | Back information, alignment and structure |
|---|
| >d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Length = 126 | Back information, alignment and structure |
|---|
| >d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Length = 127 | Back information, alignment and structure |
|---|
| >d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} Length = 129 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 130 | |||
| d1xhba2 | 328 | Polypeptide N-acetylgalactosaminyltransferase 1, N | 99.69 | |
| d1xhba1 | 131 | Polypeptide N-acetylgalactosaminyltransferase 1, C | 99.5 | |
| d1vcla2 | 133 | Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar | 99.39 | |
| d1vcla1 | 150 | Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar | 99.34 | |
| d1ggpb1 | 126 | Plant cytotoxin B-chain (lectin) {Mongolian snake- | 99.3 | |
| d1knma_ | 129 | Xylan binding domain, CBM13 (Endo-1,4-beta-xylanas | 99.24 | |
| d2aaib2 | 127 | Plant cytotoxin B-chain (lectin) {Castor bean (Ric | 99.13 | |
| d1dqga_ | 134 | Mannose receptor {Mouse (Mus musculus) [TaxId: 100 | 99.09 | |
| d1abrb2 | 127 | Plant cytotoxin B-chain (lectin) {Abrus precatoriu | 99.06 | |
| d1hwmb1 | 133 | Plant cytotoxin B-chain (lectin) {Sambucus ebulus, | 99.05 | |
| d1abrb1 | 140 | Plant cytotoxin B-chain (lectin) {Abrus precatoriu | 99.05 | |
| d1m2tb1 | 136 | Plant cytotoxin B-chain (lectin) {European mistlet | 99.04 | |
| d1m2tb2 | 126 | Plant cytotoxin B-chain (lectin) {European mistlet | 99.03 | |
| d1ggpb1 | 126 | Plant cytotoxin B-chain (lectin) {Mongolian snake- | 99.02 | |
| d1hwmb2 | 131 | Plant cytotoxin B-chain (lectin) {Sambucus ebulus, | 98.99 | |
| d1m2tb2 | 126 | Plant cytotoxin B-chain (lectin) {European mistlet | 98.98 | |
| d1ggpb2 | 128 | Plant cytotoxin B-chain (lectin) {Mongolian snake- | 98.94 | |
| d1xhba1 | 131 | Polypeptide N-acetylgalactosaminyltransferase 1, C | 98.94 | |
| d1ggpb2 | 128 | Plant cytotoxin B-chain (lectin) {Mongolian snake- | 98.93 | |
| d1knma_ | 129 | Xylan binding domain, CBM13 (Endo-1,4-beta-xylanas | 98.93 | |
| d1m2tb1 | 136 | Plant cytotoxin B-chain (lectin) {European mistlet | 98.92 | |
| d2aaib2 | 127 | Plant cytotoxin B-chain (lectin) {Castor bean (Ric | 98.91 | |
| d1abrb2 | 127 | Plant cytotoxin B-chain (lectin) {Abrus precatoriu | 98.9 | |
| d1rzob1 | 135 | Plant cytotoxin B-chain (lectin) {Castor bean (Ric | 98.88 | |
| d1abrb1 | 140 | Plant cytotoxin B-chain (lectin) {Abrus precatoriu | 98.85 | |
| d1vcla2 | 133 | Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar | 98.84 | |
| d1hwmb2 | 131 | Plant cytotoxin B-chain (lectin) {Sambucus ebulus, | 98.81 | |
| d1rzob1 | 135 | Plant cytotoxin B-chain (lectin) {Castor bean (Ric | 98.68 | |
| d1hwmb1 | 133 | Plant cytotoxin B-chain (lectin) {Sambucus ebulus, | 98.68 | |
| d2zqna1 | 130 | 29-kDa galactose-binding lectin {Lumbricus terrest | 98.53 | |
| d2zqna1 | 130 | 29-kDa galactose-binding lectin {Lumbricus terrest | 98.3 | |
| d1dqga_ | 134 | Mannose receptor {Mouse (Mus musculus) [TaxId: 100 | 98.26 | |
| d2ihoa1 | 154 | Agglutinin MOA, N-terminal domain {Fairy-ring mush | 98.21 | |
| d1vcla1 | 150 | Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar | 98.17 | |
| d1sr4a_ | 167 | Cytolethal distending toxin subunit A {Haemophilus | 98.17 | |
| d2ihoa1 | 154 | Agglutinin MOA, N-terminal domain {Fairy-ring mush | 97.71 | |
| d1qxma2 | 138 | Hemagglutinin component Ha1 {Clostridium botulinum | 97.62 | |
| d1qxma2 | 138 | Hemagglutinin component Ha1 {Clostridium botulinum | 97.41 | |
| d1qxma1 | 145 | Hemagglutinin component Ha1 {Clostridium botulinum | 97.31 | |
| d1upsa2 | 131 | GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosi | 96.57 | |
| d1qxma1 | 145 | Hemagglutinin component Ha1 {Clostridium botulinum | 96.48 | |
| d1sr4a_ | 167 | Cytolethal distending toxin subunit A {Haemophilus | 95.16 | |
| d1upsa2 | 131 | GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosi | 92.89 |
| >d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Nucleotide-diphospho-sugar transferases superfamily: Nucleotide-diphospho-sugar transferases family: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain domain: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.69 E-value=5.9e-18 Score=128.73 Aligned_cols=48 Identities=50% Similarity=1.171 Sum_probs=47.0
Q ss_pred CcchhHHHhhhCCCCCCCCCCCchHHHHHHHHcCCcCchhhhhhhcCC
Q psy15024 1 MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPE 48 (130)
Q Consensus 1 mDeyk~~~y~~~P~~~~~~~Gdis~r~~LR~~L~CksF~WyL~nV~pe 48 (130)
|||||++||..+|.+..+++|||++|++||++|+||||+|||+|||||
T Consensus 280 l~~yk~~~~~~~~~~~~~~~~~i~~r~~Lr~~l~ck~f~w~~~~~~~~ 327 (328)
T d1xhba2 280 MDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPD 327 (328)
T ss_dssp CGGGGHHHHHTSTTGGGSCCCCCHHHHHHHHHTTCCCHHHHHHHTCTT
T ss_pred HHHHHHHHHHhCcccccCCcccHHHHHHHHHHhCCCChHHHHhhCCCC
Confidence 799999999999999999999999999999999999999999999998
|
| >d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vcla2 b.42.2.1 (A:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} | Back information, alignment and structure |
|---|
| >d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} | Back information, alignment and structure |
|---|
| >d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} | Back information, alignment and structure |
|---|
| >d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1dqga_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} | Back information, alignment and structure |
|---|
| >d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} | Back information, alignment and structure |
|---|
| >d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} | Back information, alignment and structure |
|---|
| >d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} | Back information, alignment and structure |
|---|
| >d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} | Back information, alignment and structure |
|---|
| >d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} | Back information, alignment and structure |
|---|
| >d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} | Back information, alignment and structure |
|---|
| >d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} | Back information, alignment and structure |
|---|
| >d1ggpb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} | Back information, alignment and structure |
|---|
| >d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ggpb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} | Back information, alignment and structure |
|---|
| >d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} | Back information, alignment and structure |
|---|
| >d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} | Back information, alignment and structure |
|---|
| >d1rzob1 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} | Back information, alignment and structure |
|---|
| >d1vcla2 b.42.2.1 (A:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} | Back information, alignment and structure |
|---|
| >d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} | Back information, alignment and structure |
|---|
| >d1rzob1 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} | Back information, alignment and structure |
|---|
| >d2zqna1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Lumbricus terrestris [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d2zqna1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Lumbricus terrestris [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1dqga_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} | Back information, alignment and structure |
|---|
| >d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} | Back information, alignment and structure |
|---|
| >d1sr4a_ b.42.2.1 (A:) Cytolethal distending toxin subunit A {Haemophilus ducreyi [TaxId: 730]} | Back information, alignment and structure |
|---|
| >d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} | Back information, alignment and structure |
|---|
| >d1qxma2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} | Back information, alignment and structure |
|---|
| >d1qxma2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} | Back information, alignment and structure |
|---|
| >d1qxma1 b.42.2.1 (A:4-148) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} | Back information, alignment and structure |
|---|
| >d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} | Back information, alignment and structure |
|---|
| >d1qxma1 b.42.2.1 (A:4-148) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} | Back information, alignment and structure |
|---|
| >d1sr4a_ b.42.2.1 (A:) Cytolethal distending toxin subunit A {Haemophilus ducreyi [TaxId: 730]} | Back information, alignment and structure |
|---|
| >d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} | Back information, alignment and structure |
|---|