Psyllid ID: psy15024


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPELQVPSSSQITIGIIHQGAWCLDTLGNVNDGVVGLYPCHHTGGNQAWSLTKEGFIKHHDTCLTIVNEMPGTGTHEEVRELFRP
cccHHHHHHHHccccccccccccHHHHHHHHHccccccccccccccccccccccccccEEEEEccccccccccccccccEEEEEcccccccEEEEEccccccccccccEEEEcccccccccccccccccc
ccHHHHHHHHHcccccccccccHHHHHHHHHHccccccHEEEccccccccccccccccccEEcccccEccccccccccEEEEEccccccccEEEEEEcccEEEccccEEEHccccccccccHHHHHHccc
mdnykhyyyaevplaktipfgdisDRVALRERlqckpfkwylehvypelqvpsssqitiGIIHQGAWcldtlgnvndgvvglypchhtggnqawsltkegfiKHHDTCLTivnempgtgthEEVRELFRP
MDNYKHYYYaevplaktipfgDISDRVALRERLQCKPFKWYLEHVYPELQVPSSSQITIGIIHQGAWCLDTLGNVNDGVVGLYPCHHTGGNQAWSLTKEGFIKHHDTCLTIVnempgtgtheevrelfrp
MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPELQVPSSSQITIGIIHQGAWCLDTLGNVNDGVVGLYPCHHTGGNQAWSLTKEGFIKHHDTCLTIVNEMPGTGTHEEVRELFRP
***YKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPELQVPSSSQITIGIIHQGAWCLDTLGNVNDGVVGLYPCHHTGGNQAWSLTKEGFIKHHDTCLTIVNE****************
MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPELQVPSSSQITIGIIHQGAWCLDTLGNVNDGVVGLYPCHHTGGNQAWSLTKEGFIKHHDTCLTIV***************FR*
MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPELQVPSSSQITIGIIHQGAWCLDTLGNVNDGVVGLYPCHHTGGNQAWSLTKEGFIKHHDTCLTIVNEMPGTGTHEEVRELFRP
MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPELQVPSSSQITIGIIHQGAWCLDTLGNVNDGVVGLYPCHHTGGNQAWSLTKEGFIKHHDTCLTIVNEMPGTGTHEEVR**FR*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPELQVPSSSQITIGIIHQGAWCLDTLGNVNDGVVGLYPCHHTGGNQAWSLTKEGFIKHHDTCLTIVNEMPGTGTHEEVRELFRP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query130 2.2.26 [Sep-21-2011]
Q6PB93570 Polypeptide N-acetylgalac yes N/A 0.907 0.207 0.584 5e-40
Q10471571 Polypeptide N-acetylgalac yes N/A 0.907 0.206 0.584 5e-40
Q6WV19633 Polypeptide N-acetylgalac yes N/A 0.892 0.183 0.579 7e-37
P34678612 Polypeptide N-acetylgalac yes N/A 0.846 0.179 0.459 2e-24
Q8I136589 Polypeptide N-acetylgalac no N/A 0.723 0.159 0.489 1e-22
Q8BVG5550 Polypeptide N-acetylgalac no N/A 0.907 0.214 0.418 5e-22
Q96FL9552 Polypeptide N-acetylgalac no N/A 0.907 0.213 0.395 4e-21
Q10472559 Polypeptide N-acetylgalac no N/A 0.846 0.196 0.407 1e-20
Q10473559 Polypeptide N-acetylgalac no N/A 0.846 0.196 0.407 1e-20
O08912559 Polypeptide N-acetylgalac no N/A 0.846 0.196 0.398 2e-20
>sp|Q6PB93|GALT2_MOUSE Polypeptide N-acetylgalactosaminyltransferase 2 OS=Mus musculus GN=Galnt2 PE=2 SV=1 Back     alignment and function desciption
 Score =  162 bits (411), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 89/118 (75%)

Query: 1   MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPELQVPSSSQITIG 60
           MD YKH+YYA VP A+ +P+G+I  R+ LR++L CKPFKWYL++VYPEL+VP    I  G
Sbjct: 388 MDEYKHFYYAAVPSARNVPYGNIQSRLELRKKLGCKPFKWYLDNVYPELRVPDHQDIAFG 447

Query: 61  IIHQGAWCLDTLGNVNDGVVGLYPCHHTGGNQAWSLTKEGFIKHHDTCLTIVNEMPGT 118
            + QG  CLDTLG+  DGVVG+Y CH+ GGNQ W+LTKE  +KH D CLT+V+  PG+
Sbjct: 448 ALQQGTNCLDTLGHFADGVVGIYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRSPGS 505




Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has a broad spectrum of substrates for peptides such as EA2, Muc5AC, Muc1a, Muc1b. Probably involved in O-linked glycosylation of the immunoglobulin A1 (IgA1) hinge region.
Mus musculus (taxid: 10090)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 4EC: 1
>sp|Q10471|GALT2_HUMAN Polypeptide N-acetylgalactosaminyltransferase 2 OS=Homo sapiens GN=GALNT2 PE=1 SV=1 Back     alignment and function description
>sp|Q6WV19|GALT2_DROME Polypeptide N-acetylgalactosaminyltransferase 2 OS=Drosophila melanogaster GN=pgant2 PE=2 SV=2 Back     alignment and function description
>sp|P34678|GALT3_CAEEL Polypeptide N-acetylgalactosaminyltransferase 3 OS=Caenorhabditis elegans GN=gly-3 PE=2 SV=2 Back     alignment and function description
>sp|Q8I136|GALT4_CAEEL Polypeptide N-acetylgalactosaminyltransferase 4 OS=Caenorhabditis elegans GN=gly-4 PE=2 SV=2 Back     alignment and function description
>sp|Q8BVG5|GLT14_MOUSE Polypeptide N-acetylgalactosaminyltransferase 14 OS=Mus musculus GN=Galnt14 PE=2 SV=2 Back     alignment and function description
>sp|Q96FL9|GLT14_HUMAN Polypeptide N-acetylgalactosaminyltransferase 14 OS=Homo sapiens GN=GALNT14 PE=2 SV=1 Back     alignment and function description
>sp|Q10472|GALT1_HUMAN Polypeptide N-acetylgalactosaminyltransferase 1 OS=Homo sapiens GN=GALNT1 PE=1 SV=1 Back     alignment and function description
>sp|Q10473|GALT1_RAT Polypeptide N-acetylgalactosaminyltransferase 1 OS=Rattus norvegicus GN=Galnt1 PE=1 SV=1 Back     alignment and function description
>sp|O08912|GALT1_MOUSE Polypeptide N-acetylgalactosaminyltransferase 1 OS=Mus musculus GN=Galnt1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
189236651 564 PREDICTED: similar to n-acetylgalactosam 0.9 0.207 0.641 1e-41
405973911 581 Polypeptide N-acetylgalactosaminyltransf 0.907 0.203 0.618 8e-40
345319818 628 PREDICTED: polypeptide N-acetylgalactosa 0.9 0.186 0.589 3e-39
449497211 669 PREDICTED: polypeptide N-acetylgalactosa 0.907 0.176 0.584 2e-38
363731636 566 PREDICTED: polypeptide N-acetylgalactosa 0.907 0.208 0.584 2e-38
390477336 571 PREDICTED: LOW QUALITY PROTEIN: polypept 0.907 0.206 0.584 2e-38
13938114 526 Galnt2 protein, partial [Mus musculus] 0.907 0.224 0.584 3e-38
149758073 539 PREDICTED: polypeptide N-acetylgalactosa 0.907 0.218 0.584 3e-38
74195843 544 unnamed protein product [Mus musculus] 0.907 0.216 0.584 3e-38
345798845 588 PREDICTED: polypeptide N-acetylgalactosa 0.907 0.200 0.584 3e-38
>gi|189236651|ref|XP_969621.2| PREDICTED: similar to n-acetylgalactosaminyltransferase [Tribolium castaneum] gi|270005204|gb|EFA01652.1| hypothetical protein TcasGA2_TC007223 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 91/117 (77%)

Query: 1   MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPELQVPSSSQITIG 60
           MD+YKH+YYA VPLAK IPFGDIS+R+ LR  LQCKPFKWYL+HVYPEL +P ++   +G
Sbjct: 384 MDDYKHFYYAAVPLAKNIPFGDISERLELRRNLQCKPFKWYLQHVYPELAIPQATSAHVG 443

Query: 61  IIHQGAWCLDTLGNVNDGVVGLYPCHHTGGNQAWSLTKEGFIKHHDTCLTIVNEMPG 117
            + QG +CLDT+G++ DG V LY CHHTGGNQ W LT  G IKHHD CLT+ + M G
Sbjct: 444 ELRQGMYCLDTMGHLIDGTVALYQCHHTGGNQEWGLTSGGLIKHHDLCLTLDDYMKG 500




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|405973911|gb|EKC38600.1| Polypeptide N-acetylgalactosaminyltransferase 2 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|345319818|ref|XP_001521442.2| PREDICTED: polypeptide N-acetylgalactosaminyltransferase 2-like [Ornithorhynchus anatinus] Back     alignment and taxonomy information
>gi|449497211|ref|XP_002190803.2| PREDICTED: polypeptide N-acetylgalactosaminyltransferase 2 [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|363731636|ref|XP_419581.3| PREDICTED: polypeptide N-acetylgalactosaminyltransferase 2 [Gallus gallus] Back     alignment and taxonomy information
>gi|390477336|ref|XP_003735278.1| PREDICTED: LOW QUALITY PROTEIN: polypeptide N-acetylgalactosaminyltransferase 2 [Callithrix jacchus] Back     alignment and taxonomy information
>gi|13938114|gb|AAH07172.1| Galnt2 protein, partial [Mus musculus] Back     alignment and taxonomy information
>gi|149758073|ref|XP_001496259.1| PREDICTED: polypeptide N-acetylgalactosaminyltransferase 2 [Equus caballus] Back     alignment and taxonomy information
>gi|74195843|dbj|BAE30483.1| unnamed protein product [Mus musculus] Back     alignment and taxonomy information
>gi|345798845|ref|XP_003434499.1| PREDICTED: polypeptide N-acetylgalactosaminyltransferase 2 [Canis lupus familiaris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
UNIPROTKB|F1NDK8530 GALNT2 "Uncharacterized protei 0.907 0.222 0.584 2.6e-38
UNIPROTKB|E1BB48571 GALNT2 "Uncharacterized protei 0.907 0.206 0.584 2.6e-38
UNIPROTKB|F1P835533 GALNT2 "Uncharacterized protei 0.907 0.221 0.584 2.6e-38
UNIPROTKB|J9P017504 GALNT2 "Uncharacterized protei 0.907 0.234 0.584 2.6e-38
UNIPROTKB|G3V1S6533 GALNT2 "UDP-N-acetyl-alpha-D-g 0.907 0.221 0.584 2.6e-38
UNIPROTKB|Q10471571 GALNT2 "Polypeptide N-acetylga 0.907 0.206 0.584 2.6e-38
UNIPROTKB|F1RG44549 GALNT2 "Uncharacterized protei 0.907 0.214 0.584 2.6e-38
RGD|1310692530 Galnt2 "UDP-N-acetyl-alpha-D-g 0.907 0.222 0.576 3.4e-38
FB|FBgn0031530633 pgant2 "polypeptide GalNAc tra 0.892 0.183 0.579 1.4e-35
ZFIN|ZDB-GENE-041111-110565 galnt2 "UDP-N-acetyl-alpha-D-g 0.907 0.208 0.524 3.9e-34
UNIPROTKB|F1NDK8 GALNT2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 410 (149.4 bits), Expect = 2.6e-38, P = 2.6e-38
 Identities = 69/118 (58%), Positives = 89/118 (75%)

Query:     1 MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPELQVPSSSQITIG 60
             MD YK++YYA VP A+ +P+G+I  R+ LR+RL CKPFKWYLE+VYPEL+VP    I  G
Sbjct:   348 MDEYKNFYYAAVPSARNVPYGNIQSRMELRKRLSCKPFKWYLENVYPELRVPDHQDIAFG 407

Query:    61 IIHQGAWCLDTLGNVNDGVVGLYPCHHTGGNQAWSLTKEGFIKHHDTCLTIVNEMPGT 118
              + QG  CLDTLG+  DGVVG+Y CH+ GGNQ W+LTK+  +KH D CLT+V+  PG+
Sbjct:   408 ALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKDKSVKHMDLCLTVVDRAPGS 465




GO:0016021 "integral to membrane" evidence=IEA
GO:0002378 "immunoglobulin biosynthetic process" evidence=IEA
GO:0004653 "polypeptide N-acetylgalactosaminyltransferase activity" evidence=IEA
GO:0005795 "Golgi stack" evidence=IEA
GO:0018242 "protein O-linked glycosylation via serine" evidence=IEA
GO:0018243 "protein O-linked glycosylation via threonine" evidence=IEA
GO:0030145 "manganese ion binding" evidence=IEA
GO:0048471 "perinuclear region of cytoplasm" evidence=IEA
UNIPROTKB|E1BB48 GALNT2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P835 GALNT2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P017 GALNT2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G3V1S6 GALNT2 "UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2), isoform CRA_b" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q10471 GALNT2 "Polypeptide N-acetylgalactosaminyltransferase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RG44 GALNT2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1310692 Galnt2 "UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0031530 pgant2 "polypeptide GalNAc transferase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041111-110 galnt2 "UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6PB93GALT2_MOUSE2, ., 4, ., 1, ., 4, 10.58470.90760.2070yesN/A
Q10471GALT2_HUMAN2, ., 4, ., 1, ., 4, 10.58470.90760.2066yesN/A
Q6WV19GALT2_DROME2, ., 4, ., 1, ., 4, 10.57980.89230.1832yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
cd02510299 cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the fo 8e-21
cd00161124 cd00161, RICIN, Ricin-type beta-trefoil; Carbohydr 5e-12
smart00458118 smart00458, RICIN, Ricin-type beta-trefoil 2e-09
pfam00652124 pfam00652, Ricin_B_lectin, Ricin-type beta-trefoil 3e-09
cd00161124 cd00161, RICIN, Ricin-type beta-trefoil; Carbohydr 4e-08
pfam00652124 pfam00652, Ricin_B_lectin, Ricin-type beta-trefoil 2e-07
smart00458118 smart00458, RICIN, Ricin-type beta-trefoil 4e-07
>gnl|CDD|133004 cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
 Score = 84.6 bits (210), Expect = 8e-21
 Identities = 28/46 (60%), Positives = 35/46 (76%)

Query: 1   MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVY 46
           MD YK Y+Y   P  + I +GD+S+R ALRERL+CK FKWYLE+VY
Sbjct: 254 MDEYKEYFYKARPELRNIDYGDLSERKALRERLKCKSFKWYLENVY 299


UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferases (pp-GalNAc-T) initiate the formation of mucin-type, O-linked glycans by catalyzing the transfer of alpha-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to hydroxyl groups of Ser or Thr residues of core proteins to form the Tn antigen (GalNAc-a-1-O-Ser/Thr). These enzymes are type II membrane proteins with a GT-A type catalytic domain and a lectin domain located on the lumen side of the Golgi apparatus. In human, there are 15 isozymes of pp-GalNAc-Ts, representing the largest of all glycosyltransferase families. Each isozyme has unique but partially redundant substrate specificity for glycosylation sites on acceptor proteins. Length = 299

>gnl|CDD|238092 cd00161, RICIN, Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication Back     alignment and domain information
>gnl|CDD|214672 smart00458, RICIN, Ricin-type beta-trefoil Back     alignment and domain information
>gnl|CDD|216044 pfam00652, Ricin_B_lectin, Ricin-type beta-trefoil lectin domain Back     alignment and domain information
>gnl|CDD|238092 cd00161, RICIN, Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication Back     alignment and domain information
>gnl|CDD|216044 pfam00652, Ricin_B_lectin, Ricin-type beta-trefoil lectin domain Back     alignment and domain information
>gnl|CDD|214672 smart00458, RICIN, Ricin-type beta-trefoil Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 130
KOG3738|consensus559 100.0
KOG3736|consensus578 100.0
KOG3737|consensus603 99.97
cd02510299 pp-GalNAc-T pp-GalNAc-T initiates the formation of 99.06
PF00652124 Ricin_B_lectin: Ricin-type beta-trefoil lectin dom 98.9
cd00161124 RICIN Ricin-type beta-trefoil; Carbohydrate-bindin 98.83
cd00161124 RICIN Ricin-type beta-trefoil; Carbohydrate-bindin 98.68
smart00458117 RICIN Ricin-type beta-trefoil. Carbohydrate-bindin 98.61
PF00652124 Ricin_B_lectin: Ricin-type beta-trefoil lectin dom 98.53
smart00458117 RICIN Ricin-type beta-trefoil. Carbohydrate-bindin 98.47
PF14200105 RicinB_lectin_2: Ricin-type beta-trefoil lectin do 97.93
KOG3736|consensus578 97.77
KOG3738|consensus559 95.83
PF14200105 RicinB_lectin_2: Ricin-type beta-trefoil lectin do 95.27
PLN02899633 alpha-galactosidase 94.9
KOG3737|consensus603 89.13
PF03498150 CDtoxinA: Cytolethal distending toxin A/C family; 82.58
PF0300218 Somatostatin: Somatostatin/Cortistatin family; Int 80.83
>KOG3738|consensus Back     alignment and domain information
Probab=100.00  E-value=1.3e-40  Score=265.88  Aligned_cols=125  Identities=46%  Similarity=0.939  Sum_probs=118.8

Q ss_pred             CcchhHHHhhhCCCCCCCCCCCchHHHHHHHHcCCcCchhhhhhhcCCCCCCCCCcceeceeecCceeeeccCCCCCCeE
Q psy15024          1 MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPELQVPSSSQITIGIIHQGAWCLDTLGNVNDGVV   80 (130)
Q Consensus         1 mDeyk~~~y~~~P~~~~~~~Gdis~r~~LR~~L~CksF~WyL~nV~pel~~p~~~~~~~G~i~~~~~CLD~~~~~~g~~v   80 (130)
                      |||||++||+++|.|+.+++|+|.+|++||++|+||||+|||+||||||.+|.....++|.|+++..|||+++..+.+.+
T Consensus       376 mDEYK~~yyaarPsAr~vpfg~i~~rL~~Rk~l~CksFkWYLenVyPeL~ip~~~~~~~g~lrqg~~Cl~s~~~~~~~~~  455 (559)
T KOG3738|consen  376 MDEYKNYYYAARPSARRVPFGNIYDRLELRKKLRCKSFKWYLENVYPELRIPFKELIATGTLRQGDNCLDSQGQNSQEAL  455 (559)
T ss_pred             HHHHHHHHHhcCchhhcCCCccHHHHHHHHhhcCCcchhhhhhhcCcceeccccccccccchhccchhhhhhhcccccCc
Confidence            89999999999999999999999999999999999999999999999999999888999999999999999988777789


Q ss_pred             EEEecCCCCCceeEEE--ccCCeEeecCeeeEEeCCCCCCeeEEeec
Q psy15024         81 GLYPCHHTGGNQAWSL--TKEGFIKHHDTCLTIVNEMPGTGTHEEVR  125 (130)
Q Consensus        81 ~l~~C~~~~~~Q~W~~--t~~~~Ir~~~~CLd~~~~~~g~~V~l~~~  125 (130)
                      +|+.||+.+++|.|.+  +++..|.+.++||++.+.++|++|.|+.-
T Consensus       456 gl~~C~~s~~nqqwa~~~t~~~~~~~~elCL~v~~~~pg~~v~l~~C  502 (559)
T KOG3738|consen  456 GLASCHGSGGNQQWAFLRTSTQLITHRELCLAVGSNTPGSPVALVPC  502 (559)
T ss_pred             ceeecccCCCCcchhhhhhhhhHHHHHhhhheeecCCCCCeEEEEec
Confidence            9999999999999999  77778889999999999999999999864



>KOG3736|consensus Back     alignment and domain information
>KOG3737|consensus Back     alignment and domain information
>cd02510 pp-GalNAc-T pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
>PF00652 Ricin_B_lectin: Ricin-type beta-trefoil lectin domain; InterPro: IPR000772 Ricin is a legume lectin from the seeds of the castor bean plant, Ricinus communis Back     alignment and domain information
>cd00161 RICIN Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication Back     alignment and domain information
>cd00161 RICIN Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication Back     alignment and domain information
>smart00458 RICIN Ricin-type beta-trefoil Back     alignment and domain information
>PF00652 Ricin_B_lectin: Ricin-type beta-trefoil lectin domain; InterPro: IPR000772 Ricin is a legume lectin from the seeds of the castor bean plant, Ricinus communis Back     alignment and domain information
>smart00458 RICIN Ricin-type beta-trefoil Back     alignment and domain information
>PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A Back     alignment and domain information
>KOG3736|consensus Back     alignment and domain information
>KOG3738|consensus Back     alignment and domain information
>PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A Back     alignment and domain information
>PLN02899 alpha-galactosidase Back     alignment and domain information
>KOG3737|consensus Back     alignment and domain information
>PF03498 CDtoxinA: Cytolethal distending toxin A/C family; InterPro: IPR003558 Escherichia coli, Haemophilus spp and Campylobacter spp Back     alignment and domain information
>PF03002 Somatostatin: Somatostatin/Cortistatin family; InterPro: IPR018142 Somatostatin inhibits the release of the pituitary growth hormone, somatotropin and inhibits the release of glucagon and insulin from the pancreas of fasted animals Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
2ffu_A501 Crystal Structure Of Human Ppgalnact-2 Complexed Wi 4e-41
1xhb_A472 The Crystal Structure Of Udp-Galnac: Polypeptide Al 2e-21
2d7i_A570 Crsytal Structure Of Pp-Galnac-T10 With Udp, Galnac 1e-06
>pdb|2FFU|A Chain A, Crystal Structure Of Human Ppgalnact-2 Complexed With Udp And Ea2 Length = 501 Back     alignment and structure

Iteration: 1

Score = 162 bits (411), Expect = 4e-41, Method: Compositional matrix adjust. Identities = 69/118 (58%), Positives = 89/118 (75%) Query: 1 MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPELQVPSSSQITIG 60 MD YK++YYA VP A+ +P+G+I R+ LR++L CKPFKWYLE+VYPEL+VP I G Sbjct: 319 MDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFG 378 Query: 61 IIHQGAWCLDTLGNVNDGVVGLYPCHHTGGNQAWSLTKEGFIKHHDTCLTIVNEMPGT 118 + QG CLDTLG+ DGVVG+Y CH+ GGNQ W+LTKE +KH D CLT+V+ PG+ Sbjct: 379 ALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGS 436
>pdb|1XHB|A Chain A, The Crystal Structure Of Udp-Galnac: Polypeptide Alpha-N- Acetylgalactosaminyltransferase-T1 Length = 472 Back     alignment and structure
>pdb|2D7I|A Chain A, Crsytal Structure Of Pp-Galnac-T10 With Udp, Galnac And Mn2+ Length = 570 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 9e-40
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 2e-35
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 4e-24
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 4e-07
2vlc_A 570 Cinnamomin, type 2 ribosome-inactivating protein c 2e-09
2vlc_A570 Cinnamomin, type 2 ribosome-inactivating protein c 2e-04
1m2t_B 263 Mistletoe lectin I B chain; ribosome inactivation, 5e-09
2aai_B 262 Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG 7e-09
2aai_B262 Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG 7e-05
2aai_B 262 Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG 4e-04
2aai_B262 Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG 8e-04
1ggp_B 254 TKL-1, protein (lectin 1 B chain); sugar binding p 9e-09
1abr_B 267 Abrin-A; glycosidase/carbohydrate complex, lectin, 1e-08
1abr_B267 Abrin-A; glycosidase/carbohydrate complex, lectin, 7e-04
1abr_B 267 Abrin-A; glycosidase/carbohydrate complex, lectin, 8e-04
1vcl_A 432 Hemolytic lectin CEL-III; hemolysis, hemagglutinat 2e-07
1vcl_A 432 Hemolytic lectin CEL-III; hemolysis, hemagglutinat 2e-06
1vcl_A 432 Hemolytic lectin CEL-III; hemolysis, hemagglutinat 3e-06
3c9z_A 258 Agglutinin II, SNA-II; beta-trefoil, ricin-B domai 4e-07
3a07_A118 Actinohivin; carbohydrate-binding module family 13 2e-06
3a07_A118 Actinohivin; carbohydrate-binding module family 13 5e-05
1xez_A 721 Hemolysin, cytolysin; pore-forming toxin, Pro-toxi 1e-05
1knl_A130 Endo-1,4-beta-xylanase A; carbohydrate binding mod 3e-05
1knl_A130 Endo-1,4-beta-xylanase A; carbohydrate binding mod 6e-05
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Length = 501 Back     alignment and structure
 Score =  137 bits (346), Expect = 9e-40
 Identities = 69/118 (58%), Positives = 89/118 (75%)

Query: 1   MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPELQVPSSSQITIG 60
           MD YK++YYA VP A+ +P+G+I  R+ LR++L CKPFKWYLE+VYPEL+VP    I  G
Sbjct: 319 MDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFG 378

Query: 61  IIHQGAWCLDTLGNVNDGVVGLYPCHHTGGNQAWSLTKEGFIKHHDTCLTIVNEMPGT 118
            + QG  CLDTLG+  DGVVG+Y CH+ GGNQ W+LTKE  +KH D CLT+V+  PG+
Sbjct: 379 ALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGS 436


>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Length = 472 Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Length = 570 Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Length = 570 Back     alignment and structure
>2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} Length = 570 Back     alignment and structure
>2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} Length = 570 Back     alignment and structure
>1m2t_B Mistletoe lectin I B chain; ribosome inactivation, ribosome inhibitor, hydrolase; HET: NAG FUC ADE; 1.89A {Viscum album} SCOP: b.42.2.1 b.42.2.1 PDB: 2r9k_B* 3d7w_B* 3cef_B* 1sz6_B* 1pum_B* 1puu_B* 2rg9_B* 3o5w_B* 1onk_B* 1oql_B* 1tfm_B* 1pc8_B* 1yf8_B* 1ce7_B* 2mll_B* Length = 263 Back     alignment and structure
>2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* Length = 262 Back     alignment and structure
>2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* Length = 262 Back     alignment and structure
>2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* Length = 262 Back     alignment and structure
>2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* Length = 262 Back     alignment and structure
>1ggp_B TKL-1, protein (lectin 1 B chain); sugar binding protein; 2.70A {Trichosanthes kirilowii} SCOP: b.42.2.1 b.42.2.1 Length = 254 Back     alignment and structure
>1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* Length = 267 Back     alignment and structure
>1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* Length = 267 Back     alignment and structure
>1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* Length = 267 Back     alignment and structure
>1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* Length = 432 Back     alignment and structure
>1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* Length = 432 Back     alignment and structure
>1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* Length = 432 Back     alignment and structure
>3c9z_A Agglutinin II, SNA-II; beta-trefoil, ricin-B domain, glycosylation, glycoprotein, L sugar binding protein, plant protein; HET: NAG FUC SO4; 1.35A {Sambucus nigra} PDB: 3ca0_A* 3ca1_A* 3ca3_A* 3ca4_A* 3ca5_A* 3ca6_A* 3cah_A* 1hwm_B* 1hwn_B* 1hwo_B* 1hwp_B* Length = 258 Back     alignment and structure
>3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} Length = 118 Back     alignment and structure
>3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} Length = 118 Back     alignment and structure
>1xez_A Hemolysin, cytolysin; pore-forming toxin, Pro-toxin, water- soluble monomer, beta-prism, beta-trefoil; HET: BOG; 2.30A {Vibrio cholerae} PDB: 3o44_A Length = 721 Back     alignment and structure
>1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* Length = 130 Back     alignment and structure
>1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* Length = 130 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 100.0
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 100.0
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 99.97
3a21_A614 Putative secreted alpha-galactosidase; beta-alpha- 99.92
1knl_A130 Endo-1,4-beta-xylanase A; carbohydrate binding mod 99.26
1abr_B 267 Abrin-A; glycosidase/carbohydrate complex, lectin, 99.14
1vcl_A 432 Hemolytic lectin CEL-III; hemolysis, hemagglutinat 99.08
3c9z_A 258 Agglutinin II, SNA-II; beta-trefoil, ricin-B domai 99.03
3c9z_A 258 Agglutinin II, SNA-II; beta-trefoil, ricin-B domai 99.02
1abr_B 267 Abrin-A; glycosidase/carbohydrate complex, lectin, 99.01
1m2t_B 263 Mistletoe lectin I B chain; ribosome inactivation, 98.99
2aai_B 262 Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG 98.98
1ggp_B 254 TKL-1, protein (lectin 1 B chain); sugar binding p 98.97
1knl_A130 Endo-1,4-beta-xylanase A; carbohydrate binding mod 98.96
1m2t_B 263 Mistletoe lectin I B chain; ribosome inactivation, 98.95
2aai_B 262 Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG 98.92
2d1z_A436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 98.92
1ggp_B 254 TKL-1, protein (lectin 1 B chain); sugar binding p 98.91
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 98.9
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 98.89
2dry_A130 29-kDa galactose-binding lectin; earthworm lumbric 98.86
1vcl_A 432 Hemolytic lectin CEL-III; hemolysis, hemagglutinat 98.86
2ao3_A130 29-kDa galactose-binding lectin; earthworm lumbric 98.85
3a07_A118 Actinohivin; carbohydrate-binding module family 13 98.83
3a07_A118 Actinohivin; carbohydrate-binding module family 13 98.81
2vlc_A 570 Cinnamomin, type 2 ribosome-inactivating protein c 98.8
2vlc_A 570 Cinnamomin, type 2 ribosome-inactivating protein c 98.79
2dry_A130 29-kDa galactose-binding lectin; earthworm lumbric 98.78
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 98.69
2d1z_A436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 98.67
3pg0_A165 Threefoil; symmetric design, beta-trefoil, enginee 98.65
3pg0_A165 Threefoil; symmetric design, beta-trefoil, enginee 98.59
3a21_A614 Putative secreted alpha-galactosidase; beta-alpha- 98.53
2ao3_A130 29-kDa galactose-binding lectin; earthworm lumbric 98.53
3phz_A 286 Ricin B-related lectin; beta trefoil, saccharide b 98.32
3vsf_A526 Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactana 98.24
3phz_A 286 Ricin B-related lectin; beta trefoil, saccharide b 98.21
3ef2_A 293 Agglutinin, lectin; beta-trefoil, calcium-binding, 98.17
3vsf_A526 Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactana 98.16
3ef2_A 293 Agglutinin, lectin; beta-trefoil, calcium-binding, 97.84
3nbc_A148 Ricin B-like lectin; lactose, sugar BIND protein; 97.74
1ybi_A288 HA33A, HA33/A, non-toxin haemagglutinin HA34; beta 97.39
3nbc_A148 Ricin B-like lectin; lactose, sugar BIND protein; 97.38
3aj6_A286 Main hemagglutinin component; toxin, beta-trefoil; 97.3
2vse_A 841 MTX holotoxin, mosquitocidal toxin; ADP-ribosyltra 97.07
1ybi_A288 HA33A, HA33/A, non-toxin haemagglutinin HA34; beta 96.97
3aj6_A286 Main hemagglutinin component; toxin, beta-trefoil; 96.95
1dqg_A135 Mannose receptor; beta trefoil, multilectin recept 96.66
1xez_A 721 Hemolysin, cytolysin; pore-forming toxin, Pro-toxi 96.44
2vse_A 841 MTX holotoxin, mosquitocidal toxin; ADP-ribosyltra 95.88
1sr4_A206 CDT A, cytolethal distending toxin subunit A; bact 90.47
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
Probab=100.00  E-value=4.5e-37  Score=251.60  Aligned_cols=124  Identities=56%  Similarity=1.120  Sum_probs=116.0

Q ss_pred             CcchhHHHhhhCCCCCCCCCCCchHHHHHHHHcCCcCchhhhhhhcCCCCCCCCCcceeceeecCceeeeccCCCCCCeE
Q psy15024          1 MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPELQVPSSSQITIGIIHQGAWCLDTLGNVNDGVV   80 (130)
Q Consensus         1 mDeyk~~~y~~~P~~~~~~~Gdis~r~~LR~~L~CksF~WyL~nV~pel~~p~~~~~~~G~i~~~~~CLD~~~~~~g~~v   80 (130)
                      ||+||++||.++|.++.+++|||++|++||++|+||+|+|||+|||||+.+|.+...++|+|+++++|||+.+...+++|
T Consensus       319 ~d~~~~~~y~~~p~~~~~~~g~~~~r~~lr~~l~c~~f~w~l~~v~p~~~~p~~~~~~~g~i~~~~~Cld~~~~~~~~~v  398 (501)
T 2ffu_A          319 MDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVV  398 (501)
T ss_dssp             CGGGHHHHHHHCGGGGGCCCCCCHHHHHHHHHTTCCCHHHHHHHTCTTSCCCCCCCCCEEEEEETTEEEECTTCCTTCCC
T ss_pred             HHHHHHHHhhcCcccccCCccchHHHHHHHHhcCCCCeEEehhccccccccccccccccccccccCccccccCCCCCCEE
Confidence            79999999999999999999999999999999999999999999999999998777889999999999999887778889


Q ss_pred             EEEecCCCCCceeEEEccCCeEeecCeeeEEeCCCCCCeeEEee
Q psy15024         81 GLYPCHHTGGNQAWSLTKEGFIKHHDTCLTIVNEMPGTGTHEEV  124 (130)
Q Consensus        81 ~l~~C~~~~~~Q~W~~t~~~~Ir~~~~CLd~~~~~~g~~V~l~~  124 (130)
                      ++++||+.++||.|.++.+|+|+++++|||+.+.++|++|++..
T Consensus       399 ~l~~C~g~~~nQ~w~~~~~g~i~~~~~Cld~~~~~~g~~v~l~~  442 (501)
T 2ffu_A          399 GVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQG  442 (501)
T ss_dssp             EEEECCSSCGGGCEEECTTSCEEETTEEEECSCCSTTCBCEEEE
T ss_pred             EEEEcCCCCcceEEEEecCCceeeccccceeccCCCCCeEEEEe
Confidence            99999998779999999999999999999998777888898753



>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* Back     alignment and structure
>1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* Back     alignment and structure
>1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* Back     alignment and structure
>1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* Back     alignment and structure
>3c9z_A Agglutinin II, SNA-II; beta-trefoil, ricin-B domain, glycosylation, glycoprotein, L sugar binding protein, plant protein; HET: NAG FUC SO4; 1.35A {Sambucus nigra} PDB: 3ca0_A* 3ca1_A* 3ca3_A* 3ca4_A* 3ca5_A* 3ca6_A* 3cah_A* 1hwm_B* 1hwn_B* 1hwo_B* 1hwp_B* Back     alignment and structure
>3c9z_A Agglutinin II, SNA-II; beta-trefoil, ricin-B domain, glycosylation, glycoprotein, L sugar binding protein, plant protein; HET: NAG FUC SO4; 1.35A {Sambucus nigra} PDB: 3ca0_A* 3ca1_A* 3ca3_A* 3ca4_A* 3ca5_A* 3ca6_A* 3cah_A* 1hwm_B* 1hwn_B* 1hwo_B* 1hwp_B* Back     alignment and structure
>1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* Back     alignment and structure
>1m2t_B Mistletoe lectin I B chain; ribosome inactivation, ribosome inhibitor, hydrolase; HET: NAG FUC ADE; 1.89A {Viscum album} SCOP: b.42.2.1 b.42.2.1 PDB: 2r9k_B* 3d7w_B* 3cef_B* 1sz6_B* 1pum_B* 1puu_B* 2rg9_B* 3o5w_B* 1onk_B* 1oql_B* 1tfm_B* 1pc8_B* 1yf8_B* 1ce7_B* 2mll_B* Back     alignment and structure
>2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* Back     alignment and structure
>1ggp_B TKL-1, protein (lectin 1 B chain); sugar binding protein; 2.70A {Trichosanthes kirilowii} SCOP: b.42.2.1 b.42.2.1 Back     alignment and structure
>1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* Back     alignment and structure
>1m2t_B Mistletoe lectin I B chain; ribosome inactivation, ribosome inhibitor, hydrolase; HET: NAG FUC ADE; 1.89A {Viscum album} SCOP: b.42.2.1 b.42.2.1 PDB: 2r9k_B* 3d7w_B* 3cef_B* 1sz6_B* 1pum_B* 1puu_B* 2rg9_B* 3o5w_B* 1onk_B* 1oql_B* 1tfm_B* 1pc8_B* 1yf8_B* 1ce7_B* 2mll_B* Back     alignment and structure
>2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>1ggp_B TKL-1, protein (lectin 1 B chain); sugar binding protein; 2.70A {Trichosanthes kirilowii} SCOP: b.42.2.1 b.42.2.1 Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
>2dry_A 29-kDa galactose-binding lectin; earthworm lumbricus terrestris, sialic acid, in vitro evolution, beta-trefoil fold, sugar binding protein; HET: PGE; 1.80A {Lumbricus terrestris} PDB: 2drz_A* 2ds0_A* 2zqn_A* 2zqo_A* Back     alignment and structure
>1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* Back     alignment and structure
>3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} Back     alignment and structure
>3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} Back     alignment and structure
>2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} Back     alignment and structure
>2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} Back     alignment and structure
>2dry_A 29-kDa galactose-binding lectin; earthworm lumbricus terrestris, sialic acid, in vitro evolution, beta-trefoil fold, sugar binding protein; HET: PGE; 1.80A {Lumbricus terrestris} PDB: 2drz_A* 2ds0_A* 2zqn_A* 2zqo_A* Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} Back     alignment and structure
>3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} Back     alignment and structure
>3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* Back     alignment and structure
>3phz_A Ricin B-related lectin; beta trefoil, saccharide binding lectin, 2,6-sialyl-lactosam sugar binding protein; HET: NAG GAL SIA; 1.70A {Polyporus squamosus} Back     alignment and structure
>3vsf_A Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactanase, sugar binding protein; 2.76A {Clostridium thermocellum} PDB: 3vsz_A* 3vt0_A* 3vt1_B* 3vt2_A* Back     alignment and structure
>3phz_A Ricin B-related lectin; beta trefoil, saccharide binding lectin, 2,6-sialyl-lactosam sugar binding protein; HET: NAG GAL SIA; 1.70A {Polyporus squamosus} Back     alignment and structure
>3ef2_A Agglutinin, lectin; beta-trefoil, calcium-binding, carbohydrate-binding, sugar-binding, sugar binding protein; HET: FUC GAL GLA; 1.80A {Marasmius oreades} PDB: 2iho_A* Back     alignment and structure
>3vsf_A Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactanase, sugar binding protein; 2.76A {Clostridium thermocellum} PDB: 3vsz_A* 3vt0_A* 3vt1_B* 3vt2_A* Back     alignment and structure
>3ef2_A Agglutinin, lectin; beta-trefoil, calcium-binding, carbohydrate-binding, sugar-binding, sugar binding protein; HET: FUC GAL GLA; 1.80A {Marasmius oreades} PDB: 2iho_A* Back     alignment and structure
>3nbc_A Ricin B-like lectin; lactose, sugar BIND protein; HET: LAT; 1.01A {Clitocybe nebularis} PDB: 3nbd_A* 3nbe_A* Back     alignment and structure
>1ybi_A HA33A, HA33/A, non-toxin haemagglutinin HA34; beta-trefoil; 1.50A {Clostridium botulinum} Back     alignment and structure
>3nbc_A Ricin B-like lectin; lactose, sugar BIND protein; HET: LAT; 1.01A {Clitocybe nebularis} PDB: 3nbd_A* 3nbe_A* Back     alignment and structure
>3aj6_A Main hemagglutinin component; toxin, beta-trefoil; HET: NGA; 1.48A {Clostridium botulinum} PDB: 1qxm_A 3aj5_A* 2ehm_A* 2ehi_A* 2ehn_A* 3ah1_A* 3ah2_A* 3ah4_A* 2e4m_A Back     alignment and structure
>2vse_A MTX holotoxin, mosquitocidal toxin; ADP-ribosyltransferase, lectin, ricin-B-like domain; 2.5A {Lysinibacillus sphaericus} PDB: 2vsa_A Back     alignment and structure
>1ybi_A HA33A, HA33/A, non-toxin haemagglutinin HA34; beta-trefoil; 1.50A {Clostridium botulinum} Back     alignment and structure
>3aj6_A Main hemagglutinin component; toxin, beta-trefoil; HET: NGA; 1.48A {Clostridium botulinum} PDB: 1qxm_A 3aj5_A* 2ehm_A* 2ehi_A* 2ehn_A* 3ah1_A* 3ah2_A* 3ah4_A* 2e4m_A Back     alignment and structure
>1dqg_A Mannose receptor; beta trefoil, multilectin receptor, pituitary hormones, sulfated carbohydrate, sugar binding protein; 1.70A {Mus musculus} SCOP: b.42.2.2 PDB: 1dqo_A* 1fwu_A* 1fwv_A* Back     alignment and structure
>1xez_A Hemolysin, cytolysin; pore-forming toxin, Pro-toxin, water- soluble monomer, beta-prism, beta-trefoil; HET: BOG; 2.30A {Vibrio cholerae} PDB: 3o44_A Back     alignment and structure
>2vse_A MTX holotoxin, mosquitocidal toxin; ADP-ribosyltransferase, lectin, ricin-B-like domain; 2.5A {Lysinibacillus sphaericus} PDB: 2vsa_A Back     alignment and structure
>1sr4_A CDT A, cytolethal distending toxin subunit A; bacterial, virulence, DNA damage, genotoxin, cytotoxins, cell cycle, apoptosis, lectin; 2.00A {Haemophilus ducreyi} SCOP: b.42.2.1 PDB: 2f2f_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 130
d1xhba2328 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosa 8e-21
d1xhba1131 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosa 3e-09
d1rzob1135 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (le 3e-08
d1ggpb1126 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lecti 2e-06
d1m2tb1136 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lect 2e-06
d1vcla1150 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domai 3e-06
d1hwmb2131 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lect 4e-06
d2aaib2127 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lect 8e-06
d1ggpb2128 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lect 8e-06
d1abrb1140 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin 1e-05
d1hwmb1133 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin 1e-04
d1m2tb2126 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lect 4e-04
d1abrb2127 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lect 8e-04
d1knma_129 b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1, 0.003
>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 328 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain
domain: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 83.4 bits (205), Expect = 8e-21
 Identities = 24/48 (50%), Positives = 35/48 (72%)

Query: 1   MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPE 48
           MD +K+++Y   P    + +GDIS R+ LR +LQCKPF WYLE++YP+
Sbjct: 280 MDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPD 327


>d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 131 Back     information, alignment and structure
>d1rzob1 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Length = 135 Back     information, alignment and structure
>d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Length = 126 Back     information, alignment and structure
>d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Length = 136 Back     information, alignment and structure
>d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Length = 150 Back     information, alignment and structure
>d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Length = 131 Back     information, alignment and structure
>d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Length = 127 Back     information, alignment and structure
>d1ggpb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Length = 128 Back     information, alignment and structure
>d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Length = 140 Back     information, alignment and structure
>d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Length = 133 Back     information, alignment and structure
>d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Length = 126 Back     information, alignment and structure
>d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Length = 127 Back     information, alignment and structure
>d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} Length = 129 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
d1xhba2328 Polypeptide N-acetylgalactosaminyltransferase 1, N 99.69
d1xhba1131 Polypeptide N-acetylgalactosaminyltransferase 1, C 99.5
d1vcla2133 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 99.39
d1vcla1150 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 99.34
d1ggpb1126 Plant cytotoxin B-chain (lectin) {Mongolian snake- 99.3
d1knma_129 Xylan binding domain, CBM13 (Endo-1,4-beta-xylanas 99.24
d2aaib2127 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 99.13
d1dqga_134 Mannose receptor {Mouse (Mus musculus) [TaxId: 100 99.09
d1abrb2127 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 99.06
d1hwmb1133 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 99.05
d1abrb1140 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 99.05
d1m2tb1136 Plant cytotoxin B-chain (lectin) {European mistlet 99.04
d1m2tb2126 Plant cytotoxin B-chain (lectin) {European mistlet 99.03
d1ggpb1126 Plant cytotoxin B-chain (lectin) {Mongolian snake- 99.02
d1hwmb2131 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 98.99
d1m2tb2126 Plant cytotoxin B-chain (lectin) {European mistlet 98.98
d1ggpb2128 Plant cytotoxin B-chain (lectin) {Mongolian snake- 98.94
d1xhba1131 Polypeptide N-acetylgalactosaminyltransferase 1, C 98.94
d1ggpb2128 Plant cytotoxin B-chain (lectin) {Mongolian snake- 98.93
d1knma_129 Xylan binding domain, CBM13 (Endo-1,4-beta-xylanas 98.93
d1m2tb1136 Plant cytotoxin B-chain (lectin) {European mistlet 98.92
d2aaib2127 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 98.91
d1abrb2127 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 98.9
d1rzob1135 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 98.88
d1abrb1140 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 98.85
d1vcla2133 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 98.84
d1hwmb2131 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 98.81
d1rzob1135 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 98.68
d1hwmb1133 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 98.68
d2zqna1130 29-kDa galactose-binding lectin {Lumbricus terrest 98.53
d2zqna1130 29-kDa galactose-binding lectin {Lumbricus terrest 98.3
d1dqga_134 Mannose receptor {Mouse (Mus musculus) [TaxId: 100 98.26
d2ihoa1154 Agglutinin MOA, N-terminal domain {Fairy-ring mush 98.21
d1vcla1150 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 98.17
d1sr4a_167 Cytolethal distending toxin subunit A {Haemophilus 98.17
d2ihoa1154 Agglutinin MOA, N-terminal domain {Fairy-ring mush 97.71
d1qxma2138 Hemagglutinin component Ha1 {Clostridium botulinum 97.62
d1qxma2138 Hemagglutinin component Ha1 {Clostridium botulinum 97.41
d1qxma1145 Hemagglutinin component Ha1 {Clostridium botulinum 97.31
d1upsa2131 GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosi 96.57
d1qxma1145 Hemagglutinin component Ha1 {Clostridium botulinum 96.48
d1sr4a_167 Cytolethal distending toxin subunit A {Haemophilus 95.16
d1upsa2131 GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosi 92.89
>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain
domain: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.69  E-value=5.9e-18  Score=128.73  Aligned_cols=48  Identities=50%  Similarity=1.171  Sum_probs=47.0

Q ss_pred             CcchhHHHhhhCCCCCCCCCCCchHHHHHHHHcCCcCchhhhhhhcCC
Q psy15024          1 MDNYKHYYYAEVPLAKTIPFGDISDRVALRERLQCKPFKWYLEHVYPE   48 (130)
Q Consensus         1 mDeyk~~~y~~~P~~~~~~~Gdis~r~~LR~~L~CksF~WyL~nV~pe   48 (130)
                      |||||++||..+|.+..+++|||++|++||++|+||||+|||+|||||
T Consensus       280 l~~yk~~~~~~~~~~~~~~~~~i~~r~~Lr~~l~ck~f~w~~~~~~~~  327 (328)
T d1xhba2         280 MDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPD  327 (328)
T ss_dssp             CGGGGHHHHHTSTTGGGSCCCCCHHHHHHHHHTTCCCHHHHHHHTCTT
T ss_pred             HHHHHHHHHHhCcccccCCcccHHHHHHHHHHhCCCChHHHHhhCCCC
Confidence            799999999999999999999999999999999999999999999998



>d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vcla2 b.42.2.1 (A:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1dqga_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1ggpb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ggpb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1rzob1 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1vcla2 b.42.2.1 (A:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1rzob1 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d2zqna1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Lumbricus terrestris [TaxId: 6398]} Back     information, alignment and structure
>d2zqna1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Lumbricus terrestris [TaxId: 6398]} Back     information, alignment and structure
>d1dqga_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} Back     information, alignment and structure
>d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1sr4a_ b.42.2.1 (A:) Cytolethal distending toxin subunit A {Haemophilus ducreyi [TaxId: 730]} Back     information, alignment and structure
>d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} Back     information, alignment and structure
>d1qxma2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1qxma2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1qxma1 b.42.2.1 (A:4-148) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} Back     information, alignment and structure
>d1qxma1 b.42.2.1 (A:4-148) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1sr4a_ b.42.2.1 (A:) Cytolethal distending toxin subunit A {Haemophilus ducreyi [TaxId: 730]} Back     information, alignment and structure
>d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} Back     information, alignment and structure