Psyllid ID: psy15035
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 816 | 2.2.26 [Sep-21-2011] | |||||||
| Q8BKS9 | 647 | Pumilio domain-containing | yes | N/A | 0.572 | 0.721 | 0.287 | 2e-49 | |
| Q562C7 | 647 | Pumilio domain-containing | yes | N/A | 0.549 | 0.692 | 0.287 | 2e-48 | |
| Q15397 | 648 | Pumilio domain-containing | yes | N/A | 0.425 | 0.535 | 0.324 | 9e-45 | |
| Q09622 | 766 | Pumilio domain-containing | yes | N/A | 0.580 | 0.618 | 0.265 | 7e-40 | |
| Q9UU76 | 642 | Pumilio homology domain f | yes | N/A | 0.399 | 0.507 | 0.315 | 1e-35 | |
| Q04373 | 656 | Pumilio homology domain f | yes | N/A | 0.443 | 0.551 | 0.271 | 7e-26 | |
| Q9WVS6 | 464 | E3 ubiquitin-protein liga | no | N/A | 0.248 | 0.437 | 0.306 | 3e-24 | |
| Q9JK66 | 465 | E3 ubiquitin-protein liga | no | N/A | 0.251 | 0.440 | 0.296 | 1e-22 | |
| Q7ZYP0 | 145 | Ubiquitin-conjugating enz | N/A | N/A | 0.066 | 0.372 | 0.796 | 3e-20 | |
| O60260 | 465 | E3 ubiquitin-protein liga | no | N/A | 0.251 | 0.440 | 0.28 | 3e-20 |
| >sp|Q8BKS9|K0020_MOUSE Pumilio domain-containing protein KIAA0020 OS=Mus musculus GN=Kiaa0020 PE=2 SV=2 | Back alignment and function desciption |
|---|
Score = 197 bits (502), Expect = 2e-49, Method: Compositional matrix adjust.
Identities = 150/522 (28%), Positives = 255/522 (48%), Gaps = 55/522 (10%)
Query: 4 IVFSHDMSRIIQWLLKLSSPQMKKDIVKELLPFTVAMIKSKYSNALVKHMLKSGDENTKN 63
I F+HD +R+IQ ++ + + +K +EL V + K+KYS +VK L G +
Sbjct: 172 IAFAHDSTRVIQCFIQYGNEEQRKQAFQELQGDLVELSKAKYSRNIVKKFLMYGSKPQVA 231
Query: 64 EIIKALQPHVVTLLSHTTASPVLMYAHDQVASPAQKLAMRQELYGGLYESTGDKKINCLG 123
EII++ + HV +L H+ AS ++ YA++ A Q+ + +ELYG ++ L
Sbjct: 232 EIIRSFKGHVRKMLRHSEASAIVEYAYNDKAILEQRNMLTEELYGNTFQLYKSADHPTLD 291
Query: 124 DIFEQSPEMKTAILSVTKKTILKSLQKTQVTGSALLHAVLLDFISHSSDSPDLMEVLEML 183
+ E P I+ K+ + QK V +L+H V LDF +++ P E++E +
Sbjct: 292 KVLELQPAKLELIMDEMKQILTPMAQKEAVIKHSLVHKVFLDFFTYAPPKPR-SELIEAI 350
Query: 184 APLPLLPFVHSKAGASVAMHIIWNATNKLKKKIVKELKGHLREVATSEFGHLVLVTLLDN 243
++ H+ GA VAMH +W+ T K +K IVK +K ++ +VA ++ HLVL+ D
Sbjct: 351 RE-AVVYLAHTHDGARVAMHCLWHGTPKDRKVIVKTMKTYVEKVANGQYSHLVLLAAFDC 409
Query: 244 VDDTLLLKKALLPELLAEVVPLANHEYGRKVIAHLVSWCDPGFFHPTCIAHVKSGDEFST 303
+DDT L+K+ ++ E+++ + + N +YGRKV+ +L+S DP P I ++ GD +
Sbjct: 410 IDDTKLVKQIIISEIISSLPSIVNDKYGRKVLLYLMSPRDPAHTVPELIELLQKGDGNAH 469
Query: 304 SKKDRDIRNKEILEAVSEPLLSSIAKDADFWLSTGSVAMVTAVILKNALGPGLKEAFDSV 363
SKKD IR +E+LE++S LLS + + S ++ + +L +A G ++ A D++
Sbjct: 470 SKKDTAIRRRELLESISPALLSYLQGHTQEVVLDKSACVLVSDMLGSATG-DVQPAMDAI 528
Query: 364 ANVIVDLERRVPLELKKDFASGNKNKQKKAAQQNKGGEKNQTAQGKKGTEGKKEAGNEKE 423
A++ AA+ + GG+ +
Sbjct: 529 ASLA-------------------------AAELHPGGKDGELH----------------- 546
Query: 424 EETTPFIEHPGFHTVLKKLLQHDR--DNVAKELPTLSESIVAKASKEVLDFWTKCNRACF 481
EHP H VLK LL+ D+ KE ++++V + + L W NR
Sbjct: 547 -----VAEHPAGHLVLKWLLEQDKKMKESGKE-GCFAKTLVERVGMKNLKSWASINRGAI 600
Query: 482 ILVLILESGMESCVSELKSKLSPFKTKLSSQKFS--GAKVLL 521
IL +L+S + V+++K L P L K S G + LL
Sbjct: 601 ILSSLLQSCDQEVVNKVKGGLKPLIPTLEKNKSSSRGIQTLL 642
|
Mus musculus (taxid: 10090) |
| >sp|Q562C7|K0020_RAT Pumilio domain-containing protein KIAA0020 homolog OS=Rattus norvegicus PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q15397|K0020_HUMAN Pumilio domain-containing protein KIAA0020 OS=Homo sapiens GN=KIAA0020 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q09622|PUF12_CAEEL Pumilio domain-containing protein 12 OS=Caenorhabditis elegans GN=puf-12 PE=4 SV=1 | Back alignment and function description |
|---|
| >sp|Q9UU76|PUF6_SCHPO Pumilio homology domain family member 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=puf6 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q04373|PUF6_YEAST Pumilio homology domain family member 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUF6 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9WVS6|PRKN2_MOUSE E3 ubiquitin-protein ligase parkin OS=Mus musculus GN=Park2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9JK66|PRKN2_RAT E3 ubiquitin-protein ligase parkin OS=Rattus norvegicus GN=Park2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q7ZYP0|UB2V2_XENLA Ubiquitin-conjugating enzyme E2 variant 2 OS=Xenopus laevis GN=ube2v2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O60260|PRKN2_HUMAN E3 ubiquitin-protein ligase parkin OS=Homo sapiens GN=PARK2 PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 816 | ||||||
| 156553088 | 658 | PREDICTED: protein penguin-like [Nasonia | 0.575 | 0.714 | 0.357 | 1e-87 | |
| 383864757 | 579 | PREDICTED: protein penguin-like [Megachi | 0.577 | 0.813 | 0.353 | 1e-85 | |
| 380029507 | 616 | PREDICTED: protein penguin-like [Apis fl | 0.577 | 0.764 | 0.344 | 2e-85 | |
| 328711429 | 663 | PREDICTED: pumilio domain-containing pro | 0.577 | 0.710 | 0.350 | 2e-84 | |
| 322799187 | 646 | hypothetical protein SINV_07682 [Solenop | 0.577 | 0.729 | 0.332 | 1e-81 | |
| 340722280 | 617 | PREDICTED: protein penguin-like isoform | 0.577 | 0.763 | 0.340 | 6e-81 | |
| 307198793 | 664 | Pumilio domain-containing protein KIAA00 | 0.577 | 0.709 | 0.344 | 6e-81 | |
| 307183954 | 657 | Pumilio domain-containing protein KIAA00 | 0.577 | 0.716 | 0.328 | 1e-80 | |
| 332025412 | 653 | Pumilio domain-containing protein KIAA00 | 0.574 | 0.718 | 0.334 | 5e-79 | |
| 91089527 | 602 | PREDICTED: similar to GA14176-PA [Tribol | 0.574 | 0.779 | 0.361 | 3e-78 |
| >gi|156553088|ref|XP_001599242.1| PREDICTED: protein penguin-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 331 bits (848), Expect = 1e-87, Method: Compositional matrix adjust.
Identities = 186/520 (35%), Positives = 295/520 (56%), Gaps = 50/520 (9%)
Query: 2 GQIVFSHDMSRIIQWLLKLSSPQMKKDIVKELLPFTVAMIKSKYSNALVKHMLKSGDENT 61
+++F+HD+SR+IQW +K +P ++ IV+EL P M SKY+ +V+ +LK G E+
Sbjct: 185 AKMIFAHDLSRVIQWQIKYCNPDIQLAIVQELKPQLREMFYSKYAKNVVRTLLKKGSESV 244
Query: 62 KNEIIKALQPHVVTLLSHTTASPVLMYAHDQVASPAQKLAMRQELYGGLYESTGDKKINC 121
K +++ HVV L ++ A+P+ + +VAS +K +QE YG +Y+++ D +
Sbjct: 245 KKSVLQVCTGHVVKLCTNVLAAPIFEKIYVEVASETEKSQFKQEFYGDMYKNSKDPNVKT 304
Query: 122 LGDIFEQSPEMKTAILSVTKKTILKSLQKTQVTGSALLHAVLLDFISHSSDSPDLMEVLE 181
L D+F+ S +MK+A LS K +++ L K + S L+H VL +++S+ S D E++
Sbjct: 305 LTDVFKNSQDMKSATLSGVKANLIRILNKN-LINSTLVHTVLYEYLSNCS-KEDRTEIMA 362
Query: 182 MLAPLPLLPFVHSKAGASVAMHIIWNATNKLKKKIVKELKGHLREVATSEFGHLVLVTLL 241
+ PL + ++ GA V IW+ TNK +K I+K LK H++++ TSE GHL+++ LL
Sbjct: 363 LARPL-IADLSQTRDGAKVGNLCIWHGTNKDRKLIMKSLKEHIKDIITSEHGHLMIIALL 421
Query: 242 DNVDDTLLLKKALLPELLAEVVPLANHEYGRKVIAHLVSWCDPGFFHPTCIAHVKSGDEF 301
D+VDDT+LLKK LL E+L + + ++YGR+VI ++V+ D +FHP + ++K GD
Sbjct: 422 DSVDDTVLLKKILLQEVLNNLSDIVLNDYGRRVILYIVARRDTHYFHPALVEYLKEGDGN 481
Query: 302 STSKKDRDIRNKEILEAVSEPLLSSIAKDADFWLSTGSVAMVTAVILKNALGPGLKEAFD 361
TSKK DIR KE+L+ + + LL +I +D+ WLS G + +VT ILK + G K AF+
Sbjct: 482 ETSKKPADIREKELLDNMIDNLLENIVQDSKMWLSNGQMQLVTLAILKASRGDKPKVAFE 541
Query: 362 SVANVIVDLERRVPLELKKDFASGNKNKQKKAAQQNKGGEKNQTAQGKKGTEGKKEAGNE 421
++A I D + GTE
Sbjct: 542 TIAKFITD----------------------------------SNSMLLHGTE-------- 559
Query: 422 KEEETTPFIEHPGFHTVLKKLLQHDRDNVAKELPTLSESIVAKASKEVLDFWTKCNRACF 481
+E PG H +LKK++Q D+ + T E ++ + EV++FW CNR+CF
Sbjct: 560 ----VVKAVEDPGLHMILKKIIQMDKKRLEDNELTFGEVLLEHLTHEVIEFWVDCNRSCF 615
Query: 482 ILVLILESGMESCVSELKSKLSPFKTKLSSQKFSGAKVLL 521
+LVL++E+ E VSELKSKL +KL S+K GA +LL
Sbjct: 616 LLVLLVENESEKVVSELKSKLKNI-SKLKSKKTKGATILL 654
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|383864757|ref|XP_003707844.1| PREDICTED: protein penguin-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|380029507|ref|XP_003698411.1| PREDICTED: protein penguin-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328711429|ref|XP_001950413.2| PREDICTED: pumilio domain-containing protein KIAA0020 homolog [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|322799187|gb|EFZ20617.1| hypothetical protein SINV_07682 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|340722280|ref|XP_003399535.1| PREDICTED: protein penguin-like isoform 1 [Bombus terrestris] gi|340722282|ref|XP_003399536.1| PREDICTED: protein penguin-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|307198793|gb|EFN79580.1| Pumilio domain-containing protein KIAA0020-like protein [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|307183954|gb|EFN70542.1| Pumilio domain-containing protein KIAA0020-like protein [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|332025412|gb|EGI65579.1| Pumilio domain-containing protein KIAA0020-like protein [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|91089527|ref|XP_971048.1| PREDICTED: similar to GA14176-PA [Tribolium castaneum] gi|270012590|gb|EFA09038.1| hypothetical protein TcasGA2_TC006751 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 816 | ||||||
| FB|FBgn0015527 | 737 | pen "penguin" [Drosophila mela | 0.448 | 0.496 | 0.330 | 1.6e-55 | |
| UNIPROTKB|E1C1R5 | 638 | KIAA0020 "Uncharacterized prot | 0.449 | 0.575 | 0.282 | 8.9e-42 | |
| MGI|MGI:106253 | 647 | D19Bwg1357e "DNA segment, Chr | 0.441 | 0.556 | 0.272 | 5.1e-39 | |
| UNIPROTKB|F1SJG9 | 647 | LOC100152831 "Uncharacterized | 0.439 | 0.554 | 0.277 | 1.4e-37 | |
| UNIPROTKB|A2VDN9 | 647 | KIAA0020 "Uncharacterized prot | 0.439 | 0.554 | 0.285 | 6.7e-37 | |
| RGD|1564753 | 647 | LOC499339 "hypothetical protei | 0.443 | 0.559 | 0.280 | 2.6e-36 | |
| UNIPROTKB|Q15397 | 648 | KIAA0020 "Pumilio domain-conta | 0.439 | 0.554 | 0.271 | 5e-36 | |
| ZFIN|ZDB-GENE-030131-9808 | 601 | si:ch211-241o7.5 "si:ch211-241 | 0.438 | 0.595 | 0.282 | 9.6e-36 | |
| UNIPROTKB|E2RBF2 | 648 | KIAA0020 "Uncharacterized prot | 0.439 | 0.554 | 0.274 | 9.1e-35 | |
| DICTYBASE|DDB_G0288551 | 679 | DDB_G0288551 "pumilio RNA-bind | 0.425 | 0.511 | 0.272 | 3.1e-26 |
| FB|FBgn0015527 pen "penguin" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 504 (182.5 bits), Expect = 1.6e-55, Sum P(2) = 1.6e-55
Identities = 125/378 (33%), Positives = 194/378 (51%)
Query: 1 MGQIVFSHDMSRIIQWLLKLSSPQMKKDIVKELLPFTVAMIKSKYSNALVKHMLKSGDEN 60
+ ++V +HD +R+IQ +LK +SP ++ +I ++LLPFTV M +SKY+ V+ MLK G
Sbjct: 172 ISKVVKAHDTARVIQSMLKYASPALRAEISEKLLPFTVEMCQSKYAQFCVQRMLKYGAPA 231
Query: 61 TKNEIIKALQPHVVTLLSHTTASPVL--MYAHDQVASPAQKLAMRQELYGGLYESTGDKK 118
TK +++ +L H+V L H+ S +L MY Q A+P Q++ MRQE YG LY D
Sbjct: 232 TKAKLVDSLYGHIVRLAGHSIGSGLLDSMY---QSATPNQRIYMRQEFYGDLYRKAKDSN 288
Query: 119 INCLGDIFEQSPEMKTAILSVTKKTILKSLQKTQVTGSALLHAVLLDFI-SHSSDSPDLM 177
+ L D ++++ MK +IL K L + Q+ SAL+HAV+L+++ + D L
Sbjct: 289 VKTLSDTYKEATNMKASILGSVKAN-LDHVANKQLVDSALVHAVMLEYLRACDEDEEKLE 347
Query: 178 EVLEMLAPLPLLPFVHS-KAGASVAMHIIWNATNXXXXXXXXXXXXXXREVATSEFGHXX 236
E + A L +P + S K G+ A+ + +T ++A E GH
Sbjct: 348 ETVTAFAAL--VPHMLSTKEGSEAAVICFYKSTPKNRRAIIKNIKEHLLKIANHEHGHVF 405
Query: 237 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXANHEYGRKVIAHLVSWCDPGFFHPTCIAHVK 296
+ YGR+VI LV+ D FHP I V+
Sbjct: 406 LISLLNALDDTKATKKAIYDHLHGDLKALMSSPYGRRVIQWLVAPGDTTCFHPEFIRTVE 465
Query: 297 SGDEFSTSKKDRDIRNKEILEAVSEPLLSSIAKDADFWLSTGSVAMVTAVILKNALGPGL 356
G F KK++++R KEILE + P+ SIA+DA FWLS + +VT IL + G
Sbjct: 466 EGLAFG--KKEKELRRKEILEQIEAPIAQSIAEDAAFWLSNSHIGLVTGDILNHIQGESY 523
Query: 357 KEAFDSVANVIVDLERRV 374
++A ++A V+V E R+
Sbjct: 524 EKAASALAQVVVQPEWRI 541
|
|
| UNIPROTKB|E1C1R5 KIAA0020 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:106253 D19Bwg1357e "DNA segment, Chr 19, Brigham & Women's Genetics 1357 expressed" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SJG9 LOC100152831 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A2VDN9 KIAA0020 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1564753 LOC499339 "hypothetical protein LOC499339" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q15397 KIAA0020 "Pumilio domain-containing protein KIAA0020" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-9808 si:ch211-241o7.5 "si:ch211-241o7.5" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RBF2 KIAA0020 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0288551 DDB_G0288551 "pumilio RNA-binding region-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 816 | |||
| cd01798 | 70 | cd01798, parkin_N, amino-terminal ubiquitin-like o | 8e-26 | |
| pfam08144 | 148 | pfam08144, CPL, CPL (NUC119) domain | 2e-22 | |
| cd01769 | 69 | cd01769, UBL, Ubiquitin-like domain of UBL | 2e-10 | |
| cd01803 | 76 | cd01803, Ubiquitin, Ubiquitin | 7e-09 | |
| smart00213 | 72 | smart00213, UBQ, Ubiquitin homologues | 2e-08 | |
| pfam00240 | 69 | pfam00240, ubiquitin, Ubiquitin family | 2e-08 | |
| cd07920 | 322 | cd07920, Pumilio, Pumilio-family RNA binding domai | 8e-06 | |
| PTZ00044 | 76 | PTZ00044, PTZ00044, ubiquitin; Provisional | 9e-06 | |
| cd01806 | 76 | cd01806, Nedd8, Nebb8-like ubiquitin protein | 9e-06 | |
| cd00196 | 69 | cd00196, UBQ, Ubiquitin-like proteins | 1e-05 | |
| cd01805 | 77 | cd01805, RAD23_N, Ubiquitin-like domain of RAD23 | 3e-05 | |
| COG5078 | 153 | COG5078, COG5078, Ubiquitin-protein ligase [Posttr | 5e-04 | |
| smart00212 | 145 | smart00212, UBCc, Ubiquitin-conjugating enzyme E2, | 7e-04 | |
| cd07920 | 322 | cd07920, Pumilio, Pumilio-family RNA binding domai | 0.001 | |
| cd01809 | 72 | cd01809, Scythe_N, Ubiquitin-like domain of Scythe | 0.003 |
| >gnl|CDD|176393 cd01798, parkin_N, amino-terminal ubiquitin-like of parkin protein | Back alignment and domain information |
|---|
Score = 100 bits (251), Expect = 8e-26
Identities = 36/70 (51%), Positives = 56/70 (80%)
Query: 607 INIKSNTGNTVCVNLDPASDIRNVKEMIAPKLGLKYEEVKIIFAGKELEDTTIISECDLG 666
+ +++NTG+T V +DP +DI+ +KE++A + G+ +++++IFAGKEL +TT I ECDLG
Sbjct: 1 VYVRTNTGHTFPVEVDPDTDIKQLKEVVAKRQGVPPDQLRVIFAGKELRNTTTIQECDLG 60
Query: 667 QQSILHAVKS 676
QQSILHAV+
Sbjct: 61 QQSILHAVRR 70
|
parkin_N parkin protein is a RING-type E3 ubiquitin ligase with an amino-terminal ubiquitin-like (Ubl) domain and an RBR signature consisting of two RING finger domains separated by an IBR/DRIL domain. Naturally occurring mutations in parkin are thought to cause the disease AR_JP (autosomal-recessive juvenile parkinsonism). Parkin binds the Rpn10 subunit of 26S proteasomes through its Ubl domain. Length = 70 |
| >gnl|CDD|149284 pfam08144, CPL, CPL (NUC119) domain | Back alignment and domain information |
|---|
| >gnl|CDD|176364 cd01769, UBL, Ubiquitin-like domain of UBL | Back alignment and domain information |
|---|
| >gnl|CDD|176398 cd01803, Ubiquitin, Ubiquitin | Back alignment and domain information |
|---|
| >gnl|CDD|214563 smart00213, UBQ, Ubiquitin homologues | Back alignment and domain information |
|---|
| >gnl|CDD|215813 pfam00240, ubiquitin, Ubiquitin family | Back alignment and domain information |
|---|
| >gnl|CDD|153420 cd07920, Pumilio, Pumilio-family RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|185411 PTZ00044, PTZ00044, ubiquitin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|176401 cd01806, Nedd8, Nebb8-like ubiquitin protein | Back alignment and domain information |
|---|
| >gnl|CDD|176352 cd00196, UBQ, Ubiquitin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176400 cd01805, RAD23_N, Ubiquitin-like domain of RAD23 | Back alignment and domain information |
|---|
| >gnl|CDD|227410 COG5078, COG5078, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|214562 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, catalytic domain homologues | Back alignment and domain information |
|---|
| >gnl|CDD|153420 cd07920, Pumilio, Pumilio-family RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|176404 cd01809, Scythe_N, Ubiquitin-like domain of Scythe protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 816 | |||
| KOG2050|consensus | 652 | 100.0 | ||
| KOG0006|consensus | 446 | 100.0 | ||
| cd07920 | 322 | Pumilio Pumilio-family RNA binding domain. Puf rep | 100.0 | |
| KOG1488|consensus | 503 | 100.0 | ||
| cd07920 | 322 | Pumilio Pumilio-family RNA binding domain. Puf rep | 100.0 | |
| KOG1488|consensus | 503 | 100.0 | ||
| COG5099 | 777 | RNA-binding protein of the Puf family, translation | 99.97 | |
| KOG2049|consensus | 536 | 99.97 | ||
| PF08144 | 148 | CPL: CPL (NUC119) domain; InterPro: IPR012959 This | 99.96 | |
| KOG2050|consensus | 652 | 99.92 | ||
| KOG2049|consensus | 536 | 99.89 | ||
| COG5099 | 777 | RNA-binding protein of the Puf family, translation | 99.88 | |
| KOG0896|consensus | 138 | 99.85 | ||
| cd01793 | 74 | Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui | 99.7 | |
| KOG0004|consensus | 156 | 99.68 | ||
| cd01802 | 103 | AN1_N ubiquitin-like domain of AN1. AN1 (also know | 99.67 | |
| cd01807 | 74 | GDX_N ubiquitin-like domain of GDX. GDX contains a | 99.67 | |
| PTZ00044 | 76 | ubiquitin; Provisional | 99.66 | |
| cd01810 | 74 | ISG15_repeat2 ISG15 ubiquitin-like protein, second | 99.62 | |
| KOG2188|consensus | 650 | 99.62 | ||
| cd01797 | 78 | NIRF_N amino-terminal ubiquitin-like domain of Np9 | 99.62 | |
| cd01803 | 76 | Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 | 99.61 | |
| KOG0003|consensus | 128 | 99.61 | ||
| cd01806 | 76 | Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn | 99.6 | |
| cd01804 | 78 | midnolin_N Ubiquitin-like domain of midnolin. midn | 99.59 | |
| cd01791 | 73 | Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know | 99.58 | |
| cd01798 | 70 | parkin_N amino-terminal ubiquitin-like of parkin p | 99.57 | |
| KOG0005|consensus | 70 | 99.54 | ||
| cd01794 | 70 | DC_UbP_C dendritic cell derived ubiquitin-like pro | 99.54 | |
| cd01805 | 77 | RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo | 99.53 | |
| cd01809 | 72 | Scythe_N Ubiquitin-like domain of Scythe protein. | 99.52 | |
| cd01800 | 76 | SF3a120_C Ubiquitin-like domain of Mammalian splic | 99.51 | |
| cd01808 | 71 | hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC | 99.49 | |
| cd01792 | 80 | ISG15_repeat1 ISG15 ubiquitin-like protein, first | 99.47 | |
| COG5078 | 153 | Ubiquitin-protein ligase [Posttranslational modifi | 99.47 | |
| cd01796 | 71 | DDI1_N DNA damage inducible protein 1 ubiquitin-li | 99.46 | |
| PF00240 | 69 | ubiquitin: Ubiquitin family; InterPro: IPR000626 U | 99.44 | |
| KOG0425|consensus | 171 | 99.43 | ||
| cd01790 | 79 | Herp_N Homocysteine-responsive endoplasmic reticul | 99.41 | |
| cd01812 | 71 | BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter | 99.4 | |
| cd01813 | 74 | UBP_N UBP ubiquitin processing protease. The UBP ( | 99.39 | |
| cd01763 | 87 | Sumo Small ubiquitin-related modifier (SUMO). Smal | 99.38 | |
| KOG0417|consensus | 148 | 99.37 | ||
| KOG2188|consensus | 650 | 99.36 | ||
| KOG0419|consensus | 152 | 99.34 | ||
| smart00213 | 64 | UBQ Ubiquitin homologues. Ubiquitin-mediated prote | 99.24 | |
| KOG0426|consensus | 165 | 99.2 | ||
| cd01815 | 75 | BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC | 99.19 | |
| TIGR00601 | 378 | rad23 UV excision repair protein Rad23. All protei | 99.18 | |
| PLN00172 | 147 | ubiquitin conjugating enzyme; Provisional | 99.14 | |
| cd01799 | 75 | Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO | 99.12 | |
| cd01814 | 113 | NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT | 99.11 | |
| PTZ00390 | 152 | ubiquitin-conjugating enzyme; Provisional | 99.08 | |
| KOG0010|consensus | 493 | 99.05 | ||
| KOG0421|consensus | 175 | 99.01 | ||
| cd01769 | 69 | UBL Ubiquitin-like domain of UBL. UBLs function by | 98.99 | |
| KOG0011|consensus | 340 | 98.91 | ||
| PF00179 | 140 | UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP | 98.91 | |
| cd01795 | 107 | USP48_C USP ubiquitin-specific protease. The USP ( | 98.9 | |
| cd00195 | 141 | UBCc Ubiquitin-conjugating enzyme E2, catalytic (U | 98.87 | |
| PF11976 | 72 | Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter | 98.84 | |
| smart00212 | 145 | UBCc Ubiquitin-conjugating enzyme E2, catalytic do | 98.76 | |
| KOG0418|consensus | 200 | 98.7 | ||
| KOG0001|consensus | 75 | 98.66 | ||
| cd01789 | 84 | Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol | 98.64 | |
| KOG4574|consensus | 1007 | 98.52 | ||
| KOG0894|consensus | 244 | 98.47 | ||
| PF00806 | 35 | PUF: Pumilio-family RNA binding repeat; InterPro: | 98.43 | |
| KOG0424|consensus | 158 | 98.42 | ||
| KOG4574|consensus | 1007 | 98.4 | ||
| KOG0422|consensus | 153 | 98.4 | ||
| PLN02560 | 308 | enoyl-CoA reductase | 98.38 | |
| KOG0428|consensus | 314 | 98.38 | ||
| KOG4248|consensus | 1143 | 98.36 | ||
| PF14560 | 87 | Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K | 98.31 | |
| PF13881 | 111 | Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB | 98.26 | |
| cd01788 | 119 | ElonginB Ubiquitin-like domain of Elongin B. Elong | 98.25 | |
| smart00025 | 36 | Pumilio Pumilio-like repeats. Pumilio-like repeats | 98.12 | |
| KOG0427|consensus | 161 | 98.08 | ||
| cd01801 | 77 | Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- | 97.98 | |
| PF11543 | 80 | UN_NPL4: Nuclear pore localisation protein NPL4; I | 97.97 | |
| cd00196 | 69 | UBQ Ubiquitin-like proteins. Ubiquitin homologs; I | 97.86 | |
| PF00806 | 35 | PUF: Pumilio-family RNA binding repeat; InterPro: | 97.84 | |
| KOG0423|consensus | 223 | 97.59 | ||
| KOG1872|consensus | 473 | 97.59 | ||
| KOG3493|consensus | 73 | 97.31 | ||
| smart00025 | 36 | Pumilio Pumilio-like repeats. Pumilio-like repeats | 97.3 | |
| cd01811 | 80 | OASL_repeat1 2'-5' oligoadenylate synthetase-like | 97.1 | |
| PF13019 | 162 | Telomere_Sde2: Telomere stability and silencing | 96.9 | |
| KOG4495|consensus | 110 | 96.73 | ||
| KOG1769|consensus | 99 | 96.67 | ||
| KOG0416|consensus | 189 | 96.32 | ||
| PF00789 | 82 | UBX: UBX domain; InterPro: IPR001012 The UBX domai | 96.09 | |
| PF08817 | 79 | YukD: WXG100 protein secretion system (Wss), prote | 95.91 | |
| PF11470 | 65 | TUG-UBL1: GLUT4 regulating protein TUG; InterPro: | 95.85 | |
| PF10302 | 97 | DUF2407: DUF2407 ubiquitin-like domain; InterPro: | 95.47 | |
| smart00166 | 80 | UBX Domain present in ubiquitin-regulatory protein | 95.45 | |
| KOG0895|consensus | 1101 | 95.04 | ||
| cd01772 | 79 | SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst | 94.89 | |
| cd01767 | 77 | UBX UBX (ubiquitin regulatory X) domain. The UBX ( | 94.49 | |
| cd01770 | 79 | p47_UBX p47-like ubiquitin domain. p47_UBX p47 is | 94.47 | |
| cd01773 | 82 | Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i | 94.35 | |
| KOG0420|consensus | 184 | 93.95 | ||
| KOG0895|consensus | 1101 | 93.89 | ||
| KOG0013|consensus | 231 | 93.87 | ||
| cd01774 | 85 | Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i | 93.86 | |
| COG5417 | 81 | Uncharacterized small protein [Function unknown] | 93.53 | |
| cd01771 | 80 | Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac | 93.22 | |
| KOG3206|consensus | 234 | 92.33 | ||
| COG5227 | 103 | SMT3 Ubiquitin-like protein (sentrin) [Posttransla | 91.28 | |
| TIGR00207 | 338 | fliG flagellar motor switch protein FliG. The fliG | 90.9 | |
| PRK06437 | 67 | hypothetical protein; Provisional | 90.36 | |
| PRK05686 | 339 | fliG flagellar motor switch protein G; Validated | 89.53 | |
| KOG1639|consensus | 297 | 88.27 | ||
| cd06406 | 80 | PB1_P67 A PB1 domain is present in p67 proteins wh | 85.19 | |
| PRK08364 | 70 | sulfur carrier protein ThiS; Provisional | 82.84 | |
| PF15044 | 76 | CLU_N: Mitochondrial function, CLU-N-term | 82.56 | |
| PF14836 | 88 | Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A | 81.33 | |
| cd00754 | 80 | MoaD Ubiquitin domain of MoaD-like proteins. MoaD | 80.44 | |
| PLN02799 | 82 | Molybdopterin synthase sulfur carrier subunit | 80.43 |
| >KOG2050|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=6e-91 Score=764.06 Aligned_cols=469 Identities=33% Similarity=0.485 Sum_probs=418.8
Q ss_pred CccccccCCchHHHHhhhhcCCHHHHHHHHHHHhHHHHHhhcCcchhHHHHHHHhcCCHHHHHHHHHHHhHHHHHHhhCc
Q psy15035 1 MGQIVFSHDMSRIIQWLLKLSSPQMKKDIVKELLPFTVAMIKSKYSNALVKHMLKSGDENTKNEIIKALQPHVVTLLSHT 80 (816)
Q Consensus 1 i~~l~~~hd~sRvIQ~~lk~gt~eqR~~I~~EL~~~i~eL~~d~yg~~vVQKlL~~gs~eqr~~Ii~e~~g~v~~L~~h~ 80 (816)
|.+|+++||+|||||+|++||++++|++||+||.|.+++||+++||.|+|||||+||+++||+.||++|+||+++|++|+
T Consensus 166 i~~lv~aHDtSRViQt~Vky~s~~~r~~if~eL~p~~v~l~kskY~k~~v~KmLkyGsk~q~a~iI~sl~Ghv~kLlRH~ 245 (652)
T KOG2050|consen 166 ISKLVFAHDTSRVIQTCVKYGSEAQREQIFEELLPFFVELAKSKYAKFFVQKMLKYGSKAQKAKIINSLRGHVVKLLRHR 245 (652)
T ss_pred HHHHHHHhhhHHHHHHHHHhcCHHHHHHHHHHHhHHHHHHHHhHHHHHHHHHHHhcCCHHHHHHHHHHHhhhHHHHHhhh
Confidence 46899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CchHHHHHHHHhcCCHHHHHHHHHHHhcCcceeeccCCcchhHHhhcCChhHHHHHHHHHHHHHHHhhhhhcccCCcchh
Q psy15035 81 TASPVLMYAHDQVASPAQKLAMRQELYGGLYESTGDKKINCLGDIFEQSPEMKTAILSVTKKTILKSLQKTQVTGSALLH 160 (816)
Q Consensus 81 ~G~~VVqk~~~~~at~eQr~~Li~e~yg~~~~l~kd~~~~~l~~ile~~pekk~~Il~~l~~~l~~lv~K~~~~~~~ivh 160 (816)
+|++||+++|++|+|.+||+.|+.||||++|.+|++....+|.++++..|++|..|+++|.++|.++++| +.++++++|
T Consensus 246 eaa~Vve~ay~~~A~l~Qr~~li~EfYG~efqlfK~sn~~Tl~kil~~~pekk~~I~~~l~~~I~~v~eK-g~v~~tivH 324 (652)
T KOG2050|consen 246 EAAYVVEYAYNDFATLEQRQYLIQEFYGDEFQLFKDSNDKTLDKILAEAPEKKASILRHLKAIITPVAEK-GSVDHTIVH 324 (652)
T ss_pred HHHHHHHHHHHhhccHHHHHHHHHHHhhHHHHHHhccCcccHHHHHHhChHhHHHHHHHHHHHhHHHhhc-chhHHHHHH
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999 999999999
Q ss_pred hhHHHhhhcCCChhhHHHHHHHhCCCCccccccCcChHHHHHHHHhhcCHHHHHHHHHHHHHHHHHHhhCcCchHHHHHH
Q psy15035 161 AVLLDFISHSSDSPDLMEVLEMLAPLPLLPFVHSKAGASVAMHIIWNATNKLKKKIVKELKGHLREVATSEFGHLVLVTL 240 (816)
Q Consensus 161 ~vl~ey~~~~~~~~~~~~iie~l~~~~l~~L~~tk~Gs~Vv~~cl~~~~~kdRk~Iik~lk~~v~~La~d~~G~~Vlq~~ 240 (816)
++|++|+.+|++ +.+.++++.+++. +++|+||++||+|+++|+|+|+||+||.|||+||+|+.++|.|+|||+||.++
T Consensus 325 k~mlEy~~~ade-~e~~e~l~ll~el-v~e~vHT~dGS~vAm~li~~a~aKeRK~IiK~~K~h~~K~A~~~yGh~vlia~ 402 (652)
T KOG2050|consen 325 KLMLEYLTIADE-EEKSELLELLKEL-VPEMVHTRDGSRVAMKLIWHATAKERKLIIKNMKEHVEKIANDEYGHLVLIAL 402 (652)
T ss_pred HHHHHHHHhCCH-HHHHHHHHHHHHH-HHHHhcCCchHHHHHHHHhhCCHHHHHHHHHHHHHHHHHHHhhccCceehhhh
Confidence 999999999999 9999999999999 99999999999999999999999999999999999999999999999999999
Q ss_pred HccCCchHHHHHHHHHHHHHhHHhHhcChhhHHHHHHhhccCCCCCcCHHHHHhhccCCccccCCCCHHHHHHHHHHhhc
Q psy15035 241 LDNVDDTLLLKKALLPELLAEVVPLANHEYGRKVIAHLVSWCDPGFFHPTCIAHVKSGDEFSTSKKDRDIRNKEILEAVS 320 (816)
Q Consensus 241 l~~~DDt~l~~k~Iv~eL~~~l~~L~~d~yG~~Vl~~Ll~~~~~~~f~~~i~~~L~~~~~~~~sKKd~~~Rr~EL~~~~~ 320 (816)
|+|+|||+++.|.|++++.+.+..|..|+|||+|++||+.|+|++||+|+.+++|++++.+.+|||||.+||.||+..++
T Consensus 403 ldc~DDT~l~kk~i~~e~~~el~~li~Dk~Grrv~lyll~p~D~~~f~~e~ie~l~~~d~~k~sKKdp~vRr~eLla~is 482 (652)
T KOG2050|consen 403 LDCTDDTKLLKKLIYDELKSELKSLISDKYGRRVILYLLAPRDGRYFVPEFIEVLEELDSNKHSKKDPLVRRIELLAAIS 482 (652)
T ss_pred hcccchHHHHHHHHHHHHHHHHHHHhccchhhhhhhhhccCCccccccHHHHHHHHhcccccccccCHHHHHHHHHHhhh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhHHHHHHhcHHHHHccCChhH-HHHHHHhccCCc----ChHHHHHHHHHHHhhhccccchhhhhccccCchhhhhhhhh
Q psy15035 321 EPLLSSIAKDADFWLSTGSVAM-VTAVILKNALGP----GLKEAFDSVANVIVDLERRVPLELKKDFASGNKNKQKKAAQ 395 (816)
Q Consensus 321 ~~Ll~~i~~~~~~ll~d~~g~~-vv~~iL~~~~g~----~~~~~~~aia~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 395 (816)
|.|+.+|.+|+++++.+++||+ +|..+|....|+ +++.+.+++..... .+
T Consensus 483 p~lis~~s~~aeeil~e~~~~~~lV~~~l~~~~~~~d~~~~q~~a~a~l~~~~----~~--------------------- 537 (652)
T KOG2050|consen 483 PSLISLLSENAEEILAEALKSQVLVEASLGAEDGDKDPDEKQAAAEAALPAFK----AI--------------------- 537 (652)
T ss_pred HHHHHHHHHhHHHHHHHhhcceeeHHhhhcCcccccChhhHHHHHHHHHHHhc----cC---------------------
Confidence 9999999999999999999999 576777766665 23345555433220 00
Q ss_pred hccCCCccccccCCCCCCCcccCCCCccccCCCcccCchhHHHHHHHHhcCccccc-------ccCcch--HHHHHHhcC
Q psy15035 396 QNKGGEKNQTAQGKKGTEGKKEAGNEKEEETTPFIEHPGFHTVLKKLLQHDRDNVA-------KELPTL--SESIVAKAS 466 (816)
Q Consensus 396 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~r~lk~Li~~~~~~~~-------~~~~~f--~~~l~~~i~ 466 (816)
|..+++ ..|..++|.+|.++ .|+|.|+.. .+...| +..|++++.
T Consensus 538 ---------------~~~~~~---------p~h~~~~~~~~~il---~q~g~w~~~~~k~~~~~~~~g~~~~k~l~e~l~ 590 (652)
T KOG2050|consen 538 ---------------PEEAKK---------PKHQEEEPAAHLIL---GQEGAWMHIEKKRILKNNREGEGVPKLLLENLS 590 (652)
T ss_pred ---------------cccccC---------CcchhcccchhhHH---hccccchhHHHHHHhhhcCCccccHHHHHHHhh
Confidence 011111 14555566655553 344444332 112222 269999999
Q ss_pred hhhHhhhhccCCceeehHHHhhcCChhhHHHHHhhhcchhhh--hcccccccceeeecch
Q psy15035 467 KEVLDFWTKCNRACFILVLILESGMESCVSELKSKLSPFKTK--LSSQKFSGAKVLLIVP 524 (816)
Q Consensus 467 ~~~l~~w~~~nr~~fvl~~llE~~~~~~~~~~~~~lk~~~~~--l~~~~~~Ga~~ll~vp 524 (816)
+.+|.+|+++|||||||++|+|+.+..+.+..+..+...... ++...++|+++|++..
T Consensus 591 sk~L~sWa~~nrg~fvL~allE~~~~~v~~k~ka~~~r~~~~~~~~~~a~kg~~~L~~~l 650 (652)
T KOG2050|consen 591 SKNLKSWASVNRGCFVLLALLETCDDQVEEKKKAKLLRLVLSGILKDSATKGAELLAEKL 650 (652)
T ss_pred HHHHHHHHccCcchhhHHHHHHhcCHHhhhhHHHHHHHhhhhhhcccccCccHHHHHHHh
Confidence 999999999999999999999999999988888877766553 4445688999987643
|
|
| >KOG0006|consensus | Back alignment and domain information |
|---|
| >cd07920 Pumilio Pumilio-family RNA binding domain | Back alignment and domain information |
|---|
| >KOG1488|consensus | Back alignment and domain information |
|---|
| >cd07920 Pumilio Pumilio-family RNA binding domain | Back alignment and domain information |
|---|
| >KOG1488|consensus | Back alignment and domain information |
|---|
| >COG5099 RNA-binding protein of the Puf family, translational repressor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2049|consensus | Back alignment and domain information |
|---|
| >PF08144 CPL: CPL (NUC119) domain; InterPro: IPR012959 This C-terminal domain is found in Penguin-like proteins (CPL) and is associated with Pumilio like repeats [] | Back alignment and domain information |
|---|
| >KOG2050|consensus | Back alignment and domain information |
|---|
| >KOG2049|consensus | Back alignment and domain information |
|---|
| >COG5099 RNA-binding protein of the Puf family, translational repressor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0896|consensus | Back alignment and domain information |
|---|
| >cd01793 Fubi Fubi ubiquitin-like protein | Back alignment and domain information |
|---|
| >KOG0004|consensus | Back alignment and domain information |
|---|
| >cd01802 AN1_N ubiquitin-like domain of AN1 | Back alignment and domain information |
|---|
| >cd01807 GDX_N ubiquitin-like domain of GDX | Back alignment and domain information |
|---|
| >PTZ00044 ubiquitin; Provisional | Back alignment and domain information |
|---|
| >cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 | Back alignment and domain information |
|---|
| >KOG2188|consensus | Back alignment and domain information |
|---|
| >cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF | Back alignment and domain information |
|---|
| >cd01803 Ubiquitin Ubiquitin | Back alignment and domain information |
|---|
| >KOG0003|consensus | Back alignment and domain information |
|---|
| >cd01806 Nedd8 Nebb8-like ubiquitin protein | Back alignment and domain information |
|---|
| >cd01804 midnolin_N Ubiquitin-like domain of midnolin | Back alignment and domain information |
|---|
| >cd01791 Ubl5 UBL5 ubiquitin-like modifier | Back alignment and domain information |
|---|
| >cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein | Back alignment and domain information |
|---|
| >KOG0005|consensus | Back alignment and domain information |
|---|
| >cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein | Back alignment and domain information |
|---|
| >cd01805 RAD23_N Ubiquitin-like domain of RAD23 | Back alignment and domain information |
|---|
| >cd01809 Scythe_N Ubiquitin-like domain of Scythe protein | Back alignment and domain information |
|---|
| >cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 | Back alignment and domain information |
|---|
| >cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 | Back alignment and domain information |
|---|
| >cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 | Back alignment and domain information |
|---|
| >COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain | Back alignment and domain information |
|---|
| >PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade | Back alignment and domain information |
|---|
| >KOG0425|consensus | Back alignment and domain information |
|---|
| >cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein | Back alignment and domain information |
|---|
| >cd01812 BAG1_N Ubiquitin-like domain of BAG1 | Back alignment and domain information |
|---|
| >cd01813 UBP_N UBP ubiquitin processing protease | Back alignment and domain information |
|---|
| >cd01763 Sumo Small ubiquitin-related modifier (SUMO) | Back alignment and domain information |
|---|
| >KOG0417|consensus | Back alignment and domain information |
|---|
| >KOG2188|consensus | Back alignment and domain information |
|---|
| >KOG0419|consensus | Back alignment and domain information |
|---|
| >smart00213 UBQ Ubiquitin homologues | Back alignment and domain information |
|---|
| >KOG0426|consensus | Back alignment and domain information |
|---|
| >cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP | Back alignment and domain information |
|---|
| >TIGR00601 rad23 UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >PLN00172 ubiquitin conjugating enzyme; Provisional | Back alignment and domain information |
|---|
| >cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 | Back alignment and domain information |
|---|
| >cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 | Back alignment and domain information |
|---|
| >PTZ00390 ubiquitin-conjugating enzyme; Provisional | Back alignment and domain information |
|---|
| >KOG0010|consensus | Back alignment and domain information |
|---|
| >KOG0421|consensus | Back alignment and domain information |
|---|
| >cd01769 UBL Ubiquitin-like domain of UBL | Back alignment and domain information |
|---|
| >KOG0011|consensus | Back alignment and domain information |
|---|
| >PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] | Back alignment and domain information |
|---|
| >cd01795 USP48_C USP ubiquitin-specific protease | Back alignment and domain information |
|---|
| >cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain | Back alignment and domain information |
|---|
| >PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins | Back alignment and domain information |
|---|
| >smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues | Back alignment and domain information |
|---|
| >KOG0418|consensus | Back alignment and domain information |
|---|
| >KOG0001|consensus | Back alignment and domain information |
|---|
| >cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B | Back alignment and domain information |
|---|
| >KOG4574|consensus | Back alignment and domain information |
|---|
| >KOG0894|consensus | Back alignment and domain information |
|---|
| >PF00806 PUF: Pumilio-family RNA binding repeat; InterPro: IPR001313 The drosophila pumilio gene codes for an unusual protein that binds through the Puf domain that usually occurs as a tandem repeat of eight domains | Back alignment and domain information |
|---|
| >KOG0424|consensus | Back alignment and domain information |
|---|
| >KOG4574|consensus | Back alignment and domain information |
|---|
| >KOG0422|consensus | Back alignment and domain information |
|---|
| >PLN02560 enoyl-CoA reductase | Back alignment and domain information |
|---|
| >KOG0428|consensus | Back alignment and domain information |
|---|
| >KOG4248|consensus | Back alignment and domain information |
|---|
| >PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A | Back alignment and domain information |
|---|
| >PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A | Back alignment and domain information |
|---|
| >cd01788 ElonginB Ubiquitin-like domain of Elongin B | Back alignment and domain information |
|---|
| >smart00025 Pumilio Pumilio-like repeats | Back alignment and domain information |
|---|
| >KOG0427|consensus | Back alignment and domain information |
|---|
| >cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 | Back alignment and domain information |
|---|
| >PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway | Back alignment and domain information |
|---|
| >cd00196 UBQ Ubiquitin-like proteins | Back alignment and domain information |
|---|
| >PF00806 PUF: Pumilio-family RNA binding repeat; InterPro: IPR001313 The drosophila pumilio gene codes for an unusual protein that binds through the Puf domain that usually occurs as a tandem repeat of eight domains | Back alignment and domain information |
|---|
| >KOG0423|consensus | Back alignment and domain information |
|---|
| >KOG1872|consensus | Back alignment and domain information |
|---|
| >KOG3493|consensus | Back alignment and domain information |
|---|
| >smart00025 Pumilio Pumilio-like repeats | Back alignment and domain information |
|---|
| >cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 | Back alignment and domain information |
|---|
| >PF13019 Telomere_Sde2: Telomere stability and silencing | Back alignment and domain information |
|---|
| >KOG4495|consensus | Back alignment and domain information |
|---|
| >KOG1769|consensus | Back alignment and domain information |
|---|
| >KOG0416|consensus | Back alignment and domain information |
|---|
| >PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast | Back alignment and domain information |
|---|
| >PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] | Back alignment and domain information |
|---|
| >PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly | Back alignment and domain information |
|---|
| >PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi | Back alignment and domain information |
|---|
| >smart00166 UBX Domain present in ubiquitin-regulatory proteins | Back alignment and domain information |
|---|
| >KOG0895|consensus | Back alignment and domain information |
|---|
| >cd01772 SAKS1_UBX SAKS1-like UBX domain | Back alignment and domain information |
|---|
| >cd01767 UBX UBX (ubiquitin regulatory X) domain | Back alignment and domain information |
|---|
| >cd01770 p47_UBX p47-like ubiquitin domain | Back alignment and domain information |
|---|
| >cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain | Back alignment and domain information |
|---|
| >KOG0420|consensus | Back alignment and domain information |
|---|
| >KOG0895|consensus | Back alignment and domain information |
|---|
| >KOG0013|consensus | Back alignment and domain information |
|---|
| >cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain | Back alignment and domain information |
|---|
| >COG5417 Uncharacterized small protein [Function unknown] | Back alignment and domain information |
|---|
| >cd01771 Faf1_UBX Faf1 UBX domain | Back alignment and domain information |
|---|
| >KOG3206|consensus | Back alignment and domain information |
|---|
| >COG5227 SMT3 Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00207 fliG flagellar motor switch protein FliG | Back alignment and domain information |
|---|
| >PRK06437 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05686 fliG flagellar motor switch protein G; Validated | Back alignment and domain information |
|---|
| >KOG1639|consensus | Back alignment and domain information |
|---|
| >cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis | Back alignment and domain information |
|---|
| >PRK08364 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >PF15044 CLU_N: Mitochondrial function, CLU-N-term | Back alignment and domain information |
|---|
| >PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A | Back alignment and domain information |
|---|
| >cd00754 MoaD Ubiquitin domain of MoaD-like proteins | Back alignment and domain information |
|---|
| >PLN02799 Molybdopterin synthase sulfur carrier subunit | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 816 | ||||
| 2hlw_A | 170 | Solution Structure Of The Human Ubiquitin-Conjugati | 1e-21 | ||
| 2a4d_A | 160 | Structure Of The Human Ubiquitin-Conjugating Enzyme | 2e-21 | ||
| 3von_B | 138 | Crystalstructure Of The Ubiquitin Protease Length = | 3e-21 | ||
| 4epo_A | 149 | Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE | 3e-21 | ||
| 1zgu_A | 139 | Solution Structure Of The Human Mms2-Ubiquitin Comp | 3e-21 | ||
| 1j74_A | 145 | Crystal Structure Of Mms2 Length = 145 | 3e-21 | ||
| 2c2v_C | 142 | Crystal Structure Of The Chip-Ubc13-Uev1a Complex L | 7e-21 | ||
| 2gmi_B | 137 | Mms2UBC13~UBIQUITIN Length = 137 | 1e-11 | ||
| 1jat_B | 138 | Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Leng | 1e-11 | ||
| 3e95_C | 158 | Crystal Structure Of The Plasmodium Falciparum Ubiq | 3e-09 | ||
| 2q0v_A | 156 | Crystal Structure Of Ubiquitin Conjugating Enzyme E | 4e-09 | ||
| 2k25_A | 103 | Automated Nmr Structure Of The Ubb By Fapsy Length | 9e-09 | ||
| 1iyf_A | 81 | Solution Structure Of Ubiquitin-Like Domain Of Huma | 2e-08 | ||
| 2knb_A | 81 | Solution Nmr Structure Of The Parkin Ubl Domain In | 2e-08 | ||
| 2ojr_A | 111 | Structure Of Ubiquitin Solved By Sad Using The Lant | 3e-08 | ||
| 3vdz_A | 111 | Tailoring Encodable Lanthanide-Binding Tags As Mri | 8e-08 | ||
| 3jvz_X | 81 | E2~ubiquitin-Hect Length = 81 | 8e-08 | ||
| 2zcb_A | 76 | Crystal Structure Of Ubiquitin P37aP38A Length = 76 | 8e-08 | ||
| 1yiw_A | 76 | X-Ray Crystal Structure Of A Chemically Synthesized | 1e-07 | ||
| 3q3f_A | 189 | Engineering Domain-Swapped Binding Interfaces By Mu | 1e-07 | ||
| 2zvn_A | 154 | Nemo Cozi Domain Incomplex With Diubiquitin In P212 | 1e-07 | ||
| 3ai5_A | 307 | Crystal Structure Of Yeast Enhanced Green Fluoresce | 1e-07 | ||
| 4ap4_C | 80 | Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le | 1e-07 | ||
| 2ld9_A | 77 | Backbone Structure Of Ubiquitin Determined Using Ba | 1e-07 | ||
| 2zeq_A | 78 | Crystal Structure Of Ubiquitin-Like Domain Of Murin | 1e-07 | ||
| 3u30_A | 172 | Crystal Structure Of A Linear-Specific Ubiquitin Fa | 1e-07 | ||
| 1sif_A | 88 | Crystal Structure Of A Multiple Hydrophobic Core Mu | 1e-07 | ||
| 3k9o_B | 96 | The Crystal Structure Of E2-25k And Ubb+1 Complex L | 1e-07 | ||
| 2xk5_B | 76 | Crystal Structure Of K6-Linked Diubiquitin Length = | 2e-07 | ||
| 2znv_B | 76 | Crystal Structure Of Human Amsh-Lp Dub Domain In Co | 2e-07 | ||
| 3dvg_Y | 79 | Crystal Structure Of K63-Specific Fab Apu.3a8 Bound | 2e-07 | ||
| 2w9n_A | 152 | Crystal Structure Of Linear Di-Ubiquitin Length = 1 | 2e-07 | ||
| 1aar_A | 76 | Structure Of A Diubiquitin Conjugate And A Model Fo | 2e-07 | ||
| 3b08_A | 152 | Crystal Structure Of The Mouse Hoil1-L-Nzf In Compl | 2e-07 | ||
| 2khw_B | 79 | Solution Structure Of The Human Polymerase Iota Ubm | 2e-07 | ||
| 3dvg_X | 80 | Crystal Structure Of K63-Specific Fab Apu.3a8 Bound | 2e-07 | ||
| 2znv_C | 77 | Crystal Structure Of Human Amsh-Lp Dub Domain In Co | 2e-07 | ||
| 2k6d_B | 76 | Cin85 Sh3-C Domain In Complex With Ubiquitin Length | 2e-07 | ||
| 1xd3_B | 75 | Crystal Structure Of Uchl3-Ubvme Complex Length = 7 | 2e-07 | ||
| 1cmx_B | 76 | Structural Basis For The Specificity Of Ubiquitin C | 2e-07 | ||
| 3nob_A | 78 | Structure Of K11-Linked Di-Ubiquitin Length = 78 | 2e-07 | ||
| 4hjk_A | 77 | U7ub7 Disulfide Variant Length = 77 | 2e-07 | ||
| 2y5b_B | 152 | Structure Of Usp21 In Complex With Linear Diubiquit | 2e-07 | ||
| 3rul_A | 79 | New Strategy To Analyze Structures Of Glycopeptide- | 2e-07 | ||
| 3b1l_X | 76 | Crystal Structure Of Parkin Ubiquitin-Like Domain R | 2e-07 | ||
| 1yx5_B | 98 | Solution Structure Of S5a Uim-1UBIQUITIN COMPLEX Le | 3e-07 | ||
| 1s1q_B | 76 | Tsg101(Uev) Domain In Complex With Ubiquitin Length | 3e-07 | ||
| 2o6v_D | 76 | Crystal Structure And Solution Nmr Studies Of Lys48 | 3e-07 | ||
| 1zgu_B | 76 | Solution Structure Of The Human Mms2-Ubiquitin Comp | 3e-07 | ||
| 3ldz_F | 73 | Crystal Structure Of Human Stam1 Vhs Domain In Comp | 3e-07 | ||
| 3ons_A | 72 | Crystal Structure Of Human Ubiquitin In A New Cryst | 3e-07 | ||
| 1c3t_A | 76 | Rotamer Strain As A Determinant Of Protein Structur | 3e-07 | ||
| 3v6c_B | 91 | Crystal Structure Of Usp2 In Complex With Mutated U | 5e-07 | ||
| 3olm_D | 79 | Structure And Function Of A Ubiquitin Binding Site | 5e-07 | ||
| 4hk2_A | 78 | U7ub25.2540 Length = 78 | 6e-07 | ||
| 2o6v_B | 76 | Crystal Structure And Solution Nmr Studies Of Lys48 | 6e-07 | ||
| 2jvc_A | 82 | Nmr Solution Structure Of Ubiquitin Like Protein Le | 7e-07 | ||
| 1yj1_A | 76 | X-Ray Crystal Structure Of A Chemically Synthesized | 9e-07 | ||
| 2fcs_A | 76 | X-Ray Crystal Structure Of A Chemically Synthesized | 9e-07 | ||
| 4a18_K | 129 | T.Thermophila 60s Ribosomal Subunit In Complex With | 1e-06 | ||
| 4hcn_B | 98 | Crystal Structure Of Burkholderia Pseudomallei Effe | 1e-06 | ||
| 3v6e_B | 91 | Crystal Structure Of Usp2 And A Mutant Form Of Ubiq | 1e-06 | ||
| 2jwz_A | 76 | Mutations In The Hydrophobic Core Of Ubiquitin Diff | 1e-06 | ||
| 1ud7_A | 76 | Solution Structure Of The Designed Hydrophobic Core | 1e-06 | ||
| 3l0w_B | 169 | Structure Of Split Monoubiquitinated Pcna With Ubiq | 1e-06 | ||
| 4ii3_B | 96 | Crystal Structure Of S. Pombe Ubiquitin Activating | 2e-06 | ||
| 1otr_B | 76 | Solution Structure Of A Cue-Ubiquitin Complex Lengt | 2e-06 | ||
| 3u5e_m | 128 | The Structure Of The Eukaryotic Ribosome At 3.0 A R | 2e-06 | ||
| 4gsw_A | 80 | Crystal Structure Of Ubiquitin From Entamoeba Histo | 2e-06 | ||
| 1ogw_A | 76 | Synthetic Ubiquitin With Fluoro-Leu At 50 And 67 Le | 3e-06 | ||
| 3u5c_f | 152 | The Structure Of The Eukaryotic Ribosome At 3.0 A R | 4e-06 | ||
| 3u5g_f | 152 | The Structure Of The Eukaryotic Ribosome At 3.0 A R | 4e-06 | ||
| 2gbk_A | 83 | Crystal Structure Of The 9-10 Moad Insertion Mutant | 4e-06 | ||
| 3h7s_B | 76 | Crystal Structures Of K63-Linked Di- And Tri-Ubiqui | 4e-06 | ||
| 4i6l_B | 76 | Crystal Structure Of Otub1 In Complex With Ubiquiti | 6e-06 | ||
| 3mtn_B | 85 | Usp21 In Complex With A Ubiquitin-based, Usp21-spec | 7e-06 | ||
| 3zf7_s | 128 | High-resolution Cryo-electron Microscopy Structure | 7e-06 | ||
| 2gbr_A | 81 | Crystal Structure Of The 35-36 Moad Insertion Mutan | 7e-06 | ||
| 1zw7_A | 82 | Elimination Of The C-Cap In Ubiquitin Structure, Dy | 2e-05 | ||
| 2gbj_A | 84 | Crystal Structure Of The 9-10 8 Glycine Insertion M | 3e-05 | ||
| 2kdi_A | 114 | Solution Structure Of A UbiquitinUIM FUSION PROTEIN | 3e-05 | ||
| 4ii2_B | 83 | Crystal Structure Of Ubiquitin Activating Enzyme 1 | 4e-05 | ||
| 3n3k_B | 85 | The Catalytic Domain Of Usp8 In Complex With A Usp8 | 1e-04 | ||
| 2gbm_A | 84 | Crystal Structure Of The 35-36 8 Glycine Insertion | 1e-04 | ||
| 3dbh_I | 88 | Structural Dissection Of A Gating Mechanism Prevent | 2e-04 | ||
| 3dbl_I | 88 | Structural Dissection Of A Gating Mechanism Prevent | 2e-04 | ||
| 2nvu_I | 81 | Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 | 2e-04 | ||
| 1bt0_A | 76 | Structure Of Ubiquitin-Like Protein, Rub1 Length = | 3e-04 | ||
| 4f8c_B | 88 | Structure Of The Cif:nedd8 Complex - Yersinia Pseud | 3e-04 | ||
| 2bkr_B | 77 | Nedd8 Nedp1 Complex Length = 77 | 3e-04 | ||
| 1ib2_A | 349 | Crystal Structure Of A Pumilio-Homology Domain Leng | 4e-04 | ||
| 4hcp_B | 78 | Crystal Structure Of Burkholderia Pseudomallei Effe | 4e-04 | ||
| 1ndd_B | 76 | Structure Of Nedd8 Length = 76 | 5e-04 | ||
| 3gzn_I | 82 | Structure Of Nedd8-Activating Enzyme In Complex Wit | 5e-04 | ||
| 3bsb_A | 343 | Crystal Structure Of Human Pumilio1 In Complex With | 5e-04 | ||
| 3h3d_X | 323 | Drosophila Pumilio Rna Binding Domain (Puf Domain) | 5e-04 | ||
| 1gjz_A | 53 | Solution Structure Of A Dimeric N-Terminal Fragment | 5e-04 | ||
| 3dqv_A | 81 | Structural Insights Into Nedd8 Activation Of Cullin | 7e-04 |
| >pdb|2HLW|A Chain A, Solution Structure Of The Human Ubiquitin-Conjugating Enzyme Variant Uev1a Length = 170 | Back alignment and structure |
|
| >pdb|2A4D|A Chain A, Structure Of The Human Ubiquitin-Conjugating Enzyme E2 Variant 1 (Uev- 1) Length = 160 | Back alignment and structure |
| >pdb|3VON|B Chain B, Crystalstructure Of The Ubiquitin Protease Length = 138 | Back alignment and structure |
| >pdb|4EPO|A Chain A, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 149 | Back alignment and structure |
| >pdb|1ZGU|A Chain A, Solution Structure Of The Human Mms2-Ubiquitin Complex Length = 139 | Back alignment and structure |
| >pdb|1J74|A Chain A, Crystal Structure Of Mms2 Length = 145 | Back alignment and structure |
| >pdb|2C2V|C Chain C, Crystal Structure Of The Chip-Ubc13-Uev1a Complex Length = 142 | Back alignment and structure |
| >pdb|2GMI|B Chain B, Mms2UBC13~UBIQUITIN Length = 137 | Back alignment and structure |
| >pdb|1JAT|B Chain B, Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Length = 138 | Back alignment and structure |
| >pdb|3E95|C Chain C, Crystal Structure Of The Plasmodium Falciparum Ubiquitin Conjugating Enzyme Complex, Pfubc13-Pfuev1a Length = 158 | Back alignment and structure |
| >pdb|2Q0V|A Chain A, Crystal Structure Of Ubiquitin Conjugating Enzyme E2, Putative, From Plasmodium Falciparum Length = 156 | Back alignment and structure |
| >pdb|2K25|A Chain A, Automated Nmr Structure Of The Ubb By Fapsy Length = 103 | Back alignment and structure |
| >pdb|1IYF|A Chain A, Solution Structure Of Ubiquitin-Like Domain Of Human Parkin Length = 81 | Back alignment and structure |
| >pdb|2KNB|A Chain A, Solution Nmr Structure Of The Parkin Ubl Domain In Complex With The Endophilin-A1 Sh3 Domain Length = 81 | Back alignment and structure |
| >pdb|2OJR|A Chain A, Structure Of Ubiquitin Solved By Sad Using The Lanthanide- Binding Tag Length = 111 | Back alignment and structure |
| >pdb|3VDZ|A Chain A, Tailoring Encodable Lanthanide-Binding Tags As Mri Contrast Agents: Xq-Dse3-Ubiquitin At 2.4 Angstroms Length = 111 | Back alignment and structure |
| >pdb|3JVZ|X Chain X, E2~ubiquitin-Hect Length = 81 | Back alignment and structure |
| >pdb|2ZCB|A Chain A, Crystal Structure Of Ubiquitin P37aP38A Length = 76 | Back alignment and structure |
| >pdb|1YIW|A Chain A, X-Ray Crystal Structure Of A Chemically Synthesized Ubiquitin Length = 76 | Back alignment and structure |
| >pdb|3Q3F|A Chain A, Engineering Domain-Swapped Binding Interfaces By Mutually Exclusive Folding: Insertion Of Ubiquitin Into Position 103 Of Barnase Length = 189 | Back alignment and structure |
| >pdb|2ZVN|A Chain A, Nemo Cozi Domain Incomplex With Diubiquitin In P212121 Space Group Length = 154 | Back alignment and structure |
| >pdb|3AI5|A Chain A, Crystal Structure Of Yeast Enhanced Green Fluorescent Protein- Ubiquitin Fusion Protein Length = 307 | Back alignment and structure |
| >pdb|4AP4|C Chain C, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 80 | Back alignment and structure |
| >pdb|2LD9|A Chain A, Backbone Structure Of Ubiquitin Determined Using Backbone Amide Noes And Backbone N-H And N-C Rdcs Length = 77 | Back alignment and structure |
| >pdb|2ZEQ|A Chain A, Crystal Structure Of Ubiquitin-Like Domain Of Murine Parkin Length = 78 | Back alignment and structure |
| >pdb|3U30|A Chain A, Crystal Structure Of A Linear-Specific Ubiquitin Fab Bound To Linear Ubiquitin Length = 172 | Back alignment and structure |
| >pdb|1SIF|A Chain A, Crystal Structure Of A Multiple Hydrophobic Core Mutant Of Ubiquitin Length = 88 | Back alignment and structure |
| >pdb|3K9O|B Chain B, The Crystal Structure Of E2-25k And Ubb+1 Complex Length = 96 | Back alignment and structure |
| >pdb|2XK5|B Chain B, Crystal Structure Of K6-Linked Diubiquitin Length = 76 | Back alignment and structure |
| >pdb|2ZNV|B Chain B, Crystal Structure Of Human Amsh-Lp Dub Domain In Complex With Lys63-Linked Ubiquitin Dimer Length = 76 | Back alignment and structure |
| >pdb|3DVG|Y Chain Y, Crystal Structure Of K63-Specific Fab Apu.3a8 Bound To K63-Linked Di- Ubiquitin Length = 79 | Back alignment and structure |
| >pdb|2W9N|A Chain A, Crystal Structure Of Linear Di-Ubiquitin Length = 152 | Back alignment and structure |
| >pdb|1AAR|A Chain A, Structure Of A Diubiquitin Conjugate And A Model For Interaction With Ubiquitin Conjugating Enzyme (E2) Length = 76 | Back alignment and structure |
| >pdb|3B08|A Chain A, Crystal Structure Of The Mouse Hoil1-L-Nzf In Complex With Linear Di- Ubiquitin Length = 152 | Back alignment and structure |
| >pdb|2KHW|B Chain B, Solution Structure Of The Human Polymerase Iota Ubm2- Ubiquitin Complex Length = 79 | Back alignment and structure |
| >pdb|3DVG|X Chain X, Crystal Structure Of K63-Specific Fab Apu.3a8 Bound To K63-Linked Di- Ubiquitin Length = 80 | Back alignment and structure |
| >pdb|2ZNV|C Chain C, Crystal Structure Of Human Amsh-Lp Dub Domain In Complex With Lys63-Linked Ubiquitin Dimer Length = 77 | Back alignment and structure |
| >pdb|2K6D|B Chain B, Cin85 Sh3-C Domain In Complex With Ubiquitin Length = 76 | Back alignment and structure |
| >pdb|1XD3|B Chain B, Crystal Structure Of Uchl3-Ubvme Complex Length = 75 | Back alignment and structure |
| >pdb|1CMX|B Chain B, Structural Basis For The Specificity Of Ubiquitin C- Terminal Hydrolases Length = 76 | Back alignment and structure |
| >pdb|3NOB|A Chain A, Structure Of K11-Linked Di-Ubiquitin Length = 78 | Back alignment and structure |
| >pdb|4HJK|A Chain A, U7ub7 Disulfide Variant Length = 77 | Back alignment and structure |
| >pdb|2Y5B|B Chain B, Structure Of Usp21 In Complex With Linear Diubiquitin-Aldehyde Length = 152 | Back alignment and structure |
| >pdb|3RUL|A Chain A, New Strategy To Analyze Structures Of Glycopeptide-Target Complexes Length = 79 | Back alignment and structure |
| >pdb|3B1L|X Chain X, Crystal Structure Of Parkin Ubiquitin-Like Domain R33q Mutant Length = 76 | Back alignment and structure |
| >pdb|1YX5|B Chain B, Solution Structure Of S5a Uim-1UBIQUITIN COMPLEX Length = 98 | Back alignment and structure |
| >pdb|1S1Q|B Chain B, Tsg101(Uev) Domain In Complex With Ubiquitin Length = 76 | Back alignment and structure |
| >pdb|2O6V|D Chain D, Crystal Structure And Solution Nmr Studies Of Lys48-Linked Tetraubiquitin At Neutral Ph Length = 76 | Back alignment and structure |
| >pdb|1ZGU|B Chain B, Solution Structure Of The Human Mms2-Ubiquitin Complex Length = 76 | Back alignment and structure |
| >pdb|3LDZ|F Chain F, Crystal Structure Of Human Stam1 Vhs Domain In Complex With Ubiquitin Length = 73 | Back alignment and structure |
| >pdb|3ONS|A Chain A, Crystal Structure Of Human Ubiquitin In A New Crystal Form Length = 72 | Back alignment and structure |
| >pdb|1C3T|A Chain A, Rotamer Strain As A Determinant Of Protein Structural Specificity Length = 76 | Back alignment and structure |
| >pdb|3V6C|B Chain B, Crystal Structure Of Usp2 In Complex With Mutated Ubiquitin Length = 91 | Back alignment and structure |
| >pdb|3OLM|D Chain D, Structure And Function Of A Ubiquitin Binding Site Within The Catalytic Domain Of A Hect Ubiquitin Ligase Length = 79 | Back alignment and structure |
| >pdb|4HK2|A Chain A, U7ub25.2540 Length = 78 | Back alignment and structure |
| >pdb|2O6V|B Chain B, Crystal Structure And Solution Nmr Studies Of Lys48-Linked Tetraubiquitin At Neutral Ph Length = 76 | Back alignment and structure |
| >pdb|2JVC|A Chain A, Nmr Solution Structure Of Ubiquitin Like Protein Length = 82 | Back alignment and structure |
| >pdb|1YJ1|A Chain A, X-Ray Crystal Structure Of A Chemically Synthesized [d-Gln35]ubiquitin Length = 76 | Back alignment and structure |
| >pdb|2FCS|A Chain A, X-Ray Crystal Structure Of A Chemically Synthesized [l-Gln35]ubiquitin With A Cubic Space Group Length = 76 | Back alignment and structure |
| >pdb|4A18|K Chain K, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 26s Rrna And Proteins Of Molecule 1 Length = 129 | Back alignment and structure |
| >pdb|4HCN|B Chain B, Crystal Structure Of Burkholderia Pseudomallei Effector Protein Chbp In Complex With Ubiquitin Length = 98 | Back alignment and structure |
| >pdb|3V6E|B Chain B, Crystal Structure Of Usp2 And A Mutant Form Of Ubiquitin Length = 91 | Back alignment and structure |
| >pdb|2JWZ|A Chain A, Mutations In The Hydrophobic Core Of Ubiquitin Differentially Affect Its Recognition By Receptor Proteins Length = 76 | Back alignment and structure |
| >pdb|1UD7|A Chain A, Solution Structure Of The Designed Hydrophobic Core Mutant Of Ubiquitin, 1d7 Length = 76 | Back alignment and structure |
| >pdb|3L0W|B Chain B, Structure Of Split Monoubiquitinated Pcna With Ubiquitin In Position Two Length = 169 | Back alignment and structure |
| >pdb|4II3|B Chain B, Crystal Structure Of S. Pombe Ubiquitin Activating Enzyme 1 (uba1) In Complex With Ubiquitin And Atp/mg Length = 96 | Back alignment and structure |
| >pdb|1OTR|B Chain B, Solution Structure Of A Cue-Ubiquitin Complex Length = 76 | Back alignment and structure |
| >pdb|3U5E|MM Chain m, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. This Entry Contains Proteins Of The 60s Subunit, Ribosome A Length = 128 | Back alignment and structure |
| >pdb|4GSW|A Chain A, Crystal Structure Of Ubiquitin From Entamoeba Histolytica To 2.15 Angstrom Length = 80 | Back alignment and structure |
| >pdb|1OGW|A Chain A, Synthetic Ubiquitin With Fluoro-Leu At 50 And 67 Length = 76 | Back alignment and structure |
| >pdb|3U5C|FF Chain f, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. This Entry Contains Proteins Of The 40s Subunit, Ribosome A Length = 152 | Back alignment and structure |
| >pdb|3U5G|FF Chain f, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. This Entry Contains Proteins Of The 40s Subunit, Ribosome B Length = 152 | Back alignment and structure |
| >pdb|2GBK|A Chain A, Crystal Structure Of The 9-10 Moad Insertion Mutant Of Ubiquitin Length = 83 | Back alignment and structure |
| >pdb|4I6L|B Chain B, Crystal Structure Of Otub1 In Complex With Ubiquitin Variant Length = 76 | Back alignment and structure |
| >pdb|3MTN|B Chain B, Usp21 In Complex With A Ubiquitin-based, Usp21-specific Inhibitor Length = 85 | Back alignment and structure |
| >pdb|3ZF7|SS Chain s, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 128 | Back alignment and structure |
| >pdb|2GBR|A Chain A, Crystal Structure Of The 35-36 Moad Insertion Mutant Of Ubiquitin Length = 81 | Back alignment and structure |
| >pdb|1ZW7|A Chain A, Elimination Of The C-Cap In Ubiquitin Structure, Dynamics And Thermodynamic Consequences Length = 82 | Back alignment and structure |
| >pdb|2GBJ|A Chain A, Crystal Structure Of The 9-10 8 Glycine Insertion Mutant Of Ubiquitin. Length = 84 | Back alignment and structure |
| >pdb|2KDI|A Chain A, Solution Structure Of A UbiquitinUIM FUSION PROTEIN Length = 114 | Back alignment and structure |
| >pdb|4II2|B Chain B, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 83 | Back alignment and structure |
| >pdb|3N3K|B Chain B, The Catalytic Domain Of Usp8 In Complex With A Usp8 Specific Inhibitor Length = 85 | Back alignment and structure |
| >pdb|2GBM|A Chain A, Crystal Structure Of The 35-36 8 Glycine Insertion Mutant Of Ubiquitin Length = 84 | Back alignment and structure |
| >pdb|3DBH|I Chain I, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190ala-Nedd8ala72arg) Length = 88 | Back alignment and structure |
| >pdb|3DBL|I Chain I, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190wt-Nedd8ala72gln) Length = 88 | Back alignment and structure |
| >pdb|2NVU|I Chain I, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 81 | Back alignment and structure |
| >pdb|1BT0|A Chain A, Structure Of Ubiquitin-Like Protein, Rub1 Length = 76 | Back alignment and structure |
| >pdb|4F8C|B Chain B, Structure Of The Cif:nedd8 Complex - Yersinia Pseudotuberculosis Cycle Inhibiting Factor In Complex With Human Nedd8 Length = 88 | Back alignment and structure |
| >pdb|2BKR|B Chain B, Nedd8 Nedp1 Complex Length = 77 | Back alignment and structure |
| >pdb|1IB2|A Chain A, Crystal Structure Of A Pumilio-Homology Domain Length = 349 | Back alignment and structure |
| >pdb|4HCP|B Chain B, Crystal Structure Of Burkholderia Pseudomallei Effector Protein Chbp In Complex With Nedd8 Length = 78 | Back alignment and structure |
| >pdb|1NDD|B Chain B, Structure Of Nedd8 Length = 76 | Back alignment and structure |
| >pdb|3GZN|I Chain I, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 82 | Back alignment and structure |
| >pdb|3BSB|A Chain A, Crystal Structure Of Human Pumilio1 In Complex With Cyclinb Reverse Rna Length = 343 | Back alignment and structure |
| >pdb|3H3D|X Chain X, Drosophila Pumilio Rna Binding Domain (Puf Domain) Length = 323 | Back alignment and structure |
| >pdb|1GJZ|A Chain A, Solution Structure Of A Dimeric N-Terminal Fragment Of Human Ubiquitin Length = 53 | Back alignment and structure |
| >pdb|3DQV|A Chain A, Structural Insights Into Nedd8 Activation Of Cullin-Ring Ligases: Conformational Control Of Conjugation Length = 81 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3gvo_A Pumilio 2, pumilio homolog 2; RNA-binding, PUF domain, RNA binding protein; HET: DTD; 1.60A {Mus musculus} PDB: 3gvt_A 3q0q_A 3q0r_A 3q0s_A 1ib2_A 1m8w_A 1m8x_A 1m8y_A 1m8z_A 3q0l_A 3q0m_A 3q0n_A 3q0o_A 3q0p_A 2yjy_A 3bsx_A 3bsb_A 3h3d_X Length = 351 | Back alignment and structure |
|---|
Score = 147 bits (372), Expect = 7e-39
Identities = 50/291 (17%), Positives = 111/291 (38%), Gaps = 20/291 (6%)
Query: 3 QIVFSHDMSRIIQWLLKLSSPQMKKDIVKELLPFTVAMIKSKYSNALVKHMLKSGDENTK 62
+ SR IQ L+ ++P ++ + E+L ++ + N +++ + G + K
Sbjct: 30 EFSQDQHGSRFIQQKLERATPAERQIVFNEILQAAYQLMTDVFGNYVIQKFFEFGSLDQK 89
Query: 63 NEIIKALQPHVVTLLSHTTASPVLMYAHDQVASPAQKLAMRQELYGGLYESTGDKKIN-C 121
+ ++ HV+ L V+ A + S Q+ M +EL G + + D+ N
Sbjct: 90 LALATRIRGHVLPLALQMYGCRVIQKALE-SISSDQQSEMVKELDGHVLKCVKDQNGNHV 148
Query: 122 LGDIFEQ-SPEMKTAILSVTKKTILKSLQKTQVTGSALLHAVLLDFISHSSDSPDLMEVL 180
+ E P+ I+ K + V+ + H + + +L
Sbjct: 149 VQKCIECVQPQSLQFIIDAFKGQVFVLSTHPYG------CRVIQRILEHCTAE-QTLPIL 201
Query: 181 EMLAPLPLLPFVHSKAGASVAMHIIWNATNKLKKKIVKELKGHLREVATSEFGHLVLVTL 240
E L V + G V H++ + + K KIV E++G + ++ +F V+
Sbjct: 202 EELHQH-TEQLVQDQYGNYVIQHVLEHGRPEDKSKIVSEIRGKVLALSQHKFASNVVEKC 260
Query: 241 LDNVDDTLLLKKALLPELLAE-------VVPLANHEYGRKVIAHLVSWCDP 284
+ + + L+ E+ + + + +Y V+ ++ +P
Sbjct: 261 VTHASRA--ERALLIDEVCCQNDGPHSALYTMMKDQYANYVVQKMIDMAEP 309
|
| >3gvo_A Pumilio 2, pumilio homolog 2; RNA-binding, PUF domain, RNA binding protein; HET: DTD; 1.60A {Mus musculus} PDB: 3gvt_A 3q0q_A 3q0r_A 3q0s_A 1ib2_A 1m8w_A 1m8x_A 1m8y_A 1m8z_A 3q0l_A 3q0m_A 3q0n_A 3q0o_A 3q0p_A 2yjy_A 3bsx_A 3bsb_A 3h3d_X Length = 351 | Back alignment and structure |
|---|
| >3gvo_A Pumilio 2, pumilio homolog 2; RNA-binding, PUF domain, RNA binding protein; HET: DTD; 1.60A {Mus musculus} PDB: 3gvt_A 3q0q_A 3q0r_A 3q0s_A 1ib2_A 1m8w_A 1m8x_A 1m8y_A 1m8z_A 3q0l_A 3q0m_A 3q0n_A 3q0o_A 3q0p_A 2yjy_A 3bsx_A 3bsb_A 3h3d_X Length = 351 | Back alignment and structure |
|---|
| >3k49_A MRNA-binding protein PUF3; PUF3, pumilio, RNA binding, mitochondrial mRNA,, membrane, mitochondrion; HET: CIT; 2.50A {Saccharomyces cerevisiae} PDB: 3k4e_A Length = 369 | Back alignment and structure |
|---|
| >3k49_A MRNA-binding protein PUF3; PUF3, pumilio, RNA binding, mitochondrial mRNA,, membrane, mitochondrion; HET: CIT; 2.50A {Saccharomyces cerevisiae} PDB: 3k4e_A Length = 369 | Back alignment and structure |
|---|
| >3k49_A MRNA-binding protein PUF3; PUF3, pumilio, RNA binding, mitochondrial mRNA,, membrane, mitochondrion; HET: CIT; 2.50A {Saccharomyces cerevisiae} PDB: 3k4e_A Length = 369 | Back alignment and structure |
|---|
| >3bwt_A Protein PUF4; pumilio, RNA binding, HO endonuclease, transcription, RNA binding protein; 2.69A {Saccharomyces cerevisiae} PDB: 4dzs_A 3bx2_A 3bx3_A Length = 333 | Back alignment and structure |
|---|
| >2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Length = 156 | Back alignment and structure |
|---|
| >1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Length = 138 | Back alignment and structure |
|---|
| >2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Length = 160 | Back alignment and structure |
|---|
| >3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Length = 76 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 | Back alignment and structure |
|---|
| >1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 | Back alignment and structure |
|---|
| >4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Length = 90 | Back alignment and structure |
|---|
| >2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 | Back alignment and structure |
|---|
| >2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Length = 189 | Back alignment and structure |
|---|
| >3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 106 | Back alignment and structure |
|---|
| >1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Length = 76 | Back alignment and structure |
|---|
| >3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Length = 88 | Back alignment and structure |
|---|
| >2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 93 | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Length = 77 | Back alignment and structure |
|---|
| >1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 100 | Back alignment and structure |
|---|
| >3u5c_F RP14, S2, YS8, 40S ribosomal protein S5; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_F 3o30_D 3o2z_D 3u5g_F 3jyv_G* 2noq_F 1s1h_G 3iz6_F Length = 225 | Back alignment and structure |
|---|
| >4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: k.45.1.1 PDB: 3dbr_I 3dbl_I Length = 88 | Back alignment and structure |
|---|
| >3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 101 | Back alignment and structure |
|---|
| >3v71_A PUF (pumilio/FBF) domain-containing protein 7, CO transcript evidence; PUF repeats, RNA binding protein-RNA complex; HET: EPE; 2.90A {Caenorhabditis elegans} Length = 382 | Back alignment and structure |
|---|
| >3v71_A PUF (pumilio/FBF) domain-containing protein 7, CO transcript evidence; PUF repeats, RNA binding protein-RNA complex; HET: EPE; 2.90A {Caenorhabditis elegans} Length = 382 | Back alignment and structure |
|---|
| >1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 125 | Back alignment and structure |
|---|
| >1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Length = 88 | Back alignment and structure |
|---|
| >2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Length = 85 | Back alignment and structure |
|---|
| >1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 95 | Back alignment and structure |
|---|
| >3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Length = 76 | Back alignment and structure |
|---|
| >3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Length = 128 | Back alignment and structure |
|---|
| >1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Length = 98 | Back alignment and structure |
|---|
| >3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Length = 96 | Back alignment and structure |
|---|
| >2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Length = 84 | Back alignment and structure |
|---|
| >1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 87 | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Length = 368 | Back alignment and structure |
|---|
| >2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Length = 114 | Back alignment and structure |
|---|
| >3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Length = 169 | Back alignment and structure |
|---|
| >2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Length = 85 | Back alignment and structure |
|---|
| >1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 89 | Back alignment and structure |
|---|
| >1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Length = 115 | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Length = 172 | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Length = 172 | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Length = 159 | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Length = 159 | Back alignment and structure |
|---|
| >2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 78 | Back alignment and structure |
|---|
| >1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Length = 111 | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Length = 152 | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Length = 152 | Back alignment and structure |
|---|
| >3k62_A FEM-3 mRNA-binding factor 2; FBF, FEM-3 binding factor, PUF, RNA-binding specificity, base flipping, base stacking; 1.90A {Caenorhabditis elegans} PDB: 3k5y_A 3k5z_A 3k61_A 3k5q_A 3k64_A 3qg9_A 3v6y_A 3v74_A 3qgc_A 3qgb_A Length = 412 | Back alignment and structure |
|---|
| >3k62_A FEM-3 mRNA-binding factor 2; FBF, FEM-3 binding factor, PUF, RNA-binding specificity, base flipping, base stacking; 1.90A {Caenorhabditis elegans} PDB: 3k5y_A 3k5z_A 3k61_A 3k5q_A 3k64_A 3qg9_A 3v6y_A 3v74_A 3qgc_A 3qgb_A Length = 412 | Back alignment and structure |
|---|
| >2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Length = 94 | Back alignment and structure |
|---|
| >3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Length = 307 | Back alignment and structure |
|---|
| >1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 102 | Back alignment and structure |
|---|
| >1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 | Back alignment and structure |
|---|
| >3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Length = 189 | Back alignment and structure |
|---|
| >1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 93 | Back alignment and structure |
|---|
| >1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 | Back alignment and structure |
|---|
| >2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 816 | |||
| 3gvo_A | 351 | Pumilio 2, pumilio homolog 2; RNA-binding, PUF dom | 100.0 | |
| 3k49_A | 369 | MRNA-binding protein PUF3; PUF3, pumilio, RNA bind | 100.0 | |
| 3bwt_A | 333 | Protein PUF4; pumilio, RNA binding, HO endonucleas | 100.0 | |
| 3k62_A | 412 | FEM-3 mRNA-binding factor 2; FBF, FEM-3 binding fa | 100.0 | |
| 3v71_A | 382 | PUF (pumilio/FBF) domain-containing protein 7, CO | 100.0 | |
| 3gvo_A | 351 | Pumilio 2, pumilio homolog 2; RNA-binding, PUF dom | 100.0 | |
| 3bwt_A | 333 | Protein PUF4; pumilio, RNA binding, HO endonucleas | 100.0 | |
| 3k49_A | 369 | MRNA-binding protein PUF3; PUF3, pumilio, RNA bind | 100.0 | |
| 3v71_A | 382 | PUF (pumilio/FBF) domain-containing protein 7, CO | 100.0 | |
| 3k62_A | 412 | FEM-3 mRNA-binding factor 2; FBF, FEM-3 binding fa | 100.0 | |
| 3phx_B | 79 | Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu | 99.73 | |
| 3u5c_f | 152 | 40S ribosomal protein S31; translation, ribosome, | 99.72 | |
| 3plu_A | 93 | Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- | 99.7 | |
| 4fbj_B | 88 | NEDD8; effector-HOST target complex, glutamine dea | 99.7 | |
| 4dwf_A | 90 | HLA-B-associated transcript 3; ubiquitin-like doma | 99.68 | |
| 2hj8_A | 88 | Interferon-induced 17 kDa protein; HR2873B, human | 99.67 | |
| 3dbh_I | 88 | NEDD8; cell cycle, activating enzyme, apoptosis, m | 99.67 | |
| 3n3k_B | 85 | Ubiquitin; hydrolase, protease, thiol protease, DU | 99.67 | |
| 1ndd_A | 76 | NEDD8, protein (ubiquitin-like protein NEDD8); pro | 99.66 | |
| 4hcn_B | 98 | Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas | 99.66 | |
| 3k9o_B | 96 | Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b | 99.66 | |
| 2kan_A | 94 | Uncharacterized protein AR3433A; ubiquitin fold, a | 99.66 | |
| 3mtn_B | 85 | UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit | 99.65 | |
| 1wh3_A | 87 | 59 kDa 2'-5'-oligoadenylate synthetase like protei | 99.65 | |
| 1wy8_A | 89 | NP95-like ring finger protein, isoform A; ubiquiti | 99.65 | |
| 1sif_A | 88 | Ubiquitin; hydrophobic mutants, folding, stability | 99.65 | |
| 3a9j_A | 76 | Ubiquitin; protein complex, cytoplasm, isopeptide | 99.65 | |
| 2uyz_B | 79 | Small ubiquitin-related modifier 1; sumoylation, c | 99.65 | |
| 1uh6_A | 100 | Ubiquitin-like 5; beta-grAsp fold, structural geno | 99.64 | |
| 1wyw_B | 97 | Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho | 99.64 | |
| 3v6c_B | 91 | Ubiquitin; structural genomics, structural genomic | 99.64 | |
| 1wgd_A | 93 | Homocysteine-responsive endoplasmic reticulum- res | 99.63 | |
| 2kk8_A | 84 | Uncharacterized protein AT4G05270; solution arabid | 99.63 | |
| 2faz_A | 78 | Ubiquitin-like containing PHD and ring finger DOM | 99.63 | |
| 2l7r_A | 93 | Ubiquitin-like protein FUBI; structural genomics, | 99.63 | |
| 2lxa_A | 87 | Ubiquitin-like protein MDY2; ubiquitin-like domain | 99.62 | |
| 1wgh_A | 116 | Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo | 99.62 | |
| 1v2y_A | 105 | 3300001G02RIK protein; hypothetical protein, ubiqu | 99.62 | |
| 4eew_A | 88 | Large proline-rich protein BAG6; ubiquitin-like fo | 99.61 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 99.61 | |
| 3vdz_A | 111 | Ubiquitin-40S ribosomal protein S27A; gadolinium, | 99.61 | |
| 1uel_A | 95 | HHR23B, UV excision repair protein RAD23 homolog B | 99.61 | |
| 4a20_A | 98 | Ubiquitin-like protein MDY2; protein binding, GET- | 99.6 | |
| 3m62_B | 106 | UV excision repair protein RAD23; armadillo-like r | 99.6 | |
| 1yx5_B | 98 | Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s | 99.6 | |
| 1se9_A | 126 | Ubiquitin family; ubiquitin-like, cell-free, wheat | 99.6 | |
| 2xzm_9 | 189 | RPS31E; ribosome, translation; 3.93A {Tetrahymena | 99.6 | |
| 2dzi_A | 81 | Ubiquitin-like protein 4A; GDX, structural genomic | 99.6 | |
| 3l0w_B | 169 | Monoubiquitinated proliferating cell nuclear antig | 99.59 | |
| 1wju_A | 100 | NEDD8 ultimate buster-1; ubiquitin-like domain, st | 99.59 | |
| 1we6_A | 111 | Splicing factor, putative; structural genomics, ub | 99.59 | |
| 2wyq_A | 85 | HHR23A, UV excision repair protein RAD23 homolog A | 99.59 | |
| 3b1l_X | 76 | E3 ubiquitin-protein ligase parkin; proteasome, AL | 99.36 | |
| 2ojr_A | 111 | Ubiquitin; lanthide-binding TAG, terbium, TB, SAD | 99.58 | |
| 4ajy_B | 118 | Transcription elongation factor B polypeptide 2; E | 99.58 | |
| 2gow_A | 125 | HCG-1 protein, ubiquitin-like protein 3; BC059385, | 99.57 | |
| 1wx8_A | 96 | Riken cDNA 4931431F19; ubiquitin-like domain, ubiq | 99.57 | |
| 1v5o_A | 102 | 1700011N24RIK protein; hypothetical protein, ubiqu | 99.57 | |
| 2fnj_B | 118 | Transcription elongation factor B polypeptide 2; b | 99.57 | |
| 1yqb_A | 100 | Ubiquilin 3; structural genomics consortium, ubiqu | 99.57 | |
| 1wx7_A | 106 | Ubiquilin 3; ubiquitin-like domain, structural gen | 99.56 | |
| 1ttn_A | 106 | DC-UBP, dendritic cell-derived ubiquitin-like prot | 99.56 | |
| 3q3f_A | 189 | Ribonuclease/ubiquitin chimeric protein; domain SW | 99.56 | |
| 2kdi_A | 114 | Ubiquitin, vacuolar protein sorting-associated pro | 99.56 | |
| 1j8c_A | 125 | Ubiquitin-like protein hplic-2; ubiquitin-like dom | 99.54 | |
| 2a4d_A | 160 | Ubiquitin-conjugating enzyme E2 variant 1; alterna | 99.54 | |
| 2bwf_A | 77 | Ubiquitin-like protein DSK2; signaling protein, UB | 99.54 | |
| 2klc_A | 101 | Ubiquilin-1; ubiquitin-like, structural genomics, | 99.54 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 99.54 | |
| 1we7_A | 115 | SF3A1 protein; structural genomics, ubiquitin-like | 99.53 | |
| 3u5e_m | 128 | 60S ribosomal protein L40; translation, ribosome, | 99.52 | |
| 2kdb_A | 99 | Homocysteine-responsive endoplasmic reticulum- res | 99.51 | |
| 2q0v_A | 156 | Ubiquitin-conjugating enzyme E2, putative; malaria | 99.51 | |
| 1wia_A | 95 | Hypothetical ubiquitin-like protein (riken cDNA 20 | 99.5 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 99.5 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 99.5 | |
| 2hlw_A | 170 | Ubiquitin-conjugating enzyme E2 variant 1; ubiquit | 99.49 | |
| 1jat_B | 138 | Ubiquitin-conjugating enzyme variant MMS2; UEV, li | 99.49 | |
| 4dbg_A | 105 | Ranbp-type and C3HC4-type zinc finger-containing; | 99.46 | |
| 1v5t_A | 90 | 8430435I17RIK protein; hypothetical protein, ubiqu | 99.46 | |
| 1wgg_A | 96 | Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti | 99.46 | |
| 3m63_B | 101 | Ubiquitin domain-containing protein DSK2; armadill | 99.46 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 99.46 | |
| 1wxv_A | 92 | BAG-family molecular chaperone regulator-1; struct | 99.44 | |
| 1x1m_A | 107 | Ubiquitin-like protein SB132; structural genomics, | 99.44 | |
| 2dzm_A | 100 | FAS-associated factor 1; ubiquitin-like domain, HF | 99.42 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 99.42 | |
| 2kd0_A | 85 | LRR repeats and ubiquitin-like domain-containing p | 99.4 | |
| 2daf_A | 118 | FLJ35834 protein; hypothetical protein FLJ35834, u | 99.38 | |
| 1v86_A | 95 | DNA segment, CHR 7, wayne state university 128, ex | 99.37 | |
| 2dzj_A | 88 | Synaptic glycoprotein SC2; ubiquitin-like fold, st | 99.36 | |
| 2kjr_A | 95 | CG11242; UBL, ubiquitin, ubiquitin-like, structura | 99.35 | |
| 3ai5_A | 307 | Yeast enhanced green fluorescent protein, ubiquit; | 99.34 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 99.33 | |
| 2kj6_A | 97 | Tubulin folding cofactor B; methods development, N | 99.31 | |
| 4b6w_A | 86 | Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik | 99.3 | |
| 2a7l_A | 136 | Hypothetical ubiquitin-conjugating enzyme LOC55284 | 99.29 | |
| 1fxt_A | 149 | Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM | 99.25 | |
| 2awf_A | 172 | Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co | 99.25 | |
| 2io1_B | 94 | Small ubiquitin-related modifier 3 precursor; SUMO | 99.24 | |
| 2fo3_A | 125 | Ubiquitin-conjugating enzyme; SGC, UBC, structural | 99.24 | |
| 2ayv_A | 166 | Ubiquitin-conjugating enzyme E2; structural genomi | 99.24 | |
| 3rcz_B | 163 | SUMO-conjugating enzyme UBC9; SUMO-like domain, pr | 99.24 | |
| 2h2y_A | 136 | Ubiquitin-conjugating enzyme; structural genomics, | 99.23 | |
| 1wf9_A | 107 | NPL4 family protein; beta-grAsp fold like domain, | 99.23 | |
| 1yh2_A | 169 | HSPC150 protein similar to ubiquitin-conjugating e | 99.22 | |
| 2ucz_A | 165 | UBC7, ubiquitin conjugating enzyme; ubiquitin conj | 99.21 | |
| 1v6e_A | 95 | Cytoskeleton-associated protein 1; tubulin-specifi | 99.21 | |
| 2c4o_A | 165 | Ubiquitin-conjugating enzyme E2 D2; thioesterifica | 99.19 | |
| 3h8k_A | 164 | Ubiquitin-conjugating enzyme E2 G2; alpha beta, al | 99.19 | |
| 2gjd_A | 157 | Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT | 99.19 | |
| 2c2v_B | 154 | Ubiquitin-conjugating enzyme E2 N; chaperone, heat | 99.19 | |
| 1t0y_A | 122 | Tubulin folding cofactor B; ubiquitin-like, cytosk | 99.19 | |
| 2e2c_A | 156 | Ubiquitin conjugating enzyme; ubiquitin conjugatio | 99.18 | |
| 1ayz_A | 169 | UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin | 99.18 | |
| 2aak_A | 152 | UBC1, ubiquitin conjugating enzyme; ubiquitin conj | 99.18 | |
| 1zdn_A | 158 | Ubiquitin-conjugating enzyme E2S; structural genom | 99.18 | |
| 2pwq_A | 216 | Ubiquitin conjugating enzyme; structural genomics | 99.17 | |
| 3rz3_A | 183 | Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj | 99.17 | |
| 2r0j_A | 149 | Ubiquitin carrier protein; ubiquitin conjugating, | 99.17 | |
| 2grr_A | 161 | Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj | 99.17 | |
| 4gpr_A | 151 | Ubiquitin-conjugating enzyme family protein; ubiqu | 99.17 | |
| 1z2u_A | 150 | Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro | 99.16 | |
| 2f4w_A | 187 | Ubiquitin-conjugating enzyme E2, J2; endoplasmic r | 99.16 | |
| 1i7k_A | 179 | Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A | 99.16 | |
| 3fn1_B | 167 | NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin | 99.15 | |
| 3bzh_A | 194 | Ubiquitin-conjugating enzyme E2 E1; structural gen | 99.14 | |
| 1tte_A | 215 | Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq | 99.13 | |
| 2io0_B | 91 | Small ubiquitin-related modifier 2 precursor; SUMO | 99.13 | |
| 1yrv_A | 169 | Ubiquitin-conjugating ligase MGC351130; structural | 99.13 | |
| 2kzr_A | 86 | Ubiquitin thioesterase OTU1; structural genomics, | 99.12 | |
| 1jat_A | 155 | Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig | 99.12 | |
| 2f4z_A | 193 | Tgtwinscan_2721 - E2 domain; ubiquitin conjugating | 99.11 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 99.09 | |
| 2bep_A | 159 | Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 | 99.09 | |
| 2y9m_A | 172 | Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra | 99.09 | |
| 2d07_B | 93 | Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho | 99.07 | |
| 3k9o_A | 201 | Ubiquitin-conjugating enzyme E2 K; E2-25K, complex | 99.05 | |
| 1wz0_A | 104 | Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li | 99.04 | |
| 3ceg_A | 323 | Baculoviral IAP repeat-containing protein 6; apopt | 99.04 | |
| 1wm3_A | 72 | Ubiquitin-like protein SMT3B; ubiquitin fold, half | 99.03 | |
| 3e46_A | 253 | Ubiquitin-conjugating enzyme E2-25 kDa; huntington | 99.01 | |
| 1y8x_A | 160 | Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju | 99.01 | |
| 2nvu_C | 180 | NEDD8-conjugating enzyme UBC12; multifunction macr | 99.0 | |
| 3a4r_A | 79 | Nfatc2-interacting protein; ubiquitin fold, coiled | 98.99 | |
| 2k8h_A | 110 | Small ubiquitin protein; SUMO, post-translational | 98.98 | |
| 2eke_C | 106 | Ubiquitin-like protein SMT3; UBC9, SUMO binding mo | 98.97 | |
| 1yf9_A | 171 | Ubiquitin carrier protein 4; SGPP, structural geno | 98.97 | |
| 1wzv_A | 155 | Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A | 98.97 | |
| 1c4z_D | 154 | UBCH7, ubiquitin conjugating enzyme E2; bilobal st | 98.96 | |
| 2z5d_A | 179 | Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig | 98.95 | |
| 4ddg_A | 399 | Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI | 98.93 | |
| 2onu_A | 152 | Ubiquitin-conjugating enzyme, putative; UBC, plasm | 98.92 | |
| 3o2u_A | 190 | NEDD8-conjugating enzyme UBC12; E2 conjugase, liga | 98.88 | |
| 4ds2_A | 167 | Ubiquitin-conjugating enzyme E2, putative; structu | 98.86 | |
| 1zuo_A | 186 | Hypothetical protein LOC92912; ligase, ubiquitin-c | 98.86 | |
| 1wjn_A | 97 | Tubulin-folding protein TBCE; ubiquitin-like domai | 98.78 | |
| 3kyd_D | 115 | Small ubiquitin-related modifier 1; SUMO, thioeste | 98.36 | |
| 3pge_A | 200 | SUMO-modified proliferating cell nuclear antigen; | 98.32 | |
| 3tix_A | 207 | Ubiquitin-like protein SMT3, RNA-induced transcri | 98.22 | |
| 2z6o_A | 172 | UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p | 98.15 | |
| 2pjh_A | 80 | Protein NPL4, nuclear protein localization protein | 98.13 | |
| 3v7o_A | 227 | Minor nucleoprotein VP30; ssgcid, seattle structur | 97.94 | |
| 4efo_A | 94 | Serine/threonine-protein kinase TBK1; ubiquitin li | 97.88 | |
| 3goe_A | 82 | DNA repair protein RAD60; SUMO-like domain, sumoyl | 97.87 | |
| 2jxx_A | 97 | Nfatc2-interacting protein; nuclear factor of acti | 97.53 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 97.36 | |
| 2al3_A | 90 | TUG long isoform; TUG UBL1 insulin, endocytosis/ex | 97.21 | |
| 3ix6_A | 360 | TS, tsase, thymidylate synthase; niaid, ssgcid, se | 97.17 | |
| 2l76_A | 95 | Nfatc2-interacting protein; ubiquitin-like domain, | 97.04 | |
| 2kc2_A | 128 | Talin-1, F1; FERM, adhesion, cell membrane, cell p | 96.82 | |
| 3kpa_A | 168 | Probable ubiquitin fold modifier conjugating ENZY; | 96.48 | |
| 4da1_A | 389 | Protein phosphatase 1K, mitochondrial; metal-ION-a | 96.41 | |
| 3qx1_A | 84 | FAS-associated factor 1; UBX, protein binding, P97 | 96.29 | |
| 2bps_A | 81 | YUKD protein; ubiquitin-like protein, ubiquitin; 2 | 96.28 | |
| 2dzk_A | 109 | UBX domain-containing protein 2; ubiquitin-like fo | 95.58 | |
| 1wj4_A | 124 | KIAA0794 protein; UBX domain, beta-grAsp fold, str | 94.84 | |
| 2l32_A | 74 | Small archaeal modifier protein 2; protein BIN; NM | 93.43 | |
| 2cr5_A | 109 | Reproduction 8; UBX domain, D0H8S2298E protein, st | 93.03 | |
| 1ryj_A | 70 | Unknown; beta/alpha protein, structural genomics, | 92.56 | |
| 1s3s_G | 127 | P47 protein; AAA ATPase, protein-protein complex, | 92.49 | |
| 4e71_A | 111 | Plexin-B2, MM1; transmembrane, signaling, RBD, str | 91.72 | |
| 2daj_A | 91 | KIAA0977 protein, COBL-like 1; ubiquitin-like doma | 88.62 | |
| 3r3q_A | 162 | Suppressor protein STP22 of temperature-sensitive | 88.07 | |
| 2r2o_A | 138 | Plexin-B1; effector domain, structural genomics, s | 87.94 | |
| 3h6n_A | 127 | Plexin-D1; structural genomics consortium, SGC, me | 87.89 | |
| 3jyu_A | 231 | Ubiquitin carboxyl-terminal hydrolase; domain in u | 87.32 | |
| 1vjk_A | 98 | Molybdopterin converting factor, subunit 1; struct | 87.17 | |
| 1oey_A | 83 | P67-PHOX, neutrophil cytosol factor 2; immune syst | 86.3 | |
| 3obq_A | 146 | Tumor susceptibility gene 101 protein; protein tra | 86.13 | |
| 4a3p_A | 217 | Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H | 84.17 | |
| 4e74_A | 117 | Plexin-A4; RBD, structural genomics, structural ge | 83.35 | |
| 1tyg_B | 87 | YJBS; alpha beta barrel, protein-protein complex, | 82.4 | |
| 3hjl_A | 329 | Flagellar motor switch protein FLIG; armadillo rep | 82.23 | |
| 3rpf_C | 74 | Molybdopterin converting factor, subunit 1 (MOAD); | 82.06 | |
| 1wgk_A | 114 | Riken cDNA 2900073H19 protein; THis domain, ubiqut | 80.8 | |
| 3ivf_A | 371 | Talin-1; FERM domain, cell membrane, cell projecti | 80.19 |
| >3gvo_A Pumilio 2, pumilio homolog 2; RNA-binding, PUF domain, RNA binding protein; HET: DTD; 1.60A {Mus musculus} SCOP: a.118.1.8 PDB: 3gvt_A 3q0q_A 3q0r_A 3q0s_A 1ib2_A 1m8w_A 1m8x_A 1m8y_A 1m8z_A 3q0l_A 3q0m_A 3q0n_A 3q0o_A 3q0p_A 2yjy_A 3bsx_A 3bsb_A 3h3d_X | Back alignment and structure |
|---|
Probab=100.00 E-value=2.4e-46 Score=414.34 Aligned_cols=306 Identities=17% Similarity=0.250 Sum_probs=274.1
Q ss_pred CccccccCCchHHHHhhhhcCCHHHHHHHHHHHhHHHHHhhcCcchhHHHHHHHhcCCHHHHHHHHHHHhHHHHHHhhCc
Q psy15035 1 MGQIVFSHDMSRIIQWLLKLSSPQMKKDIVKELLPFTVAMIKSKYSNALVKHMLKSGDENTKNEIIKALQPHVVTLLSHT 80 (816)
Q Consensus 1 i~~l~~~hd~sRvIQ~~lk~gt~eqR~~I~~EL~~~i~eL~~d~yg~~vVQKlL~~gs~eqr~~Ii~e~~g~v~~L~~h~ 80 (816)
|+++|++|+|||+||++|+++++++|+.||+|+.+++++||+|+||||||||+|+||+++||..|+++++|++++|+.|+
T Consensus 28 i~~la~dq~gsR~lQ~~l~~~~~~~~~~i~~ei~~~~~~L~~d~~gn~vvQklle~~~~~~~~~i~~~i~g~~~~l~~~~ 107 (351)
T 3gvo_A 28 IVEFSQDQHGSRFIQQKLERATPAERQIVFNEILQAAYQLMTDVFGNYVIQKFFEFGSLDQKLALATRIRGHVLPLALQM 107 (351)
T ss_dssp HHHHHTSHHHHHHHHHHHHHCCHHHHHHHHHHHGGGHHHHHTSTTHHHHHHHHHHHCCHHHHHHHHHHHTTCHHHHHTST
T ss_pred HHHHhcCCcchHHHHHHHhhCCHHHHHHHHHHHHHhHHHHHhChhhhHHHHHHHhhCCHHHHHHHHHHHHhhHHHHhhCH
Confidence 46789999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CchHHHHHHHHhcCCHHHHHHHHHHHhcCcceeeccC-CcchhHHhhcC-ChhHHHHHHHHHHHHHHHhhhhhcccCCcc
Q psy15035 81 TASPVLMYAHDQVASPAQKLAMRQELYGGLYESTGDK-KINCLGDIFEQ-SPEMKTAILSVTKKTILKSLQKTQVTGSAL 158 (816)
Q Consensus 81 ~G~~VVqk~~~~~at~eQr~~Li~e~yg~~~~l~kd~-~~~~l~~ile~-~pekk~~Il~~l~~~l~~lv~K~~~~~~~i 158 (816)
|||+|||++| ++++.+|+..|++||+|+.+.|++|. |++++|++++. .|+++..|++.+.+++..+... ..|+.+
T Consensus 108 ~G~rvvQk~l-e~~~~~~~~~i~~el~~~~~~L~~d~~Gn~ViQk~l~~~~~~~~~~i~~~~~~~~~~ls~~--~~G~~V 184 (351)
T 3gvo_A 108 YGCRVIQKAL-ESISSDQQSEMVKELDGHVLKCVKDQNGNHVVQKCIECVQPQSLQFIIDAFKGQVFVLSTH--PYGCRV 184 (351)
T ss_dssp THHHHHHHHH-HHSCHHHHHHHHGGGTTCHHHHHHSTTHHHHHHHHHHHSCGGGTHHHHHHTTTTHHHHHTS--TTHHHH
T ss_pred HhHHHHHHHH-HhCCHHHHHHHHHHhhhhHHHHHHhhhhhHHHHHHHHhCCHHHHHHHHHHHHHHHHHHHhC--cHhHHH
Confidence 9999999999 58889999999999999999999998 99999999996 6889999999999988877765 455444
Q ss_pred hhhhHHHhhhcCCChhhHHHHHHHhCCCCccccccCcChHHHHHHHHhhcCHHHHHHHHHHHHHHHHHHhhCcCchHHHH
Q psy15035 159 LHAVLLDFISHSSDSPDLMEVLEMLAPLPLLPFVHSKAGASVAMHIIWNATNKLKKKIVKELKGHLREVATSEFGHLVLV 238 (816)
Q Consensus 159 vh~vl~ey~~~~~~~~~~~~iie~l~~~~l~~L~~tk~Gs~Vv~~cl~~~~~kdRk~Iik~lk~~v~~La~d~~G~~Vlq 238 (816)
++.++..+++ +++..+++.|.++ +..|+++++||+|+|+||+++++++|+.|++.+++++..|++|+||++|++
T Consensus 185 ----vq~~le~~~~-~~~~~ii~~l~~~-~~~L~~d~~Gn~ViQ~~l~~~~~~~~~~i~~~l~~~~~~Ls~~k~gs~Vve 258 (351)
T 3gvo_A 185 ----IQRILEHCTA-EQTLPILEELHQH-TEQLVQDQYGNYVIQHVLEHGRPEDKSKIVSEIRGKVLALSQHKFASNVVE 258 (351)
T ss_dssp ----HHHHHHHSCH-HHHHHHHHHHHTT-HHHHHTSTTHHHHHHHHHHHSCHHHHHHHHHTTTTCHHHHHTSTTHHHHHH
T ss_pred ----HHHHHHHCCH-HHHHHHHHHHhhh-HHhcCCCchHHHHHHHHHHhCchhhHHHHHHHHHHHHHHHhcCcHHHHHHH
Confidence 4555566777 9999999999999 999999999999999999999999999999999999999999999999999
Q ss_pred HHHccCCchHHHHHHHHHHHHH-------hHHhHhcChhhHHHHHHhhccCCCCCcCHHHHHhhccCCccccCCCCHHHH
Q psy15035 239 TLLDNVDDTLLLKKALLPELLA-------EVVPLANHEYGRKVIAHLVSWCDPGFFHPTCIAHVKSGDEFSTSKKDRDIR 311 (816)
Q Consensus 239 ~~l~~~DDt~l~~k~Iv~eL~~-------~l~~L~~d~yG~~Vl~~Ll~~~~~~~f~~~i~~~L~~~~~~~~sKKd~~~R 311 (816)
+||++.++. .++.|+.+|.. .+..|+.|+||+|||+++|+..+ ++.
T Consensus 259 k~l~~~~~~--~r~~ii~el~~~~~~~~~~l~~l~~d~ygnyViq~~L~~~~------------------------~~~- 311 (351)
T 3gvo_A 259 KCVTHASRA--ERALLIDEVCCQNDGPHSALYTMMKDQYANYVVQKMIDMAE------------------------PAQ- 311 (351)
T ss_dssp HHHHHSCHH--HHHHHHHHHHSCEETTEEHHHHHHHSTTHHHHHHHHHHHCC------------------------HHH-
T ss_pred HHHHhCCHH--HHHHHHHHHhcccCCCChHHHHccCCcchHHHHHHHHHhCC------------------------HHH-
Confidence 999998765 47889999986 79999999999999999997543 222
Q ss_pred HHHHHHhhchhHHHHHHhcHHHHHccCChhHHHHHHHhc
Q psy15035 312 NKEILEAVSEPLLSSIAKDADFWLSTGSVAMVTAVILKN 350 (816)
Q Consensus 312 r~EL~~~~~~~Ll~~i~~~~~~ll~d~~g~~vv~~iL~~ 350 (816)
|+. +++.+..++..|..+++|..|+..+.+.
T Consensus 312 r~~--------i~~~i~~~~~~L~~~~~g~~i~~kl~~~ 342 (351)
T 3gvo_A 312 RKI--------IMHKIRPHITTLRKYTYGKHILAKLEKY 342 (351)
T ss_dssp HHH--------HHHHHGGGHHHHTTSTTTHHHHHHHHHH
T ss_pred HHH--------HHHHHHHHHHHHhcCCchHHHHHHHHHH
Confidence 233 4444555678888999999998776554
|
| >3k49_A MRNA-binding protein PUF3; PUF3, pumilio, RNA binding, mitochondrial mRNA,, membrane, mitochondrion; HET: CIT; 2.50A {Saccharomyces cerevisiae} SCOP: a.118.1.0 PDB: 3k4e_A | Back alignment and structure |
|---|
| >3bwt_A Protein PUF4; pumilio, RNA binding, HO endonuclease, transcription, RNA binding protein; 2.69A {Saccharomyces cerevisiae} PDB: 4dzs_A 3bx2_A 3bx3_A | Back alignment and structure |
|---|
| >3k62_A FEM-3 mRNA-binding factor 2; FBF, FEM-3 binding factor, PUF, RNA-binding specificity, base flipping, base stacking; 1.90A {Caenorhabditis elegans} PDB: 3k5y_A 3k5z_A 3k61_A 3k5q_A 3k64_A 3qg9_A 3v6y_A 3v74_A 3qgc_A 3qgb_A | Back alignment and structure |
|---|
| >3v71_A PUF (pumilio/FBF) domain-containing protein 7, CO transcript evidence; PUF repeats, RNA binding protein-RNA complex; HET: EPE; 2.90A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3gvo_A Pumilio 2, pumilio homolog 2; RNA-binding, PUF domain, RNA binding protein; HET: DTD; 1.60A {Mus musculus} SCOP: a.118.1.8 PDB: 3gvt_A 3q0q_A 3q0r_A 3q0s_A 1ib2_A 1m8w_A 1m8x_A 1m8y_A 1m8z_A 3q0l_A 3q0m_A 3q0n_A 3q0o_A 3q0p_A 2yjy_A 3bsx_A 3bsb_A 3h3d_X | Back alignment and structure |
|---|
| >3bwt_A Protein PUF4; pumilio, RNA binding, HO endonuclease, transcription, RNA binding protein; 2.69A {Saccharomyces cerevisiae} PDB: 4dzs_A 3bx2_A 3bx3_A | Back alignment and structure |
|---|
| >3k49_A MRNA-binding protein PUF3; PUF3, pumilio, RNA binding, mitochondrial mRNA,, membrane, mitochondrion; HET: CIT; 2.50A {Saccharomyces cerevisiae} SCOP: a.118.1.0 PDB: 3k4e_A | Back alignment and structure |
|---|
| >3v71_A PUF (pumilio/FBF) domain-containing protein 7, CO transcript evidence; PUF repeats, RNA binding protein-RNA complex; HET: EPE; 2.90A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3k62_A FEM-3 mRNA-binding factor 2; FBF, FEM-3 binding factor, PUF, RNA-binding specificity, base flipping, base stacking; 1.90A {Caenorhabditis elegans} PDB: 3k5y_A 3k5z_A 3k61_A 3k5q_A 3k64_A 3qg9_A 3v6y_A 3v74_A 3qgc_A 3qgb_A | Back alignment and structure |
|---|
| >3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f | Back alignment and structure |
|---|
| >3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A | Back alignment and structure |
|---|
| >4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B | Back alignment and structure |
|---|
| >4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A | Back alignment and structure |
|---|
| >2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I | Back alignment and structure |
|---|
| >3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A | Back alignment and structure |
|---|
| >4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A | Back alignment and structure |
|---|
| >2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... | Back alignment and structure |
|---|
| >2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B | Back alignment and structure |
|---|
| >1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C | Back alignment and structure |
|---|
| >3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B | Back alignment and structure |
|---|
| >1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A | Back alignment and structure |
|---|
| >1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A | Back alignment and structure |
|---|
| >3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B | Back alignment and structure |
|---|
| >1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 | Back alignment and structure |
|---|
| >2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B | Back alignment and structure |
|---|
| >1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A | Back alignment and structure |
|---|
| >3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A | Back alignment and structure |
|---|
| >2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* | Back alignment and structure |
|---|
| >2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A | Back alignment and structure |
|---|
| >1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} | Back alignment and structure |
|---|
| >2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S | Back alignment and structure |
|---|
| >2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A | Back alignment and structure |
|---|
| >3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p | Back alignment and structure |
|---|
| >2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C | Back alignment and structure |
|---|
| >1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B | Back alignment and structure |
|---|
| >4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A | Back alignment and structure |
|---|
| >1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A | Back alignment and structure |
|---|
| >1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
| >2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} | Back alignment and structure |
|---|
| >2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A | Back alignment and structure |
|---|
| >2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A | Back alignment and structure |
|---|
| >2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A | Back alignment and structure |
|---|
| >3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A | Back alignment and structure |
|---|
| >2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B | Back alignment and structure |
|---|
| >2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A | Back alignment and structure |
|---|
| >1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A | Back alignment and structure |
|---|
| >2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A | Back alignment and structure |
|---|
| >2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A | Back alignment and structure |
|---|
| >4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... | Back alignment and structure |
|---|
| >2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A | Back alignment and structure |
|---|
| >3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A | Back alignment and structure |
|---|
| >1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 | Back alignment and structure |
|---|
| >2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F | Back alignment and structure |
|---|
| >2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A | Back alignment and structure |
|---|
| >2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A | Back alignment and structure |
|---|
| >2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A | Back alignment and structure |
|---|
| >3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A | Back alignment and structure |
|---|
| >1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B | Back alignment and structure |
|---|
| >3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* | Back alignment and structure |
|---|
| >1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A | Back alignment and structure |
|---|
| >2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A | Back alignment and structure |
|---|
| >1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C | Back alignment and structure |
|---|
| >2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A | Back alignment and structure |
|---|
| >2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C | Back alignment and structure |
|---|
| >4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A | Back alignment and structure |
|---|
| >1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A | Back alignment and structure |
|---|
| >2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} | Back alignment and structure |
|---|
| >4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} | Back alignment and structure |
|---|
| >3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* | Back alignment and structure |
|---|
| >2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* | Back alignment and structure |
|---|
| >2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 | Back alignment and structure |
|---|
| >4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A | Back alignment and structure |
|---|
| >3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A | Back alignment and structure |
|---|
| >2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A | Back alignment and structure |
|---|
| >1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} | Back alignment and structure |
|---|
| >2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 | Back alignment and structure |
|---|
| >1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A | Back alignment and structure |
|---|
| >4e71_A Plexin-B2, MM1; transmembrane, signaling, RBD, structural genomics consortium, SGC, signaling protein; 2.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3r3q_A Suppressor protein STP22 of temperature-sensitive factor receptor and arginine permease...; endosomal sorting, ESCRT-I; 1.45A {Saccharomyces cerevisiae} SCOP: d.20.1.2 PDB: 3r42_A 1uzx_A* | Back alignment and structure |
|---|
| >2r2o_A Plexin-B1; effector domain, structural genomics, structural GEN consortium, SGC, glycoprotein, membrane, phosphorylation, R secreted, transmembrane; 2.00A {Homo sapiens} PDB: 2rex_A* 2jph_A | Back alignment and structure |
|---|
| >3h6n_A Plexin-D1; structural genomics consortium, SGC, membrane, transmembrane, receptor, alternative splicing, cell membrane, glycoprotein, polymorphism; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} | Back alignment and structure |
|---|
| >1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 | Back alignment and structure |
|---|
| >1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 | Back alignment and structure |
|---|
| >3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} SCOP: d.20.1.2 PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A | Back alignment and structure |
|---|
| >4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A | Back alignment and structure |
|---|
| >4e74_A Plexin-A4; RBD, structural genomics, structural genomics consor SGC, signaling protein; 1.58A {Homo sapiens} PDB: 3q3j_A* | Back alignment and structure |
|---|
| >1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 | Back alignment and structure |
|---|
| >3hjl_A Flagellar motor switch protein FLIG; armadillo repeat motif, superhelix, conformational plasticit repeat, torque generation; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1wgk_A Riken cDNA 2900073H19 protein; THis domain, ubiqutin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.3.3 PDB: 1xo3_A | Back alignment and structure |
|---|
| >3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 816 | ||||
| d1m8za_ | 339 | a.118.1.8 (A:) Pumilio 1 {Human (Homo sapiens) [Ta | 9e-23 | |
| d1m8za_ | 339 | a.118.1.8 (A:) Pumilio 1 {Human (Homo sapiens) [Ta | 6e-04 | |
| d1jatb_ | 136 | d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {B | 1e-18 | |
| d2a4da1 | 139 | d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, | 6e-18 | |
| d1wx9a1 | 73 | d.15.1.1 (A:8-80) Large proline-rich protein BAT3 | 2e-11 | |
| d2zeqa1 | 78 | d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin | 4e-11 | |
| d1z2ma2 | 76 | d.15.1.1 (A:79-154) Interferon-induced 15 kDa prot | 8e-11 | |
| d2bwfa1 | 73 | d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyc | 1e-10 | |
| d1bt0a_ | 73 | d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis t | 3e-10 | |
| d1wh3a_ | 87 | d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like | 7e-10 | |
| d1ttna1 | 80 | d.15.1.1 (A:21-100) Dendritic cell-derived ubiquit | 8e-10 | |
| d1ogwa_ | 76 | d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [Tax | 1e-09 | |
| d1oqya4 | 77 | d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 h | 6e-09 | |
| d1euvb_ | 79 | d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yea | 9e-09 | |
| d1uela_ | 95 | d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homol | 1e-08 | |
| d1wiaa_ | 95 | d.15.1.1 (A:) Ubiquitin-like protein bab25500 (201 | 2e-08 | |
| d1wgda_ | 93 | d.15.1.1 (A:) Homocysteine-responsive endoplasmic | 2e-08 | |
| d1wgha_ | 116 | d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mous | 5e-08 | |
| d1zkha1 | 86 | d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-t | 7e-08 | |
| d1z2ma1 | 76 | d.15.1.1 (A:3-78) Interferon-induced 15 kDa protei | 4e-07 | |
| d1wy8a1 | 76 | d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING fing | 4e-07 | |
| d1v2ya_ | 105 | d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik | 6e-07 | |
| d1wgga_ | 96 | d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolas | 8e-07 | |
| d1uh6a_ | 100 | d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mous | 1e-06 | |
| d1v5ta_ | 90 | d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus mu | 2e-06 | |
| d2faza1 | 76 | d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING fing | 2e-06 | |
| d1wjua_ | 100 | d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human | 2e-06 | |
| d1se9a_ | 101 | d.15.1.1 (A:) Hypothetical protein At3g01050 {Thal | 7e-06 | |
| d1we6a_ | 111 | d.15.1.1 (A:) Splicing factor 3 subunit 1, C-termi | 7e-06 | |
| d2c9wb1 | 103 | d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) | 8e-06 | |
| d1x1ma1 | 94 | d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse | 1e-05 | |
| d1v6ea_ | 95 | d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol | 2e-05 | |
| d1j8ca_ | 103 | d.15.1.1 (A:) Ubiquitin-like N-terminal domain of | 2e-04 | |
| d1fzya_ | 149 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B | 7e-04 | |
| d1t0ya_ | 90 | d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol | 0.001 |
| >d1m8za_ a.118.1.8 (A:) Pumilio 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 339 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: Pumilio repeat domain: Pumilio 1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 98.3 bits (244), Expect = 9e-23
Identities = 55/295 (18%), Positives = 116/295 (39%), Gaps = 23/295 (7%)
Query: 2 GQIV-FSHD--MSRIIQWLLKLSSPQMKKDIVKELLPFTVAMIKSKYSNALVKHMLKSGD 58
G I+ FS D SR IQ L+ ++P ++ + E+L ++ + N +++ + G
Sbjct: 24 GHIMEFSQDQHGSRFIQLKLERATPAERQLVFNEILQAAYQLMVDVFGNYVIQKFFEFGS 83
Query: 59 ENTKNEIIKALQPHVVTLLSHTTASPVLMYAHDQVASPAQKLAMRQELYGGLYESTGDKK 118
K + + ++ HV++L V+ A + Q+ M +EL G + + D+
Sbjct: 84 LEQKLALAERIRGHVLSLALQMYGCRVIQKA-LEFIPSDQQNEMVRELDGHVLKCVKDQN 142
Query: 119 INCLGD--IFEQSPEMKTAILSVTKKTILKSLQKTQVTGSALLHAVLLDFISHSSDSPDL 176
N + I P+ I+ K + V+ + H
Sbjct: 143 GNHVVQKCIECVQPQSLQFIIDAFKGQVFALSTHPYG------CRVIQRILEHCLP-DQT 195
Query: 177 MEVLEMLAPLPLLPFVHSKAGASVAMHIIWNATNKLKKKIVKELKGHLREVATSEFGHLV 236
+ +LE L V + G V H++ + + K KIV E++G++ ++ +F V
Sbjct: 196 LPILEELHQH-TEQLVQDQYGNYVIQHVLEHGRPEDKSKIVAEIRGNVLVLSQHKFASNV 254
Query: 237 LVTLLDNVDDTLLLKKALLPELLAE-------VVPLANHEYGRKVIAHLVSWCDP 284
+ + + T + L+ E+ + + +Y V+ ++ +P
Sbjct: 255 VEKCVTHASRT--ERAVLIDEVCTMNDGPHSALYTMMKDQYANYVVQKMIDVAEP 307
|
| >d1m8za_ a.118.1.8 (A:) Pumilio 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 339 | Back information, alignment and structure |
|---|
| >d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Length = 136 | Back information, alignment and structure |
|---|
| >d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 | Back information, alignment and structure |
|---|
| >d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 | Back information, alignment and structure |
|---|
| >d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 | Back information, alignment and structure |
|---|
| >d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Length = 79 | Back information, alignment and structure |
|---|
| >d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 | Back information, alignment and structure |
|---|
| >d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 116 | Back information, alignment and structure |
|---|
| >d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 105 | Back information, alignment and structure |
|---|
| >d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 | Back information, alignment and structure |
|---|
| >d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 | Back information, alignment and structure |
|---|
| >d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 | Back information, alignment and structure |
|---|
| >d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 101 | Back information, alignment and structure |
|---|
| >d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 111 | Back information, alignment and structure |
|---|
| >d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 | Back information, alignment and structure |
|---|
| >d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Length = 149 | Back information, alignment and structure |
|---|
| >d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 90 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 816 | |||
| d1m8za_ | 339 | Pumilio 1 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1m8za_ | 339 | Pumilio 1 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2zeqa1 | 78 | Ubiquitin-like domain of parkin {Mouse (Mus muscul | 99.79 | |
| d1ogwa_ | 76 | Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | 99.78 | |
| d1wh3a_ | 87 | 2'-5'-oligoadenylate synthetase-like protein, OASL | 99.77 | |
| d1bt0a_ | 73 | Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI | 99.76 | |
| d1z2ma2 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 99.74 | |
| d2faza1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 99.72 | |
| d1wx9a1 | 73 | Large proline-rich protein BAT3 {Human (Homo sapie | 99.7 | |
| d1ttna1 | 80 | Dendritic cell-derived ubiquitin-like protein {Hum | 99.69 | |
| d1wy8a1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 99.69 | |
| d1uela_ | 95 | Ubiquitin-like domain of Rad23 homolog B (Hhr23B) | 99.68 | |
| d1m94a_ | 73 | Ubiquitin-like modifier protein hub1 {Baker's yeas | 99.66 | |
| d2bwfa1 | 73 | DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.65 | |
| d1yqba1 | 84 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.64 | |
| d1z2ma1 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 99.64 | |
| d1oqya4 | 77 | Ubiquitin-like domain of Rad23 homolog A (Hhr23a) | 99.63 | |
| d1jatb_ | 136 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 99.63 | |
| d2a4da1 | 139 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.62 | |
| d1zkha1 | 86 | Splicing factor 3 subunit 1, C-terminal domain {Hu | 99.58 | |
| d1v5oa_ | 102 | 1700011n24rik protein {Mouse (Mus musculus) [TaxId | 99.58 | |
| d1uh6a_ | 100 | Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu | 99.58 | |
| d1v2ya_ | 105 | Ubiquitin-like protein 3300001g02rik {Mouse (Mus m | 99.58 | |
| d1we6a_ | 111 | Splicing factor 3 subunit 1, C-terminal domain {Th | 99.57 | |
| d1wiaa_ | 95 | Ubiquitin-like protein bab25500 (2010008E23Rik) {M | 99.57 | |
| d1wgha_ | 116 | Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu | 99.56 | |
| d1j8ca_ | 103 | Ubiquitin-like N-terminal domain of PLIC-2 {Human | 99.56 | |
| d1wx8a1 | 83 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 99.56 | |
| d1se9a_ | 101 | Hypothetical protein At3g01050 {Thale cress (Arabi | 99.54 | |
| d1wgga_ | 96 | Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M | 99.53 | |
| d1wjua_ | 100 | NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens | 99.52 | |
| d2c9wb1 | 103 | Elongin B {Human (Homo sapiens) [TaxId: 9606]} | 99.45 | |
| d1v5ta_ | 90 | 8430435i17rik protein {Mouse (Mus musculus) [TaxId | 99.45 | |
| d1v86a_ | 95 | hypothetical D7wsu128e protein {Mouse (Mus musculu | 99.44 | |
| d1wgda_ | 93 | Homocysteine-responsive endoplasmic reticulum-resi | 99.44 | |
| d1wxva1 | 81 | Bag-family molecular chaperone regulator-1 {Human | 99.4 | |
| d2a7la1 | 117 | Ubiquitin-protein ligase W (E2 W) {Human (Homo sap | 99.29 | |
| d1v6ea_ | 95 | Ubiquitin-like domain of tubulin folding cofactor | 99.29 | |
| d2awfa1 | 125 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.28 | |
| d1fzya_ | 149 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 99.28 | |
| d2fo3a1 | 109 | Putative ubiquitin-conjugating enzyme, E2 domain { | 99.26 | |
| d1yh2a1 | 154 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.22 | |
| d1euvb_ | 79 | SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy | 99.2 | |
| d1j7db_ | 149 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.19 | |
| d1z3da1 | 149 | Ubiquitin conjugating enzyme, UBC {Nematode (Caeno | 99.19 | |
| d1pzva_ | 161 | Ubiquitin conjugating enzyme, UBC {Nematode (Caeno | 99.19 | |
| d2e2ca_ | 156 | Ubiquitin conjugating enzyme, UBC {Clam (Spisula s | 99.18 | |
| d2ucza_ | 164 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 99.16 | |
| d2f4wa1 | 157 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.16 | |
| d1i7ka_ | 146 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.14 | |
| d2f4za1 | 161 | Hypothetical protein Tgtwinscan_2721, E2 domain {T | 99.13 | |
| d1c4zd_ | 144 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.11 | |
| d1yrva1 | 148 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.11 | |
| d1jata_ | 152 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 99.1 | |
| d1ayza_ | 153 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 99.08 | |
| d1zdna1 | 151 | Ubiquitin conjugating enzyme, UBC {Human(Homo sapi | 99.08 | |
| d1y6la_ | 148 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.07 | |
| d2uyza1 | 156 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.06 | |
| d1z2ua1 | 147 | Ubiquitin conjugating enzyme, UBC {Caenorhabditis | 99.04 | |
| d1wjna_ | 97 | Tubulin-folding protein TbcE {Mouse (Mus musculus) | 99.02 | |
| d1t0ya_ | 90 | Ubiquitin-like domain of tubulin folding cofactor | 98.98 | |
| d1x1ma1 | 94 | Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta | 98.98 | |
| d2bepa1 | 154 | Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain | 98.95 | |
| d2uyzb1 | 77 | SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax | 98.93 | |
| d1wzva1 | 150 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 98.93 | |
| d2z5da1 | 152 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 98.85 | |
| d1y8xa1 | 157 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 98.85 | |
| d1zuoa1 | 162 | Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom | 98.82 | |
| d1yf9a1 | 158 | Ubiquitin conjugating enzyme, UBC {Leishmania majo | 98.71 | |
| d1wm3a_ | 72 | SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | 97.98 | |
| d1wf9a1 | 94 | NPL4-like protein 1 {Thale cress (Arabidopsis thal | 97.67 | |
| d2al3a1 | 76 | Tether containing UBX domain for GLUT4 (Tug) {Mous | 96.83 | |
| d1s1qa_ | 141 | Tumor susceptibility gene 101 (TSG101) {Human (Hom | 96.34 | |
| d1h8ca_ | 82 | Fas-associated factor 1, Faf1 {Human (Homo sapiens | 95.92 | |
| d1i42a_ | 89 | p47 {Rat (Rattus norvegicus) [TaxId: 10116]} | 94.24 | |
| d2cr5a1 | 96 | UBX domain-containing protein 6 (Reproduction 8) { | 93.78 | |
| d1wj4a_ | 124 | Hypothetical protein KIAA0794 {Human (Homo sapiens | 93.51 | |
| d1uzxa_ | 152 | Vacuolar protein sorting-associated {Baker's yeast | 83.58 | |
| d1vjka_ | 88 | Molybdopterin synthase subunit MoaD {Pyrococcus fu | 80.23 |
| >d1m8za_ a.118.1.8 (A:) Pumilio 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: Pumilio repeat domain: Pumilio 1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=6.4e-42 Score=373.72 Aligned_cols=302 Identities=17% Similarity=0.240 Sum_probs=268.6
Q ss_pred ccccccCCchHHHHhhhhcCCHHHHHHHHHHHhHHHHHhhcCcchhHHHHHHHhcCCHHHHHHHHHHHhHHHHHHhhCcC
Q psy15035 2 GQIVFSHDMSRIIQWLLKLSSPQMKKDIVKELLPFTVAMIKSKYSNALVKHMLKSGDENTKNEIIKALQPHVVTLLSHTT 81 (816)
Q Consensus 2 ~~l~~~hd~sRvIQ~~lk~gt~eqR~~I~~EL~~~i~eL~~d~yg~~vVQKlL~~gs~eqr~~Ii~e~~g~v~~L~~h~~ 81 (816)
.++|.+|+|||+||++|++|++++|+.||+||.|++.+||+|+|||||||||++||++++|..|++++.|++.+|+.|+|
T Consensus 27 ~~~~~~q~gSr~lQ~~l~~~~~~~~~~I~~~l~~~~~~L~~~~~gn~vvqkll~~~~~~~~~~i~~~l~~~~~~L~~~~~ 106 (339)
T d1m8za_ 27 MEFSQDQHGSRFIQLKLERATPAERQLVFNEILQAAYQLMVDVFGNYVIQKFFEFGSLEQKLALAERIRGHVLSLALQMY 106 (339)
T ss_dssp HHHHTSHHHHHHHHHHHHHCCHHHHHHHHHHHGGGHHHHHTSTTHHHHHHHHHHHSCHHHHHHHHHHHTTCHHHHHTSTT
T ss_pred HHHhcCchhhHHHHHHHhhCCHHHHHHHHHHHHHHHHHHhhCcccchhHHHHHhhCCHHHHHHHHHHHHhhHHHHhcccc
Confidence 57899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred chHHHHHHHHhcCCHHHHHHHHHHHhcCcceeeccC-CcchhHHhhcC-ChhHHHHHHHHHHHHHHHhhhhhcccCCcch
Q psy15035 82 ASPVLMYAHDQVASPAQKLAMRQELYGGLYESTGDK-KINCLGDIFEQ-SPEMKTAILSVTKKTILKSLQKTQVTGSALL 159 (816)
Q Consensus 82 G~~VVqk~~~~~at~eQr~~Li~e~yg~~~~l~kd~-~~~~l~~ile~-~pekk~~Il~~l~~~l~~lv~K~~~~~~~iv 159 (816)
|++|||++| +..+.+++..|++||+++...+++|. ++++++++++. .|+.+..|++.+.+.+..++.+ ...
T Consensus 107 gs~Vvq~l~-~~~~~~~~~~l~~el~~~~~~l~~d~~~~~v~~~~l~~~~~~~~~~i~~~~~~~~~~l~~~------~~g 179 (339)
T d1m8za_ 107 GCRVIQKAL-EFIPSDQQNEMVRELDGHVLKCVKDQNGNHVVQKCIECVQPQSLQFIIDAFKGQVFALSTH------PYG 179 (339)
T ss_dssp HHHHHHHHH-HHSCHHHHHHHHHTTTTCHHHHHHSTTHHHHHHHHHHHSCGGGGHHHHHHTTTTHHHHHTS------TTH
T ss_pred cchHHHhhh-ccCCHHHHHHHHHHHhhhhHHHhcCCCcchHHHHHHHhcCHHHHHHHHHHHHHHHHHHHhC------cch
Confidence 999999999 58888999999999999999999998 88999999987 5788899999999888777665 445
Q ss_pred hhhHHHhhhcCCChhhHHHHHHHhCCCCccccccCcChHHHHHHHHhhcCHHHHHHHHHHHHHHHHHHhhCcCchHHHHH
Q psy15035 160 HAVLLDFISHSSDSPDLMEVLEMLAPLPLLPFVHSKAGASVAMHIIWNATNKLKKKIVKELKGHLREVATSEFGHLVLVT 239 (816)
Q Consensus 160 h~vl~ey~~~~~~~~~~~~iie~l~~~~l~~L~~tk~Gs~Vv~~cl~~~~~kdRk~Iik~lk~~v~~La~d~~G~~Vlq~ 239 (816)
+++++.++..+++ +++..+++.+.++ +.+|+++++|++|++++|+++++++|+.|++.+++++.++++|+||++|+++
T Consensus 180 ~~vlq~~l~~~~~-~~~~~l~~~l~~~-~~~L~~~~~G~~vvq~~l~~~~~~~~~~i~~~l~~~~~~l~~~k~gS~vve~ 257 (339)
T d1m8za_ 180 CRVIQRILEHCLP-DQTLPILEELHQH-TEQLVQDQYGNYVIQHVLEHGRPEDKSKIVAEIRGNVLVLSQHKFASNVVEK 257 (339)
T ss_dssp HHHHHHHHHHSCH-HHHHHHHHHHHHT-HHHHTTSTTHHHHHHHHHHHSCHHHHHHHHHHHTTCHHHHHTSTTHHHHHHH
T ss_pred hHHHHHHHhcCCH-HHHHHHHHHHHHH-HHHHHhCccHHHHHHHHHHcCCHHHHHHHHHHHHhhHHHHHcchhHHHHHHH
Confidence 6667777788888 9999999999999 9999999999999999999999999999999999999999999999999999
Q ss_pred HHccCCchHHHHHHHHHHHHH-------hHHhHhcChhhHHHHHHhhccCCCCCcCHHHHHhhccCCccccCCCCHHHHH
Q psy15035 240 LLDNVDDTLLLKKALLPELLA-------EVVPLANHEYGRKVIAHLVSWCDPGFFHPTCIAHVKSGDEFSTSKKDRDIRN 312 (816)
Q Consensus 240 ~l~~~DDt~l~~k~Iv~eL~~-------~l~~L~~d~yG~~Vl~~Ll~~~~~~~f~~~i~~~L~~~~~~~~sKKd~~~Rr 312 (816)
++...++.. ++.++.++.. .+..|+.|+||++||+.+|+..+ ++. +
T Consensus 258 ~l~~~~~~~--~~~~~~~l~~~~~~~~~~l~~L~~d~~gn~Viq~~l~~~~------------------------~~~-~ 310 (339)
T d1m8za_ 258 CVTHASRTE--RAVLIDEVCTMNDGPHSALYTMMKDQYANYVVQKMIDVAE------------------------PGQ-R 310 (339)
T ss_dssp HHHHSCHHH--HHHHHHHHHHCEETTEEHHHHHHTSTTHHHHHHHHHHHSC------------------------HHH-H
T ss_pred HHHhCCHHH--HHHHHHHHHhcccCchHHHHHHHcCCcccHHHHHHHHhCC------------------------HHH-H
Confidence 999987664 5678888753 48899999999999999996532 112 2
Q ss_pred HHHHHhhchhHHHHHHhcHHHHHccCChhHHHHHH
Q psy15035 313 KEILEAVSEPLLSSIAKDADFWLSTGSVAMVTAVI 347 (816)
Q Consensus 313 ~EL~~~~~~~Ll~~i~~~~~~ll~d~~g~~vv~~i 347 (816)
.+|...+ ..+..+|..+++|..|++.+
T Consensus 311 ~~i~~~l--------~~~~~~L~~~~~G~~v~~~l 337 (339)
T d1m8za_ 311 KIVMHKI--------RPHIATLRKYTYGKHILAKL 337 (339)
T ss_dssp HHHHHTT--------GGGHHHHTTSSTHHHHHHHH
T ss_pred HHHHHHH--------HHHHHHHhcCCcHHHHHHHH
Confidence 3444444 44677888899999987654
|
| >d1m8za_ a.118.1.8 (A:) Pumilio 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} | Back information, alignment and structure |
|---|
| >d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} | Back information, alignment and structure |
|---|
| >d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|