Psyllid ID: psy15079

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70----
MTDAQVKTWFQNRRTKWRPFSFEGVSKSKHIVVRPLIDKVNLYVIEAVWTVLSALIDVNRWPVDQDFSNNQIDR
ccHHHHHHHHHHccccccccccccccccccEEcccEEcHHHHHHHHHHHHHHHHHHHccccccccccccccccc
ccHHHHHHHHHHHHHHccccccccccHcccEEEHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc
MTDAQVKTWFqnrrtkwrpfsfegvskskhivvrplidkVNLYVIEAVWTVLSALIdvnrwpvdqdfsnnqidr
mtdaqvktwfqnrrtkwrpfsfegvskskhivvrpliDKVNLYVIEAVWTVLSALIdvnrwpvdqdfsnnqidr
MTDAQVKTWFQNRRTKWRPFSFEGVSKSKHIVVRPLIDKVNLYVIEAVWTVLSALIDVNRWPVDQDFSNNQIDR
******KTWFQNRRTKWRPFSFEGVSKSKHIVVRPLIDKVNLYVIEAVWTVLSALIDVNRWPVD**********
***AQVKTWFQNRR*******************RPLIDKVNLYVIEAVWTVLSALIDVNRWPVDQDFS******
MTDAQVKTWFQNRRTKWRPFSFEGVSKSKHIVVRPLIDKVNLYVIEAVWTVLSALIDVNRWPVDQDFSNNQIDR
*TDAQVKTWFQNRRTKWRPFSFEGVSKSKHIVVRPLIDKVNLYVIEAVWTVLSALIDVNRWPVDQDFS******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTDAQVKTWFQNRRTKWRPFSFEGVSKSKHIVVRPLIDKVNLYVIEAVWTVLSALIDVNRWPVDQDFSNNQIDR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query74 2.2.26 [Sep-21-2011]
Q61663284 T-cell leukemia homeobox yes N/A 0.5 0.130 0.594 1e-05
O43763284 T-cell leukemia homeobox yes N/A 0.5 0.130 0.594 2e-05
P43345332 T-cell leukemia homeobox no N/A 0.243 0.054 1.0 3e-05
O93367297 T-cell leukemia homeobox yes N/A 0.243 0.060 1.0 4e-05
P31314330 T-cell leukemia homeobox no N/A 0.243 0.054 1.0 4e-05
O93366297 T-cell leukemia homeobox no N/A 0.243 0.060 1.0 5e-05
O55144291 T-cell leukemia homeobox no N/A 0.243 0.061 1.0 0.0001
O43711291 T-cell leukemia homeobox no N/A 0.243 0.061 1.0 0.0001
>sp|Q61663|TLX2_MOUSE T-cell leukemia homeobox protein 2 OS=Mus musculus GN=Tlx2 PE=2 SV=1 Back     alignment and function desciption
 Score = 48.1 bits (113), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 25/37 (67%)

Query: 1   MTDAQVKTWFQNRRTKWRPFSFEGVSKSKHIVVRPLI 37
           MTDAQVKTWFQNRRTKWR  + E     +H   R L+
Sbjct: 196 MTDAQVKTWFQNRRTKWRRQTAEEREAERHRAGRLLL 232
Transcription activator that binds DNA elements with the consensus sequence 5'-CGGTAATTGG-3'. Binds DNA via its homeobox. Required for normal cell death of enteric neurons in the gastrointestinal tract. Required for normal development of the enteric nervous system, and for proper development of normal motility of the gastrointestinal tract.
Mus musculus (taxid: 10090)
>sp|O43763|TLX2_HUMAN T-cell leukemia homeobox protein 2 OS=Homo sapiens GN=TLX2 PE=1 SV=2 Back     alignment and function description
>sp|P43345|TLX1_MOUSE T-cell leukemia homeobox protein 1 OS=Mus musculus GN=Tlx1 PE=1 SV=1 Back     alignment and function description
>sp|O93367|TLX3_CHICK T-cell leukemia homeobox protein 3 OS=Gallus gallus GN=TLX3 PE=2 SV=1 Back     alignment and function description
>sp|P31314|TLX1_HUMAN T-cell leukemia homeobox protein 1 OS=Homo sapiens GN=TLX1 PE=1 SV=1 Back     alignment and function description
>sp|O93366|TLX1_CHICK T-cell leukemia homeobox protein 1 OS=Gallus gallus GN=TLX1 PE=2 SV=1 Back     alignment and function description
>sp|O55144|TLX3_MOUSE T-cell leukemia homeobox protein 3 OS=Mus musculus GN=Tlx3 PE=2 SV=1 Back     alignment and function description
>sp|O43711|TLX3_HUMAN T-cell leukemia homeobox protein 3 OS=Homo sapiens GN=TLX3 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query74
297687228 336 PREDICTED: T-cell leukemia homeobox prot 0.513 0.113 0.578 0.0003
390474322 577 PREDICTED: uncharacterized protein LOC10 0.5 0.064 0.594 0.0004
426223981 284 PREDICTED: T-cell leukemia homeobox prot 0.5 0.130 0.594 0.0004
330864806 284 T-cell leukemia homeobox protein 2 [Bos 0.5 0.130 0.594 0.0004
311252341 284 PREDICTED: T-cell leukemia homeobox prot 0.5 0.130 0.594 0.0004
431920376 284 T-cell leukemia homeobox protein 2 [Pter 0.5 0.130 0.594 0.0004
395543194 286 PREDICTED: T-cell leukemia homeobox prot 0.5 0.129 0.594 0.0004
291386484 284 PREDICTED: T-cell leukemia, homeobox 2-l 0.5 0.130 0.594 0.0005
126332298 286 PREDICTED: t-cell leukemia homeobox prot 0.5 0.129 0.594 0.0005
6678367 284 T-cell leukemia homeobox protein 2 [Mus 0.5 0.130 0.594 0.0006
>gi|297687228|ref|XP_002821122.1| PREDICTED: T-cell leukemia homeobox protein 1 [Pongo abelii] Back     alignment and taxonomy information
 Score = 49.7 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 22/38 (57%), Positives = 26/38 (68%)

Query: 1   MTDAQVKTWFQNRRTKWRPFSFEGVSKSKHIVVRPLID 38
           MTDAQVKTWFQNRRTKWR  + E     +H   R L++
Sbjct: 246 MTDAQVKTWFQNRRTKWRRQTAEEREAERHQANRILLE 283

Source: Pongo abelii

Species: Pongo abelii

Genus: Pongo

Family: Hominidae

Order: Primates

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|390474322|ref|XP_002757665.2| PREDICTED: uncharacterized protein LOC100386232 [Callithrix jacchus] Back     alignment and taxonomy information
>gi|426223981|ref|XP_004006152.1| PREDICTED: T-cell leukemia homeobox protein 2 [Ovis aries] Back     alignment and taxonomy information
>gi|330864806|ref|NP_001179087.1| T-cell leukemia homeobox protein 2 [Bos taurus] gi|296482771|tpg|DAA24886.1| TPA: T-cell leukemia homeobox 2-like [Bos taurus] gi|440896446|gb|ELR48365.1| T-cell leukemia homeobox protein 2 [Bos grunniens mutus] Back     alignment and taxonomy information
>gi|311252341|ref|XP_003125043.1| PREDICTED: T-cell leukemia homeobox protein 2-like [Sus scrofa] Back     alignment and taxonomy information
>gi|431920376|gb|ELK18408.1| T-cell leukemia homeobox protein 2 [Pteropus alecto] Back     alignment and taxonomy information
>gi|395543194|ref|XP_003773505.1| PREDICTED: T-cell leukemia homeobox protein 2 [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|291386484|ref|XP_002709761.1| PREDICTED: T-cell leukemia, homeobox 2-like [Oryctolagus cuniculus] Back     alignment and taxonomy information
>gi|126332298|ref|XP_001376731.1| PREDICTED: t-cell leukemia homeobox protein 2-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|6678367|ref|NP_033418.1| T-cell leukemia homeobox protein 2 [Mus musculus] gi|6016286|sp|Q61663.1|TLX2_MOUSE RecName: Full=T-cell leukemia homeobox protein 2; AltName: Full=Enteric neuron homeobox protein; AltName: Full=Homeobox TLX-2; AltName: Full=Homeobox protein Hox-11L1; AltName: Full=Hox11L.1; AltName: Full=PMUR10F gi|193844|gb|AAA37805.1| homeobox protein [Mus musculus] gi|148666639|gb|EDK99055.1| T-cell leukemia, homeobox 2, isoform CRA_b [Mus musculus] gi|187950979|gb|AAI38242.1| T-cell leukemia, homeobox 2 [Mus musculus] gi|187951899|gb|AAI38241.1| T-cell leukemia, homeobox 2 [Mus musculus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query74
UNIPROTKB|F1NNC8141 TLX1 "T-cell leukemia homeobox 0.243 0.127 1.0 9e-06
UNIPROTKB|F1NVB2136 TLX3 "T-cell leukemia homeobox 0.243 0.132 1.0 9e-06
UNIPROTKB|F1MM89284 TLX2 "Uncharacterized protein" 0.5 0.130 0.594 1.1e-05
UNIPROTKB|O43763284 TLX2 "T-cell leukemia homeobox 0.5 0.130 0.594 1.1e-05
UNIPROTKB|F1SNT5284 TLX2 "Uncharacterized protein" 0.5 0.130 0.594 1.1e-05
MGI|MGI:1350935284 Tlx2 "T cell leukemia, homeobo 0.5 0.130 0.594 1.1e-05
RGD|1595506284 Tlx2 "T-cell leukemia homeobox 0.5 0.130 0.594 1.1e-05
ZFIN|ZDB-GENE-050417-212299 barhl1a "BarH-like 1a" [Danio 0.243 0.060 0.777 2.6e-05
UNIPROTKB|F1S8U3261 TLX1 "Uncharacterized protein" 0.243 0.068 1.0 3.3e-05
UNIPROTKB|E2R998284 TLX2 "Uncharacterized protein" 0.243 0.063 1.0 3.9e-05
UNIPROTKB|F1NNC8 TLX1 "T-cell leukemia homeobox protein 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 103 (41.3 bits), Expect = 9.0e-06, P = 9.0e-06
 Identities = 18/18 (100%), Positives = 18/18 (100%)

Query:     1 MTDAQVKTWFQNRRTKWR 18
             MTDAQVKTWFQNRRTKWR
Sbjct:    51 MTDAQVKTWFQNRRTKWR 68
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0007417 "central nervous system development" evidence=IEA
GO:0008284 "positive regulation of cell proliferation" evidence=IEA
GO:0030182 "neuron differentiation" evidence=IEA
GO:0045165 "cell fate commitment" evidence=IEA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA
GO:0046982 "protein heterodimerization activity" evidence=IEA
GO:0048536 "spleen development" evidence=IEA
GO:0048645 "organ formation" evidence=IEA
UNIPROTKB|F1NVB2 TLX3 "T-cell leukemia homeobox protein 3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MM89 TLX2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O43763 TLX2 "T-cell leukemia homeobox protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SNT5 TLX2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1350935 Tlx2 "T cell leukemia, homeobox 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1595506 Tlx2 "T-cell leukemia homeobox 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050417-212 barhl1a "BarH-like 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1S8U3 TLX1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R998 TLX2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q61663TLX2_MOUSENo assigned EC number0.59450.50.1302yesN/A
O43763TLX2_HUMANNo assigned EC number0.59450.50.1302yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query74
pfam0004657 pfam00046, Homeobox, Homeobox domain 4e-07
smart0038957 smart00389, HOX, Homeodomain 2e-05
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 5e-05
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 42.1 bits (100), Expect = 4e-07
 Identities = 12/18 (66%), Positives = 15/18 (83%)

Query: 1  MTDAQVKTWFQNRRTKWR 18
          +T+ QVK WFQNRR KW+
Sbjct: 39 LTERQVKVWFQNRRAKWK 56

Length = 57
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 74
KOG0489|consensus261 99.52
KOG0487|consensus308 99.43
KOG0492|consensus246 99.41
KOG0842|consensus307 99.39
KOG0488|consensus309 99.37
KOG0848|consensus317 99.37
KOG0485|consensus268 99.33
KOG0850|consensus245 99.29
KOG0484|consensus125 99.29
KOG0494|consensus332 99.19
KOG0843|consensus197 99.17
KOG0847|consensus288 99.01
KOG0483|consensus198 98.99
KOG2251|consensus228 98.85
KOG0491|consensus194 98.82
KOG0486|consensus 351 98.81
KOG0844|consensus 408 98.78
KOG0493|consensus342 98.61
KOG0490|consensus235 98.6
COG5576156 Homeodomain-containing transcription factor [Trans 98.54
KOG4577|consensus 383 98.53
PF0004657 Homeobox: Homeobox domain not present here.; Inter 98.33
cd0008659 homeodomain Homeodomain; DNA binding domains invol 97.93
KOG0849|consensus354 97.75
KOG0775|consensus304 95.59
KOG3802|consensus398 95.48
KOG0490|consensus235 95.25
KOG1168|consensus385 92.15
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 85.79
KOG1146|consensus 1406 83.13
>KOG0489|consensus Back     alignment and domain information 
Probab=99.52  E-value=7.6e-16  Score=104.80  Aligned_cols=27  Identities=44%  Similarity=0.828  Sum_probs=24.3

Q ss_pred             CCCCCceecCCCchhhhhhhcccCccc
Q psy15079          1 MTDAQVKTWFQNRRTKWRPFSFEGVSK   27 (74)
Q Consensus         1 L~e~qVqiWFQNRRaK~kr~~~~~~~~   27 (74)
                      |+|+|||||||||||||||..+.....
T Consensus       198 LtErQIKIWFQNRRMK~Kk~~k~~~~~  224 (261)
T KOG0489|consen  198 LTERQIKIWFQNRRMKWKKENKAKSSQ  224 (261)
T ss_pred             hhHHHHHHHHHHHHHHHHHhhcccccc
Confidence            899999999999999999997776665

>KOG0487|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query74
3a01_A93 Crystal Structure Of Aristaless And Clawless Homeod 4e-05
3a03_A56 Crystal Structure Of Hox11l1 Homeodomain Length = 5 5e-05
>pdb|3A01|A Chain A, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 93 Back     alignment and structure 
Iteration: 1

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 24/38 (63%)
Query: 1  MTDAQVKTWFQNRRTKWRPFSFEGVSKSKHIVVRPLID 38
          MTDAQVKTWFQNRRTKWR  + E     +    R ++ 
Sbjct: 56 MTDAQVKTWFQNRRTKWRRQTAEEREAERQAANRLMLS 93
>pdb|3A03|A Chain A, Crystal Structure Of Hox11l1 Homeodomain Length = 56 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query74
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 9e-09
3a01_A93 Homeodomain-containing protein; homeodomain, prote 3e-08
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 4e-08
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 6e-08
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 6e-08
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 8e-08
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 1e-07
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 1e-07
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 2e-07
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 2e-07
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 3e-07
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 1e-06
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 3e-06
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 1e-05
1e3o_C160 Octamer-binding transcription factor 1; transcript 2e-05
3d1n_I151 POU domain, class 6, transcription factor 1; prote 2e-05
2xsd_C164 POU domain, class 3, transcription factor 1; trans 3e-05
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 3e-05
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 5e-05
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 5e-05
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 6e-05
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 7e-05
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 7e-05
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 8e-05
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 1e-04
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 1e-04
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 1e-04
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 1e-04
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 1e-04
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-04
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 2e-04
1uhs_A72 HOP, homeodomain only protein; structural genomics 2e-04
3a02_A60 Homeobox protein aristaless; homeodomain, developm 2e-04
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 3e-04
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 3e-04
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 3e-04
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 3e-04
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 3e-04
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 3e-04
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 4e-04
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 4e-04
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 5e-04
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 5e-04
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 5e-04
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 6e-04
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 7e-04
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
 Score = 45.4 bits (108), Expect = 9e-09
 Identities = 18/18 (100%), Positives = 18/18 (100%)

Query: 1  MTDAQVKTWFQNRRTKWR 18
          MTDAQVKTWFQNRRTKWR
Sbjct: 36 MTDAQVKTWFQNRRTKWR 53
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query74
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 99.5
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.31
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.24
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.24
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.22
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.17
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.16
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.15
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.15
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.15
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.14
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.13
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.13
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.13
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.13
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.12
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.12
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.11
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.11
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.11
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.11
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.1
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.09
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.09
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.09
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.09
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.09
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.08
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.08
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.08
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.08
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.07
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.06
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.06
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.06
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.05
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.05
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.04
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.03
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.02
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.02
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.02
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.02
2e19_A64 Transcription factor 8; homeobox domain, structura 99.01
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.01
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.0
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 98.99
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 98.98
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 98.96
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 98.96
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 98.94
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 98.93
2xsd_C164 POU domain, class 3, transcription factor 1; trans 98.93
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 98.92
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 98.88
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 98.83
1lfb_A99 Liver transcription factor (LFB1); transcription r 98.79
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 98.65
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 98.48
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 98.38
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 98.12
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
Probab=99.50  E-value=2.9e-15  Score=74.48  Aligned_cols=21  Identities=52%  Similarity=1.072  Sum_probs=18.5

Q ss_pred             CCceecCCCchhhhhhhcccC
Q psy15079          4 AQVKTWFQNRRTKWRPFSFEG   24 (74)
Q Consensus         4 ~qVqiWFQNRRaK~kr~~~~~   24 (74)
                      +||+||||||||||||.+.+.
T Consensus         1 rQVkIWFQNRRaK~Kk~~~~~   21 (37)
T 2nzz_A            1 RQIKIWFQNRRMKWKKRVFND   21 (37)
T ss_dssp             CCTTTTTTCSHHHHTSSHHHH
T ss_pred             CCceeccHHHHHHHHHHhHHH
Confidence            589999999999999986653
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 74
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 2e-06
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 7e-06
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 8e-06
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 9e-06
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 1e-05
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 1e-05
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 1e-05
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 2e-05
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 3e-05
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 4e-05
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 5e-05
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 6e-05
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 6e-05
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 8e-05
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 9e-05
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 1e-04
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 2e-04
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 2e-04
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 3e-04
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 3e-04
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 3e-04
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 3e-04
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 4e-04
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 7e-04
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 0.001
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 0.001
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 0.002
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 0.003
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 0.004
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 0.004
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Lag1 longevity assurance homolog 6, LASS6
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 38.5 bits (90), Expect = 2e-06
 Identities = 5/19 (26%), Positives = 10/19 (52%)

Query: 1  MTDAQVKTWFQNRRTKWRP 19
               ++ WF+ RR + +P
Sbjct: 33 WDVRSIQRWFRQRRNQEKP 51
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query74
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.23
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.17
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.14
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.13
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.1
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.09
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.08
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.01
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 98.98
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 98.97
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 98.92
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 98.92
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 98.92
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 98.91
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 98.87
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 98.87
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 98.85
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 98.81
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 98.79
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 98.73
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 98.68
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 98.53
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 98.48
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Antennapedia Homeodomain
species: Drosophila melanogaster [TaxId: 7227]

Probab=99.23  E-value=8.7e-14  Score=73.49  Aligned_cols=20  Identities=55%  Similarity=1.130  Sum_probs=18.7

Q ss_pred             CCCCCceecCCCchhhhhhh
Q psy15079          1 MTDAQVKTWFQNRRTKWRPF   20 (74)
Q Consensus         1 L~e~qVqiWFQNRRaK~kr~   20 (74)
                      |++.+|+|||||||+|+||+
T Consensus        36 l~~~~V~iWFQNrRak~kk~   55 (56)
T d9anta_          36 LTERQIKIWFQNRRMKWKKE   55 (56)
T ss_dssp             CCHHHHHHHHHHHHHHHHHC
T ss_pred             CChhHeeeccccchhhhhhc
Confidence            78999999999999999986
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure