Psyllid ID: psy15128
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 292 | ||||||
| 328712717 | 1397 | PREDICTED: roundabout homolog 2-like [Ac | 0.667 | 0.139 | 0.688 | 3e-74 | |
| 242012205 | 999 | predicted protein [Pediculus humanus cor | 0.671 | 0.196 | 0.611 | 4e-62 | |
| 374637164 | 1055 | roundabout-like protein, partial [Tribol | 0.647 | 0.179 | 0.596 | 7e-59 | |
| 91079308 | 1073 | PREDICTED: similar to roundabout 1 [Trib | 0.647 | 0.176 | 0.596 | 8e-59 | |
| 270004828 | 949 | roundabout [Tribolium castaneum] | 0.647 | 0.199 | 0.596 | 9e-59 | |
| 158287827 | 726 | AGAP010970-PA [Anopheles gambiae str. PE | 0.681 | 0.274 | 0.532 | 4e-56 | |
| 312377932 | 324 | hypothetical protein AND_10634 [Anophele | 0.664 | 0.598 | 0.530 | 1e-54 | |
| 198456937 | 1398 | GA12341 [Drosophila pseudoobscura pseudo | 0.667 | 0.139 | 0.517 | 3e-53 | |
| 195150159 | 1362 | GL10711 [Drosophila persimilis] gi|19410 | 0.667 | 0.143 | 0.517 | 3e-53 | |
| 195487979 | 1436 | GE11841 [Drosophila yakuba] gi|194178222 | 0.667 | 0.135 | 0.507 | 5e-53 |
| >gi|328712717|ref|XP_001952693.2| PREDICTED: roundabout homolog 2-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 284 bits (727), Expect = 3e-74, Method: Compositional matrix adjust.
Identities = 135/196 (68%), Positives = 157/196 (80%), Gaps = 1/196 (0%)
Query: 2 ITEVKKSDEGKYQCYVQNMVGERETKPALLTVHAPPSFVVRPQDQKVGLNGIASFQCVAE 61
I V DEG Y C +N VG + K A LTVH+PP+FV RP+DQKVGLNGIA+F CVA+
Sbjct: 383 IINVIAQDEGLYVCNAENDVGSEKAK-ASLTVHSPPTFVTRPKDQKVGLNGIANFDCVAQ 441
Query: 62 GSPLPSVFWTQEGSQVLMFPGNAYGHLHVTQEGTLRIQGVQKEDAGFFVCSALSVAGSTT 121
G+P PSVFW++EGSQVLMFPGNAYGH HVTQ+GTLRIQG QKEDAGF VCSALSVAGS T
Sbjct: 442 GNPPPSVFWSREGSQVLMFPGNAYGHFHVTQDGTLRIQGAQKEDAGFLVCSALSVAGSVT 501
Query: 122 VRAFLQVTSVEDTPPPIVQVGPSNQTLPLHSVAFLPCQAVGSPPPHIRWYKNGNSLPPED 181
RAFLQVTSV+D PPP+V +GP+NQTL S A LPCQA G P P I+WY+NGN L P+D
Sbjct: 502 WRAFLQVTSVQDVPPPVVDIGPTNQTLATRSAATLPCQASGIPLPTIKWYRNGNYLSPDD 561
Query: 182 TRINVSSSGSLQIDVL 197
R+ ++SSG+LQID L
Sbjct: 562 PRVTITSSGTLQIDEL 577
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242012205|ref|XP_002426824.1| predicted protein [Pediculus humanus corporis] gi|212511037|gb|EEB14086.1| predicted protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|374637164|gb|AEZ54711.1| roundabout-like protein, partial [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|91079308|ref|XP_967065.1| PREDICTED: similar to roundabout 1 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270004828|gb|EFA01276.1| roundabout [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|158287827|ref|XP_309724.3| AGAP010970-PA [Anopheles gambiae str. PEST] gi|157019376|gb|EAA05623.3| AGAP010970-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|312377932|gb|EFR24641.1| hypothetical protein AND_10634 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|198456937|ref|XP_001360492.2| GA12341 [Drosophila pseudoobscura pseudoobscura] gi|198135800|gb|EAL25067.2| GA12341 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|195150159|ref|XP_002016022.1| GL10711 [Drosophila persimilis] gi|194109869|gb|EDW31912.1| GL10711 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|195487979|ref|XP_002092121.1| GE11841 [Drosophila yakuba] gi|194178222|gb|EDW91833.1| GE11841 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 292 | ||||||
| FB|FBgn0005631 | 1429 | robo "roundabout" [Drosophila | 0.715 | 0.146 | 0.474 | 1.9e-50 | |
| UNIPROTKB|F8WBR3 | 564 | ROBO2 "Roundabout homolog 2" [ | 0.732 | 0.379 | 0.436 | 1.9e-42 | |
| UNIPROTKB|Q8UVD7 | 1614 | robo1 "Roundabout-1" [Xenopus | 0.965 | 0.174 | 0.372 | 3.1e-42 | |
| ZFIN|ZDB-GENE-040426-1874 | 1287 | zgc:77784 "zgc:77784" [Danio r | 0.671 | 0.152 | 0.453 | 3.4e-42 | |
| RGD|61941 | 1651 | Robo1 "roundabout, axon guidan | 0.972 | 0.172 | 0.366 | 2.9e-41 | |
| UNIPROTKB|Q9HCK4 | 1378 | ROBO2 "Roundabout homolog 2" [ | 0.732 | 0.155 | 0.436 | 4.5e-41 | |
| MGI|MGI:1274781 | 1612 | Robo1 "roundabout homolog 1 (D | 0.780 | 0.141 | 0.416 | 1.2e-40 | |
| UNIPROTKB|F1N279 | 1483 | ROBO1 "Uncharacterized protein | 0.972 | 0.191 | 0.363 | 1.7e-40 | |
| UNIPROTKB|F1N739 | 1683 | ROBO1 "Uncharacterized protein | 0.972 | 0.168 | 0.363 | 2.1e-40 | |
| UNIPROTKB|Q9Y6N7 | 1651 | ROBO1 "Roundabout homolog 1" [ | 0.972 | 0.172 | 0.363 | 2.6e-40 |
| FB|FBgn0005631 robo "roundabout" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 537 (194.1 bits), Expect = 1.9e-50, P = 1.9e-50
Identities = 101/213 (47%), Positives = 146/213 (68%)
Query: 2 ITEVKKSDEGKYQCYVQNMVGERETKPALLTVHAPPSFVVRPQDQKVGLNGIASFQCVAE 61
I+ + +DEG Y C N VG+ + +L+ VHAPP+F RP ++KVGLNG+ C+A
Sbjct: 345 ISNITPTDEGTYVCEAHNNVGQISARASLI-VHAPPNFTKRPSNKKVGLNGVVQLPCMAS 403
Query: 62 GSPLPSVFWTQEGSQVLMFPGNAYGHLHVTQEGTLRIQGVQKEDAGFFVCSALSVAGSTT 121
G+P PSVFWT+EG LMFP +++G HV +GTL+I V++ED G++VCSA SV S+T
Sbjct: 404 GNPPPSVFWTKEGVSTLMFPNSSHGRQHVAADGTLQITDVRQEDEGYYVCSAFSVVDSST 463
Query: 122 VRAFLQVTSVEDTPPPIVQVGPSNQTLPLHSVAFLPCQAVGSPPPHIRWYKNGNSLPPED 181
VR FLQV+S+++ PPPI+Q+GP+NQTLP SVA LPC+A G+P P I+W+ +G+++ +
Sbjct: 464 VRVFLQVSSLDERPPPIIQIGPANQTLPKGSVATLPCRATGNPSPRIKWFHDGHAVQAGN 523
Query: 182 TRINVSSSGSLQIDVLRDDFRAEPKDTRVASGE 214
R ++ SL++D L+ T ASGE
Sbjct: 524 -RYSIIQGSSLRVDDLQ--LSDSGTYTCTASGE 553
|
|
| UNIPROTKB|F8WBR3 ROBO2 "Roundabout homolog 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8UVD7 robo1 "Roundabout-1" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1874 zgc:77784 "zgc:77784" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|61941 Robo1 "roundabout, axon guidance receptor, homolog 1 (Drosophila)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9HCK4 ROBO2 "Roundabout homolog 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1274781 Robo1 "roundabout homolog 1 (Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N279 ROBO1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N739 ROBO1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y6N7 ROBO1 "Roundabout homolog 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 292 | |||
| cd05726 | 90 | cd05726, Ig4_Robo, Third immunoglobulin (Ig)-like | 4e-22 | |
| cd05724 | 86 | cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like | 2e-17 | |
| pfam07679 | 90 | pfam07679, I-set, Immunoglobulin I-set domain | 1e-15 | |
| smart00410 | 85 | smart00410, IG_like, Immunoglobulin like | 2e-12 | |
| smart00409 | 85 | smart00409, IG, Immunoglobulin | 2e-12 | |
| cd05724 | 86 | cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like | 5e-10 | |
| cd05725 | 69 | cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like | 8e-10 | |
| cd05765 | 81 | cd05765, Ig_3, Subgroup of the immunoglobulin (Ig) | 1e-08 | |
| cd00096 | 74 | cd00096, Ig, Immunoglobulin domain | 2e-08 | |
| smart00410 | 85 | smart00410, IG_like, Immunoglobulin like | 3e-08 | |
| smart00409 | 85 | smart00409, IG, Immunoglobulin | 3e-08 | |
| cd05745 | 74 | cd05745, Ig3_Peroxidasin, Third immunoglobulin (Ig | 3e-08 | |
| cd05746 | 69 | cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (I | 5e-08 | |
| cd05763 | 75 | cd05763, Ig_1, Subgroup of the immunoglobulin (Ig) | 2e-07 | |
| pfam07679 | 90 | pfam07679, I-set, Immunoglobulin I-set domain | 5e-07 | |
| smart00408 | 63 | smart00408, IGc2, Immunoglobulin C-2 Type | 5e-07 | |
| cd05744 | 75 | cd05744, Ig_Myotilin_C_like, Immunoglobulin (Ig)-l | 5e-07 | |
| cd00096 | 74 | cd00096, Ig, Immunoglobulin domain | 6e-07 | |
| pfam00047 | 62 | pfam00047, ig, Immunoglobulin domain | 8e-07 | |
| pfam07679 | 90 | pfam07679, I-set, Immunoglobulin I-set domain | 2e-06 | |
| smart00408 | 63 | smart00408, IGc2, Immunoglobulin C-2 Type | 9e-06 | |
| cd04969 | 73 | cd04969, Ig5_Contactin_like, Fifth Ig domain of co | 1e-05 | |
| pfam07679 | 90 | pfam07679, I-set, Immunoglobulin I-set domain | 2e-05 | |
| cd04968 | 88 | cd04968, Ig3_Contactin_like, Third Ig domain of co | 2e-05 | |
| cd07693 | 100 | cd07693, Ig1_Robo, First immunoglobulin (Ig)-like | 2e-05 | |
| cd05723 | 71 | cd05723, Ig4_Neogenin, Fourth immunoglobulin (Ig)- | 3e-05 | |
| cd05893 | 75 | cd05893, Ig_Palladin_C, C-terminal immunoglobulin | 5e-05 | |
| cd05745 | 74 | cd05745, Ig3_Peroxidasin, Third immunoglobulin (Ig | 7e-05 | |
| cd07693 | 100 | cd07693, Ig1_Robo, First immunoglobulin (Ig)-like | 1e-04 | |
| cd05728 | 85 | cd05728, Ig4_Contactin-2-like, Fourth Ig domain of | 1e-04 | |
| cd04979 | 89 | cd04979, Ig_Semaphorin_C, Immunoglobulin (Ig)-like | 1e-04 | |
| cd05728 | 85 | cd05728, Ig4_Contactin-2-like, Fourth Ig domain of | 2e-04 | |
| cd05731 | 71 | cd05731, Ig3_L1-CAM_like, Third immunoglobulin (Ig | 2e-04 | |
| cd05733 | 77 | cd05733, Ig6_L1-CAM_like, Sixth immunoglobulin (Ig | 3e-04 | |
| cd05851 | 88 | cd05851, Ig3_Contactin-1, Third Ig domain of conta | 3e-04 | |
| cd04972 | 90 | cd04972, Ig_TrkABC_d4, Fourth domain (immunoglobul | 5e-04 | |
| cd07693 | 100 | cd07693, Ig1_Robo, First immunoglobulin (Ig)-like | 7e-04 | |
| cd05875 | 77 | cd05875, Ig6_hNeurofascin_like, Sixth immunoglobul | 8e-04 | |
| cd05739 | 69 | cd05739, Ig3_RPTP_IIa_LAR_like, Third immunoglobul | 9e-04 | |
| cd05732 | 96 | cd05732, Ig5_NCAM-1_like, Fifth immunoglobulin (Ig | 0.001 | |
| cd05722 | 95 | cd05722, Ig1_Neogenin, First immunoglobulin (Ig)-l | 0.001 | |
| cd05892 | 75 | cd05892, Ig_Myotilin_C, C-terminal immunoglobulin | 0.001 | |
| cd04978 | 76 | cd04978, Ig4_L1-NrCAM_like, Fourth immunoglobulin | 0.001 | |
| cd05754 | 85 | cd05754, Ig3_Perlecan_like, Third immunoglobulin ( | 0.001 | |
| cd05724 | 86 | cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like | 0.002 | |
| smart00410 | 85 | smart00410, IG_like, Immunoglobulin like | 0.002 | |
| smart00409 | 85 | smart00409, IG, Immunoglobulin | 0.002 | |
| cd05733 | 77 | cd05733, Ig6_L1-CAM_like, Sixth immunoglobulin (Ig | 0.002 | |
| pfam13927 | 74 | pfam13927, Ig_3, Immunoglobulin domain | 0.002 | |
| cd05736 | 76 | cd05736, Ig2_Follistatin_like, Second immunoglobul | 0.002 | |
| cd05738 | 74 | cd05738, Ig2_RPTP_IIa_LAR_like, Second immunoglobu | 0.002 | |
| cd05731 | 71 | cd05731, Ig3_L1-CAM_like, Third immunoglobulin (Ig | 0.003 | |
| cd05722 | 95 | cd05722, Ig1_Neogenin, First immunoglobulin (Ig)-l | 0.003 | |
| cd05772 | 111 | cd05772, IgC_SIRP, Signal-regulatory protein (SIRP | 0.003 | |
| cd05876 | 71 | cd05876, Ig3_L1-CAM, Third immunoglobulin (Ig)-lik | 0.003 | |
| smart00408 | 63 | smart00408, IGc2, Immunoglobulin C-2 Type | 0.004 | |
| cd05870 | 98 | cd05870, Ig5_NCAM-2, Fifth immunoglobulin (Ig)-lik | 0.004 | |
| cd05743 | 78 | cd05743, Ig_Perlecan_D2_like, Immunoglobulin (Ig)- | 0.004 |
| >gnl|CDD|143203 cd05726, Ig4_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
Score = 88.1 bits (218), Expect = 4e-22
Identities = 37/87 (42%), Positives = 53/87 (60%), Gaps = 3/87 (3%)
Query: 54 ASFQCVAEGSPLPSVFWTQEGSQVLMFPGN---AYGHLHVTQEGTLRIQGVQKEDAGFFV 110
+FQC A G+P P++FW +EGSQ L+F + V+Q G L I VQ+ D G+++
Sbjct: 4 VTFQCEATGNPQPAIFWQKEGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQRSDVGYYI 63
Query: 111 CSALSVAGSTTVRAFLQVTSVEDTPPP 137
C L+VAGS +A+L+VT V PP
Sbjct: 64 CQTLNVAGSILTKAYLEVTDVIADRPP 90
|
Ig4_Robo: domain similar to the third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagonizes slit responsiveness in precrossing axons. The Slit-Robo interaction is mediated by the second leucine-rich repeat (LRR) domain of Slit and the two N-terminal Ig domains of Robo, Ig1 and Ig2. The primary Robo binding site for Slit2 has been shown by surface plasmon resonance experiments and mutational analysis to be is the Ig1 domain, while the Ig2 domain has been proposed to harbor a weak secondary binding site. Length = 90 |
| >gnl|CDD|143201 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain | Back alignment and domain information |
|---|
| >gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like | Back alignment and domain information |
|---|
| >gnl|CDD|214652 smart00409, IG, Immunoglobulin | Back alignment and domain information |
|---|
| >gnl|CDD|143201 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143202 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143242 cd05765, Ig_3, Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like | Back alignment and domain information |
|---|
| >gnl|CDD|214652 smart00409, IG, Immunoglobulin | Back alignment and domain information |
|---|
| >gnl|CDD|143222 cd05745, Ig3_Peroxidasin, Third immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >gnl|CDD|143223 cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >gnl|CDD|143240 cd05763, Ig_1, Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain | Back alignment and domain information |
|---|
| >gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type | Back alignment and domain information |
|---|
| >gnl|CDD|143221 cd05744, Ig_Myotilin_C_like, Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin | Back alignment and domain information |
|---|
| >gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|215677 pfam00047, ig, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain | Back alignment and domain information |
|---|
| >gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type | Back alignment and domain information |
|---|
| >gnl|CDD|143170 cd04969, Ig5_Contactin_like, Fifth Ig domain of contactin | Back alignment and domain information |
|---|
| >gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain | Back alignment and domain information |
|---|
| >gnl|CDD|143169 cd04968, Ig3_Contactin_like, Third Ig domain of contactin | Back alignment and domain information |
|---|
| >gnl|CDD|143317 cd07693, Ig1_Robo, First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212460 cd05723, Ig4_Neogenin, Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143301 cd05893, Ig_Palladin_C, C-terminal immunoglobulin (Ig)-like domain of palladin | Back alignment and domain information |
|---|
| >gnl|CDD|143222 cd05745, Ig3_Peroxidasin, Third immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >gnl|CDD|143317 cd07693, Ig1_Robo, First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143205 cd05728, Ig4_Contactin-2-like, Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143180 cd04979, Ig_Semaphorin_C, Immunoglobulin (Ig)-like domain of semaphorin | Back alignment and domain information |
|---|
| >gnl|CDD|143205 cd05728, Ig4_Contactin-2-like, Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143208 cd05731, Ig3_L1-CAM_like, Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >gnl|CDD|143210 cd05733, Ig6_L1-CAM_like, Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143259 cd05851, Ig3_Contactin-1, Third Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >gnl|CDD|143173 cd04972, Ig_TrkABC_d4, Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC | Back alignment and domain information |
|---|
| >gnl|CDD|143317 cd07693, Ig1_Robo, First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143283 cd05875, Ig6_hNeurofascin_like, Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) | Back alignment and domain information |
|---|
| >gnl|CDD|143216 cd05739, Ig3_RPTP_IIa_LAR_like, Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR | Back alignment and domain information |
|---|
| >gnl|CDD|143209 cd05732, Ig5_NCAM-1_like, Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143199 cd05722, Ig1_Neogenin, First immunoglobulin (Ig)-like domain in neogenin and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143300 cd05892, Ig_Myotilin_C, C-terminal immunoglobulin (Ig)-like domain of myotilin | Back alignment and domain information |
|---|
| >gnl|CDD|143179 cd04978, Ig4_L1-NrCAM_like, Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) | Back alignment and domain information |
|---|
| >gnl|CDD|143231 cd05754, Ig3_Perlecan_like, Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143201 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like | Back alignment and domain information |
|---|
| >gnl|CDD|214652 smart00409, IG, Immunoglobulin | Back alignment and domain information |
|---|
| >gnl|CDD|143210 cd05733, Ig6_L1-CAM_like, Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|222457 pfam13927, Ig_3, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|143213 cd05736, Ig2_Follistatin_like, Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143215 cd05738, Ig2_RPTP_IIa_LAR_like, Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR | Back alignment and domain information |
|---|
| >gnl|CDD|143208 cd05731, Ig3_L1-CAM_like, Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >gnl|CDD|143199 cd05722, Ig1_Neogenin, First immunoglobulin (Ig)-like domain in neogenin and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143249 cd05772, IgC_SIRP, Signal-regulatory protein (SIRP) immunoglobulin-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|143284 cd05876, Ig3_L1-CAM, Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type | Back alignment and domain information |
|---|
| >gnl|CDD|143278 cd05870, Ig5_NCAM-2, Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) | Back alignment and domain information |
|---|
| >gnl|CDD|143220 cd05743, Ig_Perlecan_D2_like, Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 292 | |||
| KOG3513|consensus | 1051 | 100.0 | ||
| KOG3513|consensus | 1051 | 100.0 | ||
| KOG4221|consensus | 1381 | 100.0 | ||
| KOG4222|consensus | 1281 | 99.97 | ||
| PHA02785 | 326 | IL-beta-binding protein; Provisional | 99.97 | |
| KOG4221|consensus | 1381 | 99.96 | ||
| KOG4194|consensus | 873 | 99.95 | ||
| KOG4222|consensus | 1281 | 99.95 | ||
| KOG4194|consensus | 873 | 99.94 | ||
| PHA02785 | 326 | IL-beta-binding protein; Provisional | 99.92 | |
| PHA02826 | 227 | IL-1 receptor-like protein; Provisional | 99.84 | |
| PHA02826 | 227 | IL-1 receptor-like protein; Provisional | 99.74 | |
| cd05762 | 98 | Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of | 99.72 | |
| cd05851 | 88 | Ig3_Contactin-1 Third Ig domain of contactin-1. Ig | 99.69 | |
| cd04975 | 101 | Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma | 99.68 | |
| cd05771 | 139 | IgC_Tapasin_R Tapasin-R immunoglobulin-like domain | 99.67 | |
| cd05851 | 88 | Ig3_Contactin-1 Third Ig domain of contactin-1. Ig | 99.67 | |
| cd05737 | 92 | Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- | 99.66 | |
| cd05852 | 73 | Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig | 99.66 | |
| cd05762 | 98 | Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of | 99.66 | |
| cd05894 | 86 | Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card | 99.65 | |
| cd05745 | 74 | Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom | 99.65 | |
| cd05745 | 74 | Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom | 99.64 | |
| cd05859 | 101 | Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do | 99.64 | |
| cd05852 | 73 | Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig | 99.64 | |
| cd04968 | 88 | Ig3_Contactin_like Third Ig domain of contactin. I | 99.63 | |
| cd05868 | 76 | Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o | 99.63 | |
| cd05728 | 85 | Ig4_Contactin-2-like Fourth Ig domain of the neura | 99.63 | |
| cd05747 | 92 | Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like | 99.62 | |
| cd05894 | 86 | Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card | 99.62 | |
| cd05892 | 75 | Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like | 99.62 | |
| cd05869 | 97 | Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o | 99.62 | |
| cd04975 | 101 | Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma | 99.62 | |
| cd05867 | 76 | Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do | 99.62 | |
| cd05855 | 79 | Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T | 99.61 | |
| cd05863 | 67 | Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain | 99.61 | |
| cd05863 | 67 | Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain | 99.61 | |
| cd05747 | 92 | Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like | 99.61 | |
| cd04971 | 81 | Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of | 99.6 | |
| cd05893 | 75 | Ig_Palladin_C C-terminal immunoglobulin (Ig)-like | 99.6 | |
| PF07679 | 90 | I-set: Immunoglobulin I-set domain; InterPro: IPR0 | 99.6 | |
| cd05892 | 75 | Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like | 99.6 | |
| cd05723 | 71 | Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai | 99.6 | |
| cd04972 | 90 | Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o | 99.59 | |
| cd05865 | 96 | Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o | 99.59 | |
| cd05728 | 85 | Ig4_Contactin-2-like Fourth Ig domain of the neura | 99.59 | |
| cd05746 | 69 | Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do | 99.59 | |
| cd05724 | 86 | Ig2_Robo Second immunoglobulin (Ig)-like domain in | 99.59 | |
| cd05730 | 95 | Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom | 99.59 | |
| cd05870 | 98 | Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o | 99.59 | |
| cd05867 | 76 | Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do | 99.59 | |
| cd05891 | 92 | Ig_M-protein_C C-terminal immunoglobulin (Ig)-like | 99.59 | |
| cd05865 | 96 | Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o | 99.58 | |
| cd05730 | 95 | Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom | 99.58 | |
| cd05848 | 94 | Ig1_Contactin-5 First Ig domain of contactin-5. Ig | 99.58 | |
| cd05737 | 92 | Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- | 99.58 | |
| cd05723 | 71 | Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai | 99.58 | |
| cd05893 | 75 | Ig_Palladin_C C-terminal immunoglobulin (Ig)-like | 99.58 | |
| cd05850 | 94 | Ig1_Contactin-2 First Ig domain of contactin-2. Ig | 99.58 | |
| cd04969 | 73 | Ig5_Contactin_like Fifth Ig domain of contactin. I | 99.58 | |
| cd05744 | 75 | Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain | 99.57 | |
| cd04973 | 79 | Ig1_FGFR First immunoglobulin (Ig)-like domain of | 99.57 | |
| cd05868 | 76 | Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o | 99.57 | |
| cd05735 | 88 | Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down | 99.57 | |
| cd05726 | 90 | Ig4_Robo Fhird immunoglobulin (Ig)-like domain in | 99.57 | |
| cd04969 | 73 | Ig5_Contactin_like Fifth Ig domain of contactin. I | 99.57 | |
| cd05748 | 74 | Ig_Titin_like Immunoglobulin (Ig)-like domain of t | 99.57 | |
| cd04972 | 90 | Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o | 99.57 | |
| cd05857 | 85 | Ig2_FGFR Second immunoglobulin (Ig)-like domain of | 99.57 | |
| cd04978 | 76 | Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like | 99.57 | |
| cd05758 | 98 | Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do | 99.56 | |
| cd07693 | 100 | Ig1_Robo First immunoglobulin (Ig)-like domain in | 99.56 | |
| cd05732 | 96 | Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom | 99.56 | |
| cd05735 | 88 | Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down | 99.56 | |
| cd05866 | 92 | Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o | 99.56 | |
| cd05740 | 91 | Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai | 99.56 | |
| cd05739 | 69 | Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li | 99.56 | |
| cd05760 | 77 | Ig2_PTK7 Second immunoglobulin (Ig)-like domain of | 99.55 | |
| cd05859 | 101 | Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do | 99.55 | |
| cd05864 | 70 | Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain | 99.55 | |
| cd04976 | 71 | Ig2_VEGFR Second immunoglobulin (Ig)-like domain o | 99.55 | |
| cd04978 | 76 | Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like | 99.55 | |
| cd05864 | 70 | Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain | 99.55 | |
| cd05743 | 78 | Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai | 99.54 | |
| PF07679 | 90 | I-set: Immunoglobulin I-set domain; InterPro: IPR0 | 99.54 | |
| cd05870 | 98 | Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o | 99.54 | |
| cd05744 | 75 | Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain | 99.54 | |
| cd05746 | 69 | Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do | 99.54 | |
| cd07693 | 100 | Ig1_Robo First immunoglobulin (Ig)-like domain in | 99.54 | |
| cd04968 | 88 | Ig3_Contactin_like Third Ig domain of contactin. I | 99.53 | |
| cd05732 | 96 | Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom | 99.53 | |
| cd05738 | 74 | Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l | 99.53 | |
| cd05869 | 97 | Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o | 99.53 | |
| cd04976 | 71 | Ig2_VEGFR Second immunoglobulin (Ig)-like domain o | 99.53 | |
| cd05876 | 71 | Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o | 99.52 | |
| cd05733 | 77 | Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom | 99.52 | |
| cd05876 | 71 | Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o | 99.52 | |
| cd05722 | 95 | Ig1_Neogenin First immunoglobulin (Ig)-like domain | 99.52 | |
| cd05748 | 74 | Ig_Titin_like Immunoglobulin (Ig)-like domain of t | 99.52 | |
| KOG3515|consensus | 741 | 99.52 | ||
| cd05854 | 85 | Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig | 99.51 | |
| cd05749 | 81 | Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom | 99.51 | |
| cd05891 | 92 | Ig_M-protein_C C-terminal immunoglobulin (Ig)-like | 99.51 | |
| cd05866 | 92 | Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o | 99.51 | |
| cd05849 | 93 | Ig1_Contactin-1 First Ig domain of contactin-1. Ig | 99.51 | |
| cd05853 | 85 | Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig | 99.51 | |
| cd05857 | 85 | Ig2_FGFR Second immunoglobulin (Ig)-like domain of | 99.51 | |
| cd05858 | 90 | Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o | 99.51 | |
| cd05875 | 77 | Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li | 99.51 | |
| cd05874 | 77 | Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of | 99.51 | |
| cd04974 | 90 | Ig3_FGFR Third immunoglobulin (Ig)-like domain of | 99.5 | |
| cd05725 | 69 | Ig3_Robo Third immunoglobulin (Ig)-like domain in | 99.5 | |
| cd05725 | 69 | Ig3_Robo Third immunoglobulin (Ig)-like domain in | 99.49 | |
| cd05848 | 94 | Ig1_Contactin-5 First Ig domain of contactin-5. Ig | 99.49 | |
| cd05760 | 77 | Ig2_PTK7 Second immunoglobulin (Ig)-like domain of | 99.49 | |
| cd05763 | 75 | Ig_1 Subgroup of the immunoglobulin (Ig) superfami | 99.49 | |
| cd05765 | 81 | Ig_3 Subgroup of the immunoglobulin (Ig) superfami | 99.49 | |
| cd05736 | 76 | Ig2_Follistatin_like Second immunoglobulin (Ig)-li | 99.49 | |
| cd04973 | 79 | Ig1_FGFR First immunoglobulin (Ig)-like domain of | 99.49 | |
| cd05724 | 86 | Ig2_Robo Second immunoglobulin (Ig)-like domain in | 99.49 | |
| cd05856 | 82 | Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do | 99.49 | |
| cd05764 | 74 | Ig_2 Subgroup of the immunoglobulin (Ig) superfami | 99.48 | |
| cd04977 | 92 | Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom | 99.48 | |
| cd05750 | 75 | Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain | 99.48 | |
| cd05856 | 82 | Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do | 99.48 | |
| cd05895 | 76 | Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai | 99.48 | |
| cd05850 | 94 | Ig1_Contactin-2 First Ig domain of contactin-2. Ig | 99.47 | |
| cd05849 | 93 | Ig1_Contactin-1 First Ig domain of contactin-1. Ig | 99.47 | |
| cd05743 | 78 | Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai | 99.47 | |
| cd05758 | 98 | Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do | 99.47 | |
| cd05764 | 74 | Ig_2 Subgroup of the immunoglobulin (Ig) superfami | 99.47 | |
| cd07702 | 72 | Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain | 99.47 | |
| cd04977 | 92 | Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom | 99.47 | |
| cd05726 | 90 | Ig4_Robo Fhird immunoglobulin (Ig)-like domain in | 99.47 | |
| cd05731 | 71 | Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom | 99.47 | |
| cd05739 | 69 | Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li | 99.47 | |
| cd05756 | 94 | Ig1_IL1R_like First immunoglobulin (Ig)-like domai | 99.46 | |
| cd04967 | 91 | Ig1_Contactin First Ig domain of contactin. Ig1_Co | 99.46 | |
| cd04970 | 85 | Ig6_Contactin_like Sixth Ig domain of contactin. I | 99.46 | |
| cd05738 | 74 | Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l | 99.46 | |
| cd05731 | 71 | Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom | 99.46 | |
| cd05740 | 91 | Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai | 99.46 | |
| cd05853 | 85 | Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig | 99.46 | |
| cd04971 | 81 | Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of | 99.46 | |
| cd05854 | 85 | Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig | 99.46 | |
| cd05855 | 79 | Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T | 99.46 | |
| cd05763 | 75 | Ig_1 Subgroup of the immunoglobulin (Ig) superfami | 99.45 | |
| cd05773 | 109 | Ig8_hNephrin_like Eighth immunoglobulin-like domai | 99.45 | |
| cd05873 | 87 | Ig_Sema4D_like Immunoglobulin (Ig)-like domain of | 99.45 | |
| cd04974 | 90 | Ig3_FGFR Third immunoglobulin (Ig)-like domain of | 99.45 | |
| cd05773 | 109 | Ig8_hNephrin_like Eighth immunoglobulin-like domai | 99.45 | |
| cd05727 | 96 | Ig2_Contactin-2-like Second Ig domain of the neura | 99.45 | |
| cd05756 | 94 | Ig1_IL1R_like First immunoglobulin (Ig)-like domai | 99.44 | |
| cd07702 | 72 | Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain | 99.44 | |
| KOG3515|consensus | 741 | 99.43 | ||
| cd05722 | 95 | Ig1_Neogenin First immunoglobulin (Ig)-like domain | 99.43 | |
| cd05858 | 90 | Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o | 99.43 | |
| cd04970 | 85 | Ig6_Contactin_like Sixth Ig domain of contactin. I | 99.42 | |
| cd05752 | 78 | Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do | 99.42 | |
| cd05771 | 139 | IgC_Tapasin_R Tapasin-R immunoglobulin-like domain | 99.41 | |
| cd05749 | 81 | Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom | 99.4 | |
| cd05742 | 84 | Ig1_VEGFR_like First immunoglobulin (Ig)-like doma | 99.4 | |
| cd05736 | 76 | Ig2_Follistatin_like Second immunoglobulin (Ig)-li | 99.39 | |
| cd05765 | 81 | Ig_3 Subgroup of the immunoglobulin (Ig) superfami | 99.39 | |
| cd05734 | 79 | Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain | 99.38 | |
| cd05734 | 79 | Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain | 99.37 | |
| cd05742 | 84 | Ig1_VEGFR_like First immunoglobulin (Ig)-like doma | 99.37 | |
| cd04979 | 89 | Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of | 99.37 | |
| cd05882 | 95 | Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- | 99.37 | |
| cd05861 | 84 | Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like | 99.37 | |
| cd05754 | 85 | Ig3_Perlecan_like Third immunoglobulin (Ig)-like d | 99.37 | |
| cd05898 | 98 | Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain | 99.37 | |
| cd05757 | 92 | Ig2_IL1R_like Second immunoglobulin (Ig)-like doma | 99.36 | |
| cd05750 | 75 | Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain | 99.36 | |
| cd04967 | 91 | Ig1_Contactin First Ig domain of contactin. Ig1_Co | 99.32 | |
| cd05873 | 87 | Ig_Sema4D_like Immunoglobulin (Ig)-like domain of | 99.32 | |
| cd05752 | 78 | Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do | 99.3 | |
| cd05729 | 85 | Ig2_FGFR_like Second immunoglobulin (Ig)-like doma | 99.3 | |
| cd07701 | 95 | Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- | 99.3 | |
| cd05898 | 98 | Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain | 99.3 | |
| cd05885 | 80 | Ig2_Necl-4 Second immunoglobulin (Ig)-like domain | 99.29 | |
| cd05754 | 85 | Ig3_Perlecan_like Third immunoglobulin (Ig)-like d | 99.29 | |
| cd05733 | 77 | Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom | 99.29 | |
| cd05895 | 76 | Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai | 99.29 | |
| cd05874 | 77 | Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of | 99.28 | |
| cd04979 | 89 | Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of | 99.27 | |
| cd05845 | 95 | Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do | 99.26 | |
| cd05753 | 83 | Ig2_FcgammaR_like Second immunoglobulin (Ig)-like | 99.26 | |
| cd05875 | 77 | Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li | 99.26 | |
| cd05757 | 92 | Ig2_IL1R_like Second immunoglobulin (Ig)-like doma | 99.25 | |
| cd05729 | 85 | Ig2_FGFR_like Second immunoglobulin (Ig)-like doma | 99.24 | |
| PHA03376 | 221 | BARF1; Provisional | 99.24 | |
| cd07690 | 94 | Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I | 99.24 | |
| smart00408 | 63 | IGc2 Immunoglobulin C-2 Type. | 99.23 | |
| cd05882 | 95 | Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- | 99.23 | |
| cd05861 | 84 | Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like | 99.23 | |
| cd05753 | 83 | Ig2_FcgammaR_like Second immunoglobulin (Ig)-like | 99.23 | |
| cd05871 | 91 | Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do | 99.18 | |
| cd05885 | 80 | Ig2_Necl-4 Second immunoglobulin (Ig)-like domain | 99.16 | |
| cd05717 | 95 | Ig1_Necl-1-3_like First (N-terminal) immunoglobuli | 99.16 | |
| smart00408 | 63 | IGc2 Immunoglobulin C-2 Type. | 99.14 | |
| cd05727 | 96 | Ig2_Contactin-2-like Second Ig domain of the neura | 99.13 | |
| cd05896 | 104 | Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like | 99.12 | |
| cd05862 | 86 | Ig1_VEGFR First immunoglobulin (Ig)-like domain of | 99.12 | |
| PF13895 | 80 | Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V | 99.12 | |
| cd05897 | 95 | Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom | 99.11 | |
| cd05845 | 95 | Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do | 99.08 | |
| cd07701 | 95 | Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- | 99.08 | |
| cd05862 | 86 | Ig1_VEGFR First immunoglobulin (Ig)-like domain of | 99.07 | |
| PF00047 | 64 | ig: Immunoglobulin domain The Prosite family only | 99.07 | |
| cd07690 | 94 | Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I | 99.06 | |
| cd05759 | 82 | Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d | 99.05 | |
| cd05774 | 105 | Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain | 99.04 | |
| PF00047 | 64 | ig: Immunoglobulin domain The Prosite family only | 99.04 | |
| cd05860 | 101 | Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of | 99.03 | |
| PF13895 | 80 | Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V | 99.02 | |
| cd05871 | 91 | Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do | 99.01 | |
| smart00409 | 86 | IG Immunoglobulin. | 99.01 | |
| smart00410 | 86 | IG_like Immunoglobulin like. IG domains that canno | 99.01 | |
| cd05872 | 85 | Ig_Sema4B_like Immunoglobulin (Ig)-like domain of | 99.01 | |
| cd05860 | 101 | Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of | 98.97 | |
| cd05717 | 95 | Ig1_Necl-1-3_like First (N-terminal) immunoglobuli | 98.97 | |
| cd05897 | 95 | Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom | 98.94 | |
| cd05881 | 95 | Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- | 98.93 | |
| smart00409 | 86 | IG Immunoglobulin. | 98.92 | |
| smart00410 | 86 | IG_like Immunoglobulin like. IG domains that canno | 98.92 | |
| cd05759 | 82 | Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d | 98.91 | |
| cd05879 | 116 | Ig_P0 Immunoglobulin (Ig)-like domain of Protein z | 98.9 | |
| cd05751 | 91 | Ig1_LILRB1_like First immunoglobulin (Ig)-like dom | 98.89 | |
| cd05741 | 92 | Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d | 98.88 | |
| cd05883 | 82 | Ig2_Necl-2 Second immunoglobulin (Ig)-like domain | 98.88 | |
| cd05896 | 104 | Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like | 98.85 | |
| cd05761 | 82 | Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like | 98.84 | |
| PF13927 | 75 | Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V | 98.84 | |
| cd05900 | 112 | Ig_Aggrecan Immunoglobulin (Ig)-like domain of the | 98.83 | |
| cd07705 | 83 | Ig2_Necl-1 Second immunoglobulin (Ig)-like domain | 98.81 | |
| cd05714 | 106 | Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho | 98.8 | |
| cd05884 | 83 | Ig2_Necl-3 Second immunoglobulin (Ig)-like domain | 98.8 | |
| cd05877 | 106 | Ig_LP_like Immunoglobulin (Ig)-like domain of huma | 98.77 | |
| cd05755 | 100 | Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do | 98.77 | |
| cd05878 | 110 | Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o | 98.76 | |
| cd05713 | 100 | Ig_MOG_like Immunoglobulin (Ig)-like domain of mye | 98.76 | |
| cd05755 | 100 | Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do | 98.75 | |
| cd05751 | 91 | Ig1_LILRB1_like First immunoglobulin (Ig)-like dom | 98.75 | |
| cd05881 | 95 | Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- | 98.74 | |
| cd05872 | 85 | Ig_Sema4B_like Immunoglobulin (Ig)-like domain of | 98.73 | |
| cd04983 | 109 | IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V | 98.72 | |
| cd00098 | 95 | IgC Immunoglobulin Constant domain. IgC: Immunoglo | 98.7 | |
| cd05775 | 97 | Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) | 98.7 | |
| cd05899 | 110 | IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma | 98.7 | |
| cd05718 | 98 | Ig1_PVR_like First immunoglobulin (Ig) domain of p | 98.66 | |
| cd05883 | 82 | Ig2_Necl-2 Second immunoglobulin (Ig)-like domain | 98.65 | |
| cd05902 | 110 | Ig_Neurocan Immunoglobulin (Ig)-like domain of the | 98.64 | |
| cd04983 | 109 | IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V | 98.64 | |
| cd05899 | 110 | IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma | 98.63 | |
| PF13927 | 75 | Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V | 98.62 | |
| cd05715 | 116 | Ig_P0-like Immunoglobulin (Ig)-like domain of Prot | 98.61 | |
| cd05880 | 115 | Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel | 98.6 | |
| PF07686 | 114 | V-set: Immunoglobulin V-set domain; InterPro: IPR0 | 98.57 | |
| cd05879 | 116 | Ig_P0 Immunoglobulin (Ig)-like domain of Protein z | 98.57 | |
| cd04980 | 106 | IgV_L_kappa Immunoglobulin (Ig) light chain, kappa | 98.56 | |
| PHA03376 | 221 | BARF1; Provisional | 98.56 | |
| cd00099 | 105 | IgV Immunoglobulin variable domain (IgV). IgV: Imm | 98.54 | |
| cd05711 | 94 | Ig_FcalphaRI Immunoglobulin (IG)-like domain of of | 98.53 | |
| cd05741 | 92 | Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d | 98.53 | |
| cd00098 | 95 | IgC Immunoglobulin Constant domain. IgC: Immunoglo | 98.52 | |
| cd07694 | 88 | Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. | 98.5 | |
| cd05888 | 100 | Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain | 98.48 | |
| cd05886 | 99 | Ig1_Nectin-1_like First immunoglobulin (Ig) domain | 98.48 | |
| cd05880 | 115 | Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel | 98.47 | |
| cd05901 | 117 | Ig_Versican Immunoglobulin (Ig)-like domain of the | 98.47 | |
| cd04982 | 116 | IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom | 98.47 | |
| cd05761 | 82 | Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like | 98.46 | |
| cd04980 | 106 | IgV_L_kappa Immunoglobulin (Ig) light chain, kappa | 98.46 | |
| PHA02987 | 189 | Ig domain OX-2-like protein; Provisional | 98.45 | |
| cd05846 | 97 | Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain | 98.45 | |
| PF08205 | 89 | C2-set_2: CD80-like C2-set immunoglobulin domain ; | 98.45 | |
| cd00099 | 105 | IgV Immunoglobulin variable domain (IgV). IgV: Imm | 98.42 | |
| cd05774 | 105 | Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain | 98.41 | |
| cd05775 | 97 | Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) | 98.41 | |
| cd05714 | 106 | Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho | 98.41 | |
| cd04984 | 98 | IgV_L_lambda Immunoglobulin (Ig) lambda light chai | 98.39 | |
| PHA03270 | 466 | envelope glycoprotein C; Provisional | 98.36 | |
| PHA03269 | 566 | envelope glycoprotein C; Provisional | 98.36 | |
| cd07706 | 116 | IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom | 98.35 | |
| cd07705 | 83 | Ig2_Necl-1 Second immunoglobulin (Ig)-like domain | 98.34 | |
| cd05887 | 96 | Ig1_Nectin-3_like First immunoglobulin (Ig) domain | 98.33 | |
| cd05772 | 111 | IgC_SIRP Signal-regulatory protein (SIRP) immunogl | 98.32 | |
| cd05715 | 116 | Ig_P0-like Immunoglobulin (Ig)-like domain of Prot | 98.32 | |
| cd07699 | 100 | IgC_L Immunoglobulin Constant domain. IgC_L: Immun | 98.31 | |
| cd05884 | 83 | Ig2_Necl-3 Second immunoglobulin (Ig)-like domain | 98.31 | |
| cd05718 | 98 | Ig1_PVR_like First immunoglobulin (Ig) domain of p | 98.3 | |
| cd04984 | 98 | IgV_L_lambda Immunoglobulin (Ig) lambda light chai | 98.3 | |
| smart00407 | 75 | IGc1 Immunoglobulin C-Type. | 98.3 | |
| cd05877 | 106 | Ig_LP_like Immunoglobulin (Ig)-like domain of huma | 98.3 | |
| PF08205 | 89 | C2-set_2: CD80-like C2-set immunoglobulin domain ; | 98.27 | |
| cd04982 | 116 | IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom | 98.27 | |
| cd05847 | 94 | IgC_CH2_IgE CH2 domain (second constant Ig domain | 98.25 | |
| cd05716 | 98 | Ig_pIgR Immunoglobulin (Ig)-like domain in the pol | 98.25 | |
| cd05712 | 119 | Ig_Siglec_N Immunoglobulin (Ig) domain at the N te | 98.23 | |
| cd05711 | 94 | Ig_FcalphaRI Immunoglobulin (IG)-like domain of of | 98.23 | |
| cd07700 | 107 | IgV_CD8_beta Immunoglobulin (Ig) like domain of CD | 98.23 | |
| cd05847 | 94 | IgC_CH2_IgE CH2 domain (second constant Ig domain | 98.22 | |
| cd05713 | 100 | Ig_MOG_like Immunoglobulin (Ig)-like domain of mye | 98.22 | |
| PHA03270 | 466 | envelope glycoprotein C; Provisional | 98.21 | |
| cd05766 | 94 | IgC_MHC_II_beta Class II major histocompatibility | 98.21 | |
| PHA03273 | 486 | envelope glycoprotein C; Provisional | 98.2 | |
| cd05719 | 95 | Ig2_PVR_like Second immunoglobulin (Ig) domain of | 98.2 | |
| cd07698 | 93 | IgC_MHC_I_alpha3 Class I major histocompatibility | 98.2 | |
| cd05716 | 98 | Ig_pIgR Immunoglobulin (Ig)-like domain in the pol | 98.2 | |
| cd04981 | 117 | IgV_H Immunoglobulin (Ig) heavy chain (H), variabl | 98.2 | |
| cd05770 | 93 | IgC_beta2m Class I major histocompatibility comple | 98.18 | |
| cd07698 | 93 | IgC_MHC_I_alpha3 Class I major histocompatibility | 98.18 | |
| cd05772 | 111 | IgC_SIRP Signal-regulatory protein (SIRP) immunogl | 98.17 | |
| cd05769 | 115 | IgC_TCR_beta T cell receptor (TCR) beta chain cons | 98.17 | |
| cd05889 | 96 | Ig1_DNAM-1_like First immunoglobulin (Ig) domain o | 98.17 | |
| smart00407 | 75 | IGc1 Immunoglobulin C-Type. | 98.17 | |
| PF07654 | 83 | C1-set: Immunoglobulin C1-set domain; InterPro: IP | 98.17 | |
| cd00096 | 74 | Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) | 98.17 | |
| cd07706 | 116 | IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom | 98.16 | |
| cd05900 | 112 | Ig_Aggrecan Immunoglobulin (Ig)-like domain of the | 98.16 | |
| cd05720 | 104 | Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD | 98.15 | |
| cd07699 | 100 | IgC_L Immunoglobulin Constant domain. IgC_L: Immun | 98.13 | |
| cd00096 | 74 | Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) | 98.1 | |
| cd07696 | 96 | IgC_CH3 CH3 domain (third constant Ig domain of th | 98.1 | |
| PHA03273 | 486 | envelope glycoprotein C; Provisional | 98.09 | |
| cd05878 | 110 | Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o | 98.08 | |
| cd07703 | 95 | Ig2_Nectin-2_like Second immunoglobulin (Ig) domai | 98.07 | |
| cd05768 | 102 | IgC_CH4 CH4 domain (fourth constant Ig domain of t | 98.07 | |
| PHA03269 | 566 | envelope glycoprotein C; Provisional | 98.07 | |
| cd05888 | 100 | Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain | 98.06 | |
| cd05886 | 99 | Ig1_Nectin-1_like First immunoglobulin (Ig) domain | 98.05 | |
| cd05846 | 97 | Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain | 98.04 | |
| cd05719 | 95 | Ig2_PVR_like Second immunoglobulin (Ig) domain of | 98.04 | |
| PHA02987 | 189 | Ig domain OX-2-like protein; Provisional | 98.04 | |
| cd05768 | 102 | IgC_CH4 CH4 domain (fourth constant Ig domain of t | 98.04 | |
| cd05770 | 93 | IgC_beta2m Class I major histocompatibility comple | 98.02 | |
| cd07700 | 107 | IgV_CD8_beta Immunoglobulin (Ig) like domain of CD | 98.01 | |
| cd07696 | 96 | IgC_CH3 CH3 domain (third constant Ig domain of th | 98.01 | |
| PF07686 | 114 | V-set: Immunoglobulin V-set domain; InterPro: IPR0 | 98.0 | |
| PHA03271 | 490 | envelope glycoprotein C; Provisional | 97.99 | |
| cd05887 | 96 | Ig1_Nectin-3_like First immunoglobulin (Ig) domain | 97.99 | |
| cd05767 | 94 | IgC_MHC_II_alpha Class II major histocompatibility | 97.98 | |
| cd07703 | 95 | Ig2_Nectin-2_like Second immunoglobulin (Ig) domai | 97.95 | |
| cd05766 | 94 | IgC_MHC_II_beta Class II major histocompatibility | 97.94 | |
| cd05769 | 115 | IgC_TCR_beta T cell receptor (TCR) beta chain cons | 97.93 | |
| cd05767 | 94 | IgC_MHC_II_alpha Class II major histocompatibility | 97.93 | |
| cd04985 | 95 | IgC_CH1 CH1 domain (first constant Ig domain of th | 97.91 | |
| smart00406 | 81 | IGv Immunoglobulin V-Type. | 97.88 | |
| cd07704 | 97 | Ig2_Nectin-3-4_like Second immunoglobulin (Ig) dom | 97.86 | |
| cd07694 | 88 | Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. | 97.84 | |
| cd05712 | 119 | Ig_Siglec_N Immunoglobulin (Ig) domain at the N te | 97.83 | |
| cd04981 | 117 | IgV_H Immunoglobulin (Ig) heavy chain (H), variabl | 97.83 | |
| KOG1480|consensus | 909 | 97.83 | ||
| cd05889 | 96 | Ig1_DNAM-1_like First immunoglobulin (Ig) domain o | 97.81 | |
| PF07654 | 83 | C1-set: Immunoglobulin C1-set domain; InterPro: IP | 97.8 | |
| cd07697 | 96 | IgC_TCR_gamma T cell receptor (TCR) gamma chain co | 97.8 | |
| cd04986 | 99 | IgC_CH2 CH2 domain (second constant Ig domain of t | 97.79 | |
| cd05720 | 104 | Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD | 97.77 | |
| cd07697 | 96 | IgC_TCR_gamma T cell receptor (TCR) gamma chain co | 97.77 | |
| TIGR00864 | 2740 | PCC polycystin cation channel protein. Note: this | 97.75 | |
| cd07692 | 65 | Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of | 97.7 | |
| cd04986 | 99 | IgC_CH2 CH2 domain (second constant Ig domain of t | 97.65 | |
| PHA02633 | 63 | hypothetical protein; Provisional | 97.64 | |
| cd07704 | 97 | Ig2_Nectin-3-4_like Second immunoglobulin (Ig) dom | 97.61 | |
| cd04985 | 95 | IgC_CH1 CH1 domain (first constant Ig domain of th | 97.61 | |
| cd05902 | 110 | Ig_Neurocan Immunoglobulin (Ig)-like domain of the | 97.6 | |
| TIGR00864 | 2740 | PCC polycystin cation channel protein. Note: this | 97.5 | |
| cd07689 | 99 | Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain | 97.48 | |
| PHA02633 | 63 | hypothetical protein; Provisional | 97.38 | |
| cd05901 | 117 | Ig_Versican Immunoglobulin (Ig)-like domain of the | 97.35 | |
| cd07691 | 69 | Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain | 97.32 | |
| cd07692 | 65 | Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of | 97.32 | |
| cd05721 | 115 | IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic | 97.31 | |
| smart00406 | 81 | IGv Immunoglobulin V-Type. | 97.25 | |
| PF08204 | 130 | V-set_CD47: CD47 immunoglobulin-like domain; Inter | 97.21 | |
| cd07689 | 99 | Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain | 97.19 | |
| PHA03271 | 490 | envelope glycoprotein C; Provisional | 96.87 | |
| cd07691 | 69 | Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain | 96.81 | |
| PHA02982 | 251 | hypothetical protein; Provisional | 96.81 | |
| KOG4597|consensus | 560 | 96.75 | ||
| PF08204 | 130 | V-set_CD47: CD47 immunoglobulin-like domain; Inter | 96.73 | |
| KOG0613|consensus | 1205 | 96.37 | ||
| PF07354 | 271 | Sp38: Zona-pellucida-binding protein (Sp38); Inter | 96.14 | |
| PHA03042 | 286 | CD47-like protein; Provisional | 96.05 | |
| PHA02914 | 500 | Immunoglobulin-like domain protein; Provisional | 95.52 | |
| PHA03042 | 286 | CD47-like protein; Provisional | 95.49 | |
| PHA02982 | 251 | hypothetical protein; Provisional | 95.47 | |
| cd05721 | 115 | IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic | 95.46 | |
| KOG1480|consensus | 909 | 95.28 | ||
| PHA03052 | 69 | Hypothetical protein; Provisional | 95.2 | |
| PF11465 | 108 | Receptor_2B4: Natural killer cell receptor 2B4; In | 94.59 | |
| PF07354 | 271 | Sp38: Zona-pellucida-binding protein (Sp38); Inter | 94.55 | |
| PHA02914 | 500 | Immunoglobulin-like domain protein; Provisional | 94.45 | |
| cd05890 | 98 | Ig2_Nectin-1_like Second immunoglobulin (Ig) domai | 94.21 | |
| KOG4597|consensus | 560 | 94.2 | ||
| PHA02865 | 338 | MHC-like TNF binding protein; Provisional | 93.69 | |
| PHA02865 | 338 | MHC-like TNF binding protein; Provisional | 93.28 | |
| PF06328 | 89 | Lep_receptor_Ig: Ig-like C2-type domain; InterPro: | 92.74 | |
| KOG0613|consensus | 1205 | 92.66 | ||
| PF06328 | 89 | Lep_receptor_Ig: Ig-like C2-type domain; InterPro: | 92.59 | |
| PF02124 | 211 | Marek_A: Marek's disease glycoprotein A; InterPro: | 91.78 | |
| PF11465 | 108 | Receptor_2B4: Natural killer cell receptor 2B4; In | 91.27 | |
| PF05790 | 80 | C2-set: Immunoglobulin C2-set domain; InterPro: IP | 91.11 | |
| PHA03052 | 69 | Hypothetical protein; Provisional | 89.57 | |
| PHA03189 | 348 | UL14 tegument protein; Provisional | 89.15 | |
| PF00801 | 69 | PKD: PKD domain; InterPro: IPR000601 The PKD (Poly | 88.6 | |
| PF06832 | 89 | BiPBP_C: Penicillin-Binding Protein C-terminus Fam | 88.42 | |
| PHA03282 | 540 | envelope glycoprotein E; Provisional | 83.73 | |
| PHA03112 | 141 | IL-18 binding protein; Provisional | 82.94 | |
| PF02124 | 211 | Marek_A: Marek's disease glycoprotein A; InterPro: | 81.47 |
| >KOG3513|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.5e-39 Score=272.16 Aligned_cols=276 Identities=26% Similarity=0.474 Sum_probs=224.6
Q ss_pred cccCCcCCCeeEEEEEEecccccccccEEEEEeCCCcEEeCCCccEEecCCcEEEEEEEeeeCCCeeEEEECCeEEeecc
Q psy15128 2 ITEVKKSDEGKYQCYVQNMVGERETKPALLTVHAPPSFVVRPQDQKVGLNGIASFQCVAEGSPLPSVFWTQEGSQVLMFP 81 (292)
Q Consensus 2 i~~v~~~D~G~Y~C~~~~~~~~~~~~~~~l~v~~~p~~~~~~~~~~~~~g~~~~l~C~~~~~~~~~v~W~~~~~~~~~~~ 81 (292)
|.+++.+|+|.|+|.++|..|..... +.|.|.++|.+...+....+..|++++|.|.+.|.|.|.|.|++++..+. .
T Consensus 298 I~nv~~~D~G~Y~C~AeN~~G~~~~~-~~v~v~a~P~w~~~~~d~~~~~gs~v~~eC~a~g~P~p~v~WlkNg~pl~--~ 374 (1051)
T KOG3513|consen 298 IPNVQYEDAGEYECIAENSRGSATHS-GHVTVYAPPYWLQKPQDTEADTGSNVTLECKASGKPNPTVKWLKNGEPLE--P 374 (1051)
T ss_pred ecccCcCCCeEEEEEEecccccceee-EEEEEecCchhhcccceeEecCCCCeEEEEEecCCCCCceEEeeCCeecC--c
Confidence 78999999999999999999965555 99999999999999999999999999999999999999999999998874 2
Q ss_pred CCCcceeEEeeecEEEEccCCCCCCeEEEEEEEeCCcCeeEEEEEEEEeecCCCCCeEEeCCCCc--eecCCCeEEEEeE
Q psy15128 82 GNAYGHLHVTQEGTLRIQGVQKEDAGFFVCSALSVAGSTTVRAFLQVTSVEDTPPPIVQVGPSNQ--TLPLHSVAFLPCQ 159 (292)
Q Consensus 82 ~~~~~~~~~~~~~~l~i~~~~~~d~g~Y~C~~~~~~~~~~~~~~l~v~~~~~~~~~~~~~~~~~~--~~~~g~~v~l~C~ 159 (292)
.....+. ....+.|+|.+++..|+|.|.|.|+|..|....++.|.|... +|.+...+... .+..|..+.|.|.
T Consensus 375 ~~r~~~~-~i~~g~L~is~v~~~dsg~YQC~A~Nk~G~i~anA~L~V~a~----~P~f~~~p~~~~~~a~~g~~v~i~C~ 449 (1051)
T KOG3513|consen 375 AERDPRY-KIDDGTLIISNVQESDSGVYQCIAENKYGTIYANAELKVLAS----APVFPLNPVERKVMAVVGGTVTIDCK 449 (1051)
T ss_pred cCCCcce-EEeCCEEEEEecccccCeEEEeeeecccceEeeeeEEEEEcc----CCCCCCCccceEEEEEeCCeEEEeec
Confidence 2222223 334679999999999999999999999999999999998752 44454444433 5678999999999
Q ss_pred eccCCCCceEEEeCCeeCCCCCccEEEcCCCcEEEEeeecCCCC-----------------------------CCcceEE
Q psy15128 160 AVGSPPPHIRWYKNGNSLPPEDTRINVSSSGSLQIDVLRDDFRA-----------------------------EPKDTRV 210 (292)
Q Consensus 160 ~~~~p~~~~~W~~~~~~l~~~~~~~~~~~~~~l~i~~~~~~d~g-----------------------------~~~~~~~ 210 (292)
..+.|.|.+.|.+++.. .....++.+..+|+|.|.+++.+|+| .+....+
T Consensus 450 ~~asP~p~~~W~k~~~~-~~~~~r~~i~edGtL~I~n~t~~DaG~YtC~A~N~~G~a~~~~~L~Vkd~tri~~~P~~~~v 528 (1051)
T KOG3513|consen 450 PFASPKPKVSWLKGGEK-LLQSGRIRILEDGTLEISNVTRSDAGKYTCVAENKLGKAESTGNLIVKDATRITLAPSNTDV 528 (1051)
T ss_pred cCCCCcceEEEEcCCcc-cccCceEEECCCCcEEecccCcccCcEEEEEEEcccCccceEEEEEEecCceEEeccchhhh
Confidence 99999999999999884 34458899999999999999999999 3356667
Q ss_pred eCCCceEEEeeCCC-CCCCCeEEEeEcCeEeccCCCceEEecCCCccccccccccccccccccccceeEEEEeecccccc
Q psy15128 211 ASGETALLECGPPK-GQPEPTLHWKKNGQFIDLESSKRVSILGDPWFDSRRSRSIFGSVLGALSDDQWKLIAKNIRNQQQ 289 (292)
Q Consensus 211 ~~g~~~~l~C~~~~-~~p~~~~~W~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~~~g~y~C~a~n~~g~~~ 289 (292)
..|+.++|.|.+.. ....+.|.|.+||+.+............++. ....|.|..++..|+|.|.|+|+-...+.+
T Consensus 529 ~~g~~v~l~Ce~shD~~ld~~f~W~~nG~~id~~~~~~~~~~~~~~----~~g~L~i~nv~l~~~G~Y~C~aqT~~Ds~s 604 (1051)
T KOG3513|consen 529 KVGESVTLTCEASHDPSLDITFTWKKNGRPIDFNPDGDHFEINDGS----DSGRLTIANVSLEDSGKYTCVAQTALDSAS 604 (1051)
T ss_pred ccCceEEEEeecccCCCcceEEEEEECCEEhhccCCCCceEEeCCc----CccceEEEeeccccCceEEEEEEEeecchh
Confidence 89999999999842 2446689999999988644433322222221 113588999999999999999998776654
Q ss_pred c
Q psy15128 290 H 290 (292)
Q Consensus 290 ~ 290 (292)
.
T Consensus 605 ~ 605 (1051)
T KOG3513|consen 605 A 605 (1051)
T ss_pred c
Confidence 3
|
|
| >KOG3513|consensus | Back alignment and domain information |
|---|
| >KOG4221|consensus | Back alignment and domain information |
|---|
| >KOG4222|consensus | Back alignment and domain information |
|---|
| >PHA02785 IL-beta-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG4221|consensus | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >KOG4222|consensus | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >PHA02785 IL-beta-binding protein; Provisional | Back alignment and domain information |
|---|
| >PHA02826 IL-1 receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02826 IL-1 receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) | Back alignment and domain information |
|---|
| >cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins | Back alignment and domain information |
|---|
| >cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain | Back alignment and domain information |
|---|
| >cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein | Back alignment and domain information |
|---|
| >cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) | Back alignment and domain information |
|---|
| >cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) | Back alignment and domain information |
|---|
| >cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha | Back alignment and domain information |
|---|
| >cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd04968 Ig3_Contactin_like Third Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) | Back alignment and domain information |
|---|
| >cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins | Back alignment and domain information |
|---|
| >cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins | Back alignment and domain information |
|---|
| >cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) | Back alignment and domain information |
|---|
| >cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin | Back alignment and domain information |
|---|
| >cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins | Back alignment and domain information |
|---|
| >cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB | Back alignment and domain information |
|---|
| >cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) | Back alignment and domain information |
|---|
| >cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) | Back alignment and domain information |
|---|
| >cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins | Back alignment and domain information |
|---|
| >cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC | Back alignment and domain information |
|---|
| >cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin | Back alignment and domain information |
|---|
| >PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin | Back alignment and domain information |
|---|
| >cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins | Back alignment and domain information |
|---|
| >cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC | Back alignment and domain information |
|---|
| >cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 | Back alignment and domain information |
|---|
| >cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins | Back alignment and domain information |
|---|
| >cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) | Back alignment and domain information |
|---|
| >cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) | Back alignment and domain information |
|---|
| >cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 | Back alignment and domain information |
|---|
| >cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 | Back alignment and domain information |
|---|
| >cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein | Back alignment and domain information |
|---|
| >cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins | Back alignment and domain information |
|---|
| >cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin | Back alignment and domain information |
|---|
| >cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 | Back alignment and domain information |
|---|
| >cd04969 Ig5_Contactin_like Fifth Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin | Back alignment and domain information |
|---|
| >cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) | Back alignment and domain information |
|---|
| >cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) | Back alignment and domain information |
|---|
| >cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) | Back alignment and domain information |
|---|
| >cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >cd04969 Ig5_Contactin_like Fifth Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins | Back alignment and domain information |
|---|
| >cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC | Back alignment and domain information |
|---|
| >cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor | Back alignment and domain information |
|---|
| >cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) | Back alignment and domain information |
|---|
| >cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins | Back alignment and domain information |
|---|
| >cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins | Back alignment and domain information |
|---|
| >cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins | Back alignment and domain information |
|---|
| >cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) | Back alignment and domain information |
|---|
| >cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 | Back alignment and domain information |
|---|
| >cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) | Back alignment and domain information |
|---|
| >cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR | Back alignment and domain information |
|---|
| >cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 | Back alignment and domain information |
|---|
| >cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha | Back alignment and domain information |
|---|
| >cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) | Back alignment and domain information |
|---|
| >cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) | Back alignment and domain information |
|---|
| >cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) | Back alignment and domain information |
|---|
| >cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) | Back alignment and domain information |
|---|
| >cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 | Back alignment and domain information |
|---|
| >PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) | Back alignment and domain information |
|---|
| >cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin | Back alignment and domain information |
|---|
| >cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins | Back alignment and domain information |
|---|
| >cd04968 Ig3_Contactin_like Third Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins | Back alignment and domain information |
|---|
| >cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR | Back alignment and domain information |
|---|
| >cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) | Back alignment and domain information |
|---|
| >cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins | Back alignment and domain information |
|---|
| >cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins | Back alignment and domain information |
|---|
| >cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins | Back alignment and domain information |
|---|
| >KOG3515|consensus | Back alignment and domain information |
|---|
| >cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 | Back alignment and domain information |
|---|
| >cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) | Back alignment and domain information |
|---|
| >cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) | Back alignment and domain information |
|---|
| >cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 | Back alignment and domain information |
|---|
| >cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 | Back alignment and domain information |
|---|
| >cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor | Back alignment and domain information |
|---|
| >cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) | Back alignment and domain information |
|---|
| >cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) | Back alignment and domain information |
|---|
| >cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) | Back alignment and domain information |
|---|
| >cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) | Back alignment and domain information |
|---|
| >cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 | Back alignment and domain information |
|---|
| >cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 | Back alignment and domain information |
|---|
| >cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins | Back alignment and domain information |
|---|
| >cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) | Back alignment and domain information |
|---|
| >cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) | Back alignment and domain information |
|---|
| >cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins | Back alignment and domain information |
|---|
| >cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) | Back alignment and domain information |
|---|
| >cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) | Back alignment and domain information |
|---|
| >cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 | Back alignment and domain information |
|---|
| >cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 | Back alignment and domain information |
|---|
| >cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 | Back alignment and domain information |
|---|
| >cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins | Back alignment and domain information |
|---|
| >cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) | Back alignment and domain information |
|---|
| >cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins | Back alignment and domain information |
|---|
| >cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR | Back alignment and domain information |
|---|
| >cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins | Back alignment and domain information |
|---|
| >cd04967 Ig1_Contactin First Ig domain of contactin | Back alignment and domain information |
|---|
| >cd04970 Ig6_Contactin_like Sixth Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR | Back alignment and domain information |
|---|
| >cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) | Back alignment and domain information |
|---|
| >cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 | Back alignment and domain information |
|---|
| >cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC | Back alignment and domain information |
|---|
| >cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 | Back alignment and domain information |
|---|
| >cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB | Back alignment and domain information |
|---|
| >cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin | Back alignment and domain information |
|---|
| >cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D | Back alignment and domain information |
|---|
| >cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) | Back alignment and domain information |
|---|
| >cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin | Back alignment and domain information |
|---|
| >cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins | Back alignment and domain information |
|---|
| >cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins | Back alignment and domain information |
|---|
| >cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) | Back alignment and domain information |
|---|
| >KOG3515|consensus | Back alignment and domain information |
|---|
| >cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins | Back alignment and domain information |
|---|
| >cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) | Back alignment and domain information |
|---|
| >cd04970 Ig6_Contactin_like Sixth Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins | Back alignment and domain information |
|---|
| >cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain | Back alignment and domain information |
|---|
| >cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) | Back alignment and domain information |
|---|
| >cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins | Back alignment and domain information |
|---|
| >cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins | Back alignment and domain information |
|---|
| >cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) | Back alignment and domain information |
|---|
| >cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) | Back alignment and domain information |
|---|
| >cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins | Back alignment and domain information |
|---|
| >cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin | Back alignment and domain information |
|---|
| >cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) | Back alignment and domain information |
|---|
| >cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) | Back alignment and domain information |
|---|
| >cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins | Back alignment and domain information |
|---|
| >cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) | Back alignment and domain information |
|---|
| >cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins | Back alignment and domain information |
|---|
| >cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) | Back alignment and domain information |
|---|
| >cd04967 Ig1_Contactin First Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D | Back alignment and domain information |
|---|
| >cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins | Back alignment and domain information |
|---|
| >cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins | Back alignment and domain information |
|---|
| >cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) | Back alignment and domain information |
|---|
| >cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) | Back alignment and domain information |
|---|
| >cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) | Back alignment and domain information |
|---|
| >cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins | Back alignment and domain information |
|---|
| >cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins | Back alignment and domain information |
|---|
| >cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 | Back alignment and domain information |
|---|
| >cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) | Back alignment and domain information |
|---|
| >cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin | Back alignment and domain information |
|---|
| >cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins | Back alignment and domain information |
|---|
| >cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins | Back alignment and domain information |
|---|
| >cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) | Back alignment and domain information |
|---|
| >cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins | Back alignment and domain information |
|---|
| >cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins | Back alignment and domain information |
|---|
| >PHA03376 BARF1; Provisional | Back alignment and domain information |
|---|
| >cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 | Back alignment and domain information |
|---|
| >smart00408 IGc2 Immunoglobulin C-2 Type | Back alignment and domain information |
|---|
| >cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) | Back alignment and domain information |
|---|
| >cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) | Back alignment and domain information |
|---|
| >cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins | Back alignment and domain information |
|---|
| >cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin | Back alignment and domain information |
|---|
| >cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) | Back alignment and domain information |
|---|
| >cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) | Back alignment and domain information |
|---|
| >smart00408 IGc2 Immunoglobulin C-2 Type | Back alignment and domain information |
|---|
| >cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins | Back alignment and domain information |
|---|
| >cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) | Back alignment and domain information |
|---|
| >cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) | Back alignment and domain information |
|---|
| >PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A | Back alignment and domain information |
|---|
| >cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) | Back alignment and domain information |
|---|
| >cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins | Back alignment and domain information |
|---|
| >cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) | Back alignment and domain information |
|---|
| >cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) | Back alignment and domain information |
|---|
| >PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs | Back alignment and domain information |
|---|
| >cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 | Back alignment and domain information |
|---|
| >cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) | Back alignment and domain information |
|---|
| >cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) | Back alignment and domain information |
|---|
| >PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs | Back alignment and domain information |
|---|
| >cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) | Back alignment and domain information |
|---|
| >PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A | Back alignment and domain information |
|---|
| >cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin | Back alignment and domain information |
|---|
| >smart00409 IG Immunoglobulin | Back alignment and domain information |
|---|
| >smart00410 IG_like Immunoglobulin like | Back alignment and domain information |
|---|
| >cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B | Back alignment and domain information |
|---|
| >cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) | Back alignment and domain information |
|---|
| >cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) | Back alignment and domain information |
|---|
| >cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) | Back alignment and domain information |
|---|
| >cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) | Back alignment and domain information |
|---|
| >smart00409 IG Immunoglobulin | Back alignment and domain information |
|---|
| >smart00410 IG_like Immunoglobulin like | Back alignment and domain information |
|---|
| >cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) | Back alignment and domain information |
|---|
| >cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) | Back alignment and domain information |
|---|
| >cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins | Back alignment and domain information |
|---|
| >cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins | Back alignment and domain information |
|---|
| >cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) | Back alignment and domain information |
|---|
| >cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) | Back alignment and domain information |
|---|
| >cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) | Back alignment and domain information |
|---|
| >PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C | Back alignment and domain information |
|---|
| >cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan | Back alignment and domain information |
|---|
| >cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) | Back alignment and domain information |
|---|
| >cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins | Back alignment and domain information |
|---|
| >cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) | Back alignment and domain information |
|---|
| >cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) | Back alignment and domain information |
|---|
| >cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins | Back alignment and domain information |
|---|
| >cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) | Back alignment and domain information |
|---|
| >cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) | Back alignment and domain information |
|---|
| >cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins | Back alignment and domain information |
|---|
| >cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins | Back alignment and domain information |
|---|
| >cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) | Back alignment and domain information |
|---|
| >cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B | Back alignment and domain information |
|---|
| >cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins | Back alignment and domain information |
|---|
| >cd00098 IgC Immunoglobulin Constant domain | Back alignment and domain information |
|---|
| >cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like | Back alignment and domain information |
|---|
| >cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain | Back alignment and domain information |
|---|
| >cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins | Back alignment and domain information |
|---|
| >cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) | Back alignment and domain information |
|---|
| >cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan | Back alignment and domain information |
|---|
| >cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins | Back alignment and domain information |
|---|
| >cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain | Back alignment and domain information |
|---|
| >PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C | Back alignment and domain information |
|---|
| >cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins | Back alignment and domain information |
|---|
| >cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) | Back alignment and domain information |
|---|
| >PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) | Back alignment and domain information |
|---|
| >cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain | Back alignment and domain information |
|---|
| >PHA03376 BARF1; Provisional | Back alignment and domain information |
|---|
| >cd00099 IgV Immunoglobulin variable domain (IgV) | Back alignment and domain information |
|---|
| >cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI | Back alignment and domain information |
|---|
| >cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins | Back alignment and domain information |
|---|
| >cd00098 IgC Immunoglobulin Constant domain | Back alignment and domain information |
|---|
| >cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 | Back alignment and domain information |
|---|
| >cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins | Back alignment and domain information |
|---|
| >cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins | Back alignment and domain information |
|---|
| >cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) | Back alignment and domain information |
|---|
| >cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican | Back alignment and domain information |
|---|
| >cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain | Back alignment and domain information |
|---|
| >cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) | Back alignment and domain information |
|---|
| >cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain | Back alignment and domain information |
|---|
| >PHA02987 Ig domain OX-2-like protein; Provisional | Back alignment and domain information |
|---|
| >cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins | Back alignment and domain information |
|---|
| >PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd00099 IgV Immunoglobulin variable domain (IgV) | Back alignment and domain information |
|---|
| >cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) | Back alignment and domain information |
|---|
| >cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like | Back alignment and domain information |
|---|
| >cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins | Back alignment and domain information |
|---|
| >cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain | Back alignment and domain information |
|---|
| >PHA03270 envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >PHA03269 envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain | Back alignment and domain information |
|---|
| >cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) | Back alignment and domain information |
|---|
| >cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins | Back alignment and domain information |
|---|
| >cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain | Back alignment and domain information |
|---|
| >cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins | Back alignment and domain information |
|---|
| >cd07699 IgC_L Immunoglobulin Constant domain | Back alignment and domain information |
|---|
| >cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) | Back alignment and domain information |
|---|
| >cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins | Back alignment and domain information |
|---|
| >cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain | Back alignment and domain information |
|---|
| >smart00407 IGc1 Immunoglobulin C-Type | Back alignment and domain information |
|---|
| >cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) | Back alignment and domain information |
|---|
| >PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain | Back alignment and domain information |
|---|
| >cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE) | Back alignment and domain information |
|---|
| >cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) | Back alignment and domain information |
|---|
| >cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) | Back alignment and domain information |
|---|
| >cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI | Back alignment and domain information |
|---|
| >cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain | Back alignment and domain information |
|---|
| >cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE) | Back alignment and domain information |
|---|
| >cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) | Back alignment and domain information |
|---|
| >PHA03270 envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain | Back alignment and domain information |
|---|
| >PHA03273 envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins | Back alignment and domain information |
|---|
| >cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain | Back alignment and domain information |
|---|
| >cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) | Back alignment and domain information |
|---|
| >cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain | Back alignment and domain information |
|---|
| >cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin | Back alignment and domain information |
|---|
| >cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain | Back alignment and domain information |
|---|
| >cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain | Back alignment and domain information |
|---|
| >cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain | Back alignment and domain information |
|---|
| >cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins | Back alignment and domain information |
|---|
| >smart00407 IGc1 Immunoglobulin C-Type | Back alignment and domain information |
|---|
| >PF07654 C1-set: Immunoglobulin C1-set domain; InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd00096 Ig Immunoglobulin domain | Back alignment and domain information |
|---|
| >cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain | Back alignment and domain information |
|---|
| >cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan | Back alignment and domain information |
|---|
| >cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain | Back alignment and domain information |
|---|
| >cd07699 IgC_L Immunoglobulin Constant domain | Back alignment and domain information |
|---|
| >cd00096 Ig Immunoglobulin domain | Back alignment and domain information |
|---|
| >cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin | Back alignment and domain information |
|---|
| >PHA03273 envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) | Back alignment and domain information |
|---|
| >cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins | Back alignment and domain information |
|---|
| >cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin | Back alignment and domain information |
|---|
| >PHA03269 envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins | Back alignment and domain information |
|---|
| >cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins | Back alignment and domain information |
|---|
| >cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins | Back alignment and domain information |
|---|
| >cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins | Back alignment and domain information |
|---|
| >PHA02987 Ig domain OX-2-like protein; Provisional | Back alignment and domain information |
|---|
| >cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin | Back alignment and domain information |
|---|
| >cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin | Back alignment and domain information |
|---|
| >cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain | Back alignment and domain information |
|---|
| >cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin | Back alignment and domain information |
|---|
| >PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >PHA03271 envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins | Back alignment and domain information |
|---|
| >cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain | Back alignment and domain information |
|---|
| >cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins | Back alignment and domain information |
|---|
| >cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain | Back alignment and domain information |
|---|
| >cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain | Back alignment and domain information |
|---|
| >cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain | Back alignment and domain information |
|---|
| >cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin | Back alignment and domain information |
|---|
| >smart00406 IGv Immunoglobulin V-Type | Back alignment and domain information |
|---|
| >cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins | Back alignment and domain information |
|---|
| >cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 | Back alignment and domain information |
|---|
| >cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) | Back alignment and domain information |
|---|
| >cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain | Back alignment and domain information |
|---|
| >KOG1480|consensus | Back alignment and domain information |
|---|
| >cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins | Back alignment and domain information |
|---|
| >PF07654 C1-set: Immunoglobulin C1-set domain; InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain | Back alignment and domain information |
|---|
| >cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin | Back alignment and domain information |
|---|
| >cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain | Back alignment and domain information |
|---|
| >cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain | Back alignment and domain information |
|---|
| >TIGR00864 PCC polycystin cation channel protein | Back alignment and domain information |
|---|
| >cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain | Back alignment and domain information |
|---|
| >cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin | Back alignment and domain information |
|---|
| >PHA02633 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins | Back alignment and domain information |
|---|
| >cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin | Back alignment and domain information |
|---|
| >cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan | Back alignment and domain information |
|---|
| >TIGR00864 PCC polycystin cation channel protein | Back alignment and domain information |
|---|
| >cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins | Back alignment and domain information |
|---|
| >PHA02633 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican | Back alignment and domain information |
|---|
| >cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains | Back alignment and domain information |
|---|
| >cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain | Back alignment and domain information |
|---|
| >cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) | Back alignment and domain information |
|---|
| >smart00406 IGv Immunoglobulin V-Type | Back alignment and domain information |
|---|
| >PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] | Back alignment and domain information |
|---|
| >cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins | Back alignment and domain information |
|---|
| >PHA03271 envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains | Back alignment and domain information |
|---|
| >PHA02982 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4597|consensus | Back alignment and domain information |
|---|
| >PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] | Back alignment and domain information |
|---|
| >KOG0613|consensus | Back alignment and domain information |
|---|
| >PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals | Back alignment and domain information |
|---|
| >PHA03042 CD47-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02914 Immunoglobulin-like domain protein; Provisional | Back alignment and domain information |
|---|
| >PHA03042 CD47-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02982 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) | Back alignment and domain information |
|---|
| >KOG1480|consensus | Back alignment and domain information |
|---|
| >PHA03052 Hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells | Back alignment and domain information |
|---|
| >PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals | Back alignment and domain information |
|---|
| >PHA02914 Immunoglobulin-like domain protein; Provisional | Back alignment and domain information |
|---|
| >cd05890 Ig2_Nectin-1_like Second immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins | Back alignment and domain information |
|---|
| >KOG4597|consensus | Back alignment and domain information |
|---|
| >PHA02865 MHC-like TNF binding protein; Provisional | Back alignment and domain information |
|---|
| >PHA02865 MHC-like TNF binding protein; Provisional | Back alignment and domain information |
|---|
| >PF06328 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) [] | Back alignment and domain information |
|---|
| >KOG0613|consensus | Back alignment and domain information |
|---|
| >PF06328 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) [] | Back alignment and domain information |
|---|
| >PF02124 Marek_A: Marek's disease glycoprotein A; InterPro: IPR001038 Equid herpesvirus 1 (Equine herpesvirus 1, EHV-1) glycoprotein 13 (EHV-1 gp13) has the characteristic features of a membrane-spanning protein: an N-terminal signal sequence; a hydrophobic membrane anchor region; a charged C-terminal cytoplasmic tail; and an exterior domain with nine potential N-glycosylation sites [] | Back alignment and domain information |
|---|
| >PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells | Back alignment and domain information |
|---|
| >PF05790 C2-set: Immunoglobulin C2-set domain; InterPro: IPR008424 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >PHA03052 Hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA03189 UL14 tegument protein; Provisional | Back alignment and domain information |
|---|
| >PF00801 PKD: PKD domain; InterPro: IPR000601 The PKD (Polycystic Kidney Disease) domain was first identified in the Polycystic Kidney Disease protein, polycystin-1 (PDK1 gene), and contains an Ig-like fold consisting of a beta-sandwich of seven strands in two sheets with a Greek key topology, although some members have additional strands [] | Back alignment and domain information |
|---|
| >PF06832 BiPBP_C: Penicillin-Binding Protein C-terminus Family; InterPro: IPR009647 This conserved region of approximately 90 residues is found in a sub-group of bacterial Penicillin-Binding Proteins (PBPs) | Back alignment and domain information |
|---|
| >PHA03282 envelope glycoprotein E; Provisional | Back alignment and domain information |
|---|
| >PHA03112 IL-18 binding protein; Provisional | Back alignment and domain information |
|---|
| >PF02124 Marek_A: Marek's disease glycoprotein A; InterPro: IPR001038 Equid herpesvirus 1 (Equine herpesvirus 1, EHV-1) glycoprotein 13 (EHV-1 gp13) has the characteristic features of a membrane-spanning protein: an N-terminal signal sequence; a hydrophobic membrane anchor region; a charged C-terminal cytoplasmic tail; and an exterior domain with nine potential N-glycosylation sites [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 292 | ||||
| 2vra_A | 208 | Drosophila Robo Ig1-2 (Monoclinic Form) Length = 20 | 8e-20 | ||
| 2vr9_A | 217 | Drosophila Robo Ig1-2 (Tetragonal Form) Length = 21 | 8e-20 | ||
| 2v9q_A | 212 | First And Second Ig Domains From Human Robo1 Length | 9e-18 | ||
| 3dmk_A | 816 | Crystal Structure Of Down Syndrome Cell Adhesion Mo | 1e-17 | ||
| 2yd1_A | 212 | Crystal Structure Of The N-Terminal Ig1-2 Module Of | 2e-16 | ||
| 3pxj_A | 210 | Tandem Ig Repeats Of Dlar Length = 210 | 2e-16 | ||
| 2yd4_A | 210 | Crystal Structure Of The N-Terminal Ig1-2 Module Of | 2e-14 | ||
| 2yd5_A | 214 | Crystal Structure Of The N-Terminal Ig1-2 Module Of | 3e-14 | ||
| 2yd2_A | 214 | Crystal Structure Of The N-Terminal Ig1-2 Module Of | 3e-14 | ||
| 2yd3_A | 202 | Crystal Structure Of The N-Terminal Ig1-2 Module Of | 3e-14 | ||
| 2yd9_A | 304 | Crystal Structure Of The N-Terminal Ig1-3 Module Of | 7e-14 | ||
| 3pxh_A | 201 | Tandem Ig Domains Of Tyrosine Phosphatase Lar Lengt | 6e-13 | ||
| 2yd6_A | 212 | Crystal Structure Of The N-Terminal Ig1-2 Module Of | 4e-12 | ||
| 3b43_A | 570 | I-band Fragment I65-i70 From Titin Length = 570 | 7e-12 | ||
| 3kld_A | 384 | Ptprg Cntn4 Complex Length = 384 | 2e-11 | ||
| 3jxa_A | 383 | Immunoglobulin Domains 1-4 Of Mouse Cntn4 Length = | 2e-11 | ||
| 3laf_A | 403 | Structure Of Dcc, A Netrin-1 Receptor Length = 403 | 8e-11 | ||
| 3laf_A | 403 | Structure Of Dcc, A Netrin-1 Receptor Length = 403 | 1e-09 | ||
| 2v5r_A | 391 | Structural Basis For Dscam Isoform Specificity Leng | 8e-11 | ||
| 2v5r_A | 391 | Structural Basis For Dscam Isoform Specificity Leng | 5e-08 | ||
| 2v5m_A | 388 | Structural Basis For Dscam Isoform Specificity Leng | 9e-11 | ||
| 2v5m_A | 388 | Structural Basis For Dscam Isoform Specificity Leng | 2e-07 | ||
| 2v5s_A | 394 | Structural Basis For Dscam Isoform Specificity Leng | 9e-11 | ||
| 2v5s_A | 394 | Structural Basis For Dscam Isoform Specificity Leng | 2e-07 | ||
| 2rjm_A | 284 | 3ig Structure Of Titin Domains I67-I69 E-To-A Mutat | 1e-10 | ||
| 2rjm_A | 284 | 3ig Structure Of Titin Domains I67-I69 E-To-A Mutat | 4e-10 | ||
| 2iep_A | 192 | Crystal Structure Of Immunoglobulin-Like Domains 1 | 1e-10 | ||
| 2edj_A | 100 | Solution Structure Of The Fifth Ig-Like Domain From | 3e-10 | ||
| 2rik_A | 284 | I-Band Fragment I67-I69 From Titin Length = 284 | 3e-10 | ||
| 2rik_A | 284 | I-Band Fragment I67-I69 From Titin Length = 284 | 5e-10 | ||
| 2wim_A | 291 | Crystal Structure Of Ncam2 Ig1-3 Length = 291 | 8e-10 | ||
| 3p3y_A | 404 | Crystal Structure Of Neurofascin Homophilic Adhesio | 2e-09 | ||
| 1cs6_A | 382 | N-terminal Fragment Of Axonin-1 From Chicken Length | 3e-09 | ||
| 1cs6_A | 382 | N-terminal Fragment Of Axonin-1 From Chicken Length | 6e-08 | ||
| 1qz1_A | 291 | Crystal Structure Of The Ig 1-2-3 Fragment Of Ncam | 2e-08 | ||
| 1qz1_A | 291 | Crystal Structure Of The Ig 1-2-3 Fragment Of Ncam | 8e-08 | ||
| 3grw_A | 241 | Fgfr3 In Complex With A Fab Length = 241 | 5e-08 | ||
| 2xy1_A | 192 | Crystal Structure Of Ncam2 Ig3-4 Length = 192 | 5e-08 | ||
| 2kkq_A | 116 | Solution Nmr Structure Of The Ig-Like C2-Type 2 Dom | 9e-08 | ||
| 1ry7_B | 334 | Crystal Structure Of The 3 Ig Form Of Fgfr3c In Com | 9e-08 | ||
| 1cvs_C | 225 | Crystal Structure Of A Dimeric Fgf2-Fgfr1 Complex L | 1e-07 | ||
| 3ojv_C | 226 | Crystal Structure Of Fgf1 Complexed With The Ectodo | 1e-07 | ||
| 1evt_C | 225 | Crystal Structure Of Fgf1 In Complex With The Extra | 1e-07 | ||
| 1bih_A | 395 | Crystal Structure Of The Insect Immune Protein Hemo | 2e-07 | ||
| 3v2a_R | 772 | Vegfr-2VEGF-A Complex Structure Length = 772 | 4e-07 | ||
| 3v2a_R | 772 | Vegfr-2VEGF-A Complex Structure Length = 772 | 4e-06 | ||
| 2v5t_A | 189 | Crystal Structure Of Ncam2 Ig2-3 Length = 189 | 4e-07 | ||
| 2v5t_A | 189 | Crystal Structure Of Ncam2 Ig2-3 Length = 189 | 1e-06 | ||
| 2om5_A | 381 | N-Terminal Fragment Of Human Tax1 Length = 381 | 5e-07 | ||
| 2om5_A | 381 | N-Terminal Fragment Of Human Tax1 Length = 381 | 7e-07 | ||
| 2c5d_C | 195 | Structure Of A Minimal Gas6-Axl Complex Length = 19 | 5e-07 | ||
| 2eo9_A | 118 | Solution Structure Of The Fifth Ig-Like Domain From | 1e-06 | ||
| 2eo9_A | 118 | Solution Structure Of The Fifth Ig-Like Domain From | 2e-06 | ||
| 1e07_A | 642 | Model Of Human Carcinoembryonic Antigen By Homology | 2e-06 | ||
| 3v6b_R | 424 | Vegfr-2VEGF-E Complex Structure Length = 424 | 4e-06 | ||
| 1ktk_E | 247 | Complex Of Streptococcal Pyrogenic Enterotoxin C (S | 8e-06 | ||
| 3oj2_C | 231 | Crystal Structure Of Fgf1 Complexed With The Ectodo | 8e-06 | ||
| 3s97_C | 201 | Ptprz Cntn1 Complex Length = 201 | 1e-05 | ||
| 1ev2_E | 220 | Crystal Structure Of Fgf2 In Complex With The Extra | 1e-05 | ||
| 1e0o_B | 219 | Crystal Structure Of A Ternary Fgf1-Fgfr2-Heparin C | 2e-05 | ||
| 2xyc_A | 291 | Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 | 2e-05 | ||
| 2jll_A | 389 | Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 | 2e-05 | ||
| 3hg1_E | 244 | Germline-Governed Recognition Of A Cancer Epitope B | 2e-05 | ||
| 1ii4_E | 220 | Crystal Structure Of Ser252trp Apert Mutant Fgf Rec | 4e-05 | ||
| 3k0w_A | 218 | Crystal Structure Of The Tandem Ig-Like C2-Type 2 D | 4e-05 | ||
| 3ojm_B | 231 | Crystal Structure Of Fgf1 Complexed With The Ectodo | 6e-05 | ||
| 2fdb_P | 220 | Crystal Structure Of Fibroblast Growth Factor (Fgf) | 6e-05 | ||
| 1iil_E | 220 | Crystal Structure Of Pro253arg Apert Mutant Fgf Rec | 6e-05 | ||
| 1rhf_A | 182 | Crystal Structure Of Human Tyro3-D1d2 Length = 182 | 6e-05 | ||
| 3kvq_A | 108 | Crystal Structure Of Vegfr2 Extracellular Domain D7 | 7e-05 | ||
| 2id5_A | 477 | Crystal Structure Of The Lingo-1 Ectodomain Length | 7e-05 | ||
| 3puc_A | 99 | Atomic Resolution Structure Of Titin Domain M7 Leng | 1e-04 | ||
| 2wwk_O | 109 | Crystal Structure Of The Titin M10-Obscurin Like 1 | 1e-04 | ||
| 1nun_B | 230 | Crystal Structure Analysis Of The Fgf10-fgfr2b Comp | 1e-04 | ||
| 1djs_A | 216 | Ligand-binding Portion Of Fibroblast Growth Factor | 2e-04 | ||
| 3lcy_A | 197 | Titin Ig Tandem Domains A164-A165 Length = 197 | 2e-04 | ||
| 1u2h_A | 99 | X-Ray Structure Of The N-Terminally Truncated Human | 3e-04 | ||
| 2v9t_A | 117 | Complex Between The Second Lrr Domain Of Slit2 And | 3e-04 | ||
| 2a38_A | 194 | Crystal Structure Of The N-Terminus Of Titin Length | 4e-04 | ||
| 1ya5_A | 201 | Crystal Structure Of The Titin Domains Z1z2 In Comp | 4e-04 | ||
| 2dl9_A | 103 | Solution Structure Of The Ig-Like Domain Of Human L | 5e-04 | ||
| 3o4l_E | 245 | Genetic And Structural Basis For Selection Of A Ubi | 5e-04 | ||
| 1koa_A | 491 | Twitchin Kinase Fragment (C.Elegans), Autoregulated | 5e-04 | ||
| 3zyo_A | 411 | Crystal Structure Of The N-Terminal Leucine Rich Re | 7e-04 | ||
| 3uto_A | 573 | Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- | 7e-04 | ||
| 3zyj_A | 440 | Netring1 In Complex With Ngl1 Length = 440 | 7e-04 | ||
| 1ymm_E | 249 | TcrHLA-Dr2bMBP-Peptide Complex Length = 249 | 8e-04 | ||
| 1fhg_A | 154 | High Resolution Refinement Of Telokin Length = 154 | 9e-04 |
| >pdb|2VRA|A Chain A, Drosophila Robo Ig1-2 (Monoclinic Form) Length = 208 | Back alignment and structure |
|
| >pdb|2VR9|A Chain A, Drosophila Robo Ig1-2 (Tetragonal Form) Length = 217 | Back alignment and structure |
| >pdb|2V9Q|A Chain A, First And Second Ig Domains From Human Robo1 Length = 212 | Back alignment and structure |
| >pdb|3DMK|A Chain A, Crystal Structure Of Down Syndrome Cell Adhesion Molecule (Dscam) Isoform 1.30.30, N-Terminal Eight Ig Domains Length = 816 | Back alignment and structure |
| >pdb|2YD1|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Drosophila Receptor Protein Tyrosine Phosphatase Dlar Length = 212 | Back alignment and structure |
| >pdb|3PXJ|A Chain A, Tandem Ig Repeats Of Dlar Length = 210 | Back alignment and structure |
| >pdb|2YD4|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Chicken Receptor Protein Tyrosine Phosphatase Sigma Length = 210 | Back alignment and structure |
| >pdb|2YD5|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Lar Length = 214 | Back alignment and structure |
| >pdb|2YD2|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 214 | Back alignment and structure |
| >pdb|2YD3|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 202 | Back alignment and structure |
| >pdb|2YD9|A Chain A, Crystal Structure Of The N-Terminal Ig1-3 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 304 | Back alignment and structure |
| >pdb|3PXH|A Chain A, Tandem Ig Domains Of Tyrosine Phosphatase Lar Length = 201 | Back alignment and structure |
| >pdb|2YD6|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Delta Length = 212 | Back alignment and structure |
| >pdb|3B43|A Chain A, I-band Fragment I65-i70 From Titin Length = 570 | Back alignment and structure |
| >pdb|3KLD|A Chain A, Ptprg Cntn4 Complex Length = 384 | Back alignment and structure |
| >pdb|3JXA|A Chain A, Immunoglobulin Domains 1-4 Of Mouse Cntn4 Length = 383 | Back alignment and structure |
| >pdb|3LAF|A Chain A, Structure Of Dcc, A Netrin-1 Receptor Length = 403 | Back alignment and structure |
| >pdb|3LAF|A Chain A, Structure Of Dcc, A Netrin-1 Receptor Length = 403 | Back alignment and structure |
| >pdb|2V5R|A Chain A, Structural Basis For Dscam Isoform Specificity Length = 391 | Back alignment and structure |
| >pdb|2V5R|A Chain A, Structural Basis For Dscam Isoform Specificity Length = 391 | Back alignment and structure |
| >pdb|2V5M|A Chain A, Structural Basis For Dscam Isoform Specificity Length = 388 | Back alignment and structure |
| >pdb|2V5M|A Chain A, Structural Basis For Dscam Isoform Specificity Length = 388 | Back alignment and structure |
| >pdb|2V5S|A Chain A, Structural Basis For Dscam Isoform Specificity Length = 394 | Back alignment and structure |
| >pdb|2V5S|A Chain A, Structural Basis For Dscam Isoform Specificity Length = 394 | Back alignment and structure |
| >pdb|2RJM|A Chain A, 3ig Structure Of Titin Domains I67-I69 E-To-A Mutated Variant Length = 284 | Back alignment and structure |
| >pdb|2RJM|A Chain A, 3ig Structure Of Titin Domains I67-I69 E-To-A Mutated Variant Length = 284 | Back alignment and structure |
| >pdb|2IEP|A Chain A, Crystal Structure Of Immunoglobulin-Like Domains 1 And 2 Of The Receptor Tyrosine Kinase Musk Length = 192 | Back alignment and structure |
| >pdb|2EDJ|A Chain A, Solution Structure Of The Fifth Ig-Like Domain From Human Roundabout Homolog 2 Length = 100 | Back alignment and structure |
| >pdb|2RIK|A Chain A, I-Band Fragment I67-I69 From Titin Length = 284 | Back alignment and structure |
| >pdb|2RIK|A Chain A, I-Band Fragment I67-I69 From Titin Length = 284 | Back alignment and structure |
| >pdb|2WIM|A Chain A, Crystal Structure Of Ncam2 Ig1-3 Length = 291 | Back alignment and structure |
| >pdb|3P3Y|A Chain A, Crystal Structure Of Neurofascin Homophilic Adhesion Complex In Space Group P6522 Length = 404 | Back alignment and structure |
| >pdb|1CS6|A Chain A, N-terminal Fragment Of Axonin-1 From Chicken Length = 382 | Back alignment and structure |
| >pdb|1CS6|A Chain A, N-terminal Fragment Of Axonin-1 From Chicken Length = 382 | Back alignment and structure |
| >pdb|1QZ1|A Chain A, Crystal Structure Of The Ig 1-2-3 Fragment Of Ncam Length = 291 | Back alignment and structure |
| >pdb|1QZ1|A Chain A, Crystal Structure Of The Ig 1-2-3 Fragment Of Ncam Length = 291 | Back alignment and structure |
| >pdb|3GRW|A Chain A, Fgfr3 In Complex With A Fab Length = 241 | Back alignment and structure |
| >pdb|2XY1|A Chain A, Crystal Structure Of Ncam2 Ig3-4 Length = 192 | Back alignment and structure |
| >pdb|2KKQ|A Chain A, Solution Nmr Structure Of The Ig-Like C2-Type 2 Domain Of Human Myotilin. Northeast Structural Genomics Target Hr3158 Length = 116 | Back alignment and structure |
| >pdb|1RY7|B Chain B, Crystal Structure Of The 3 Ig Form Of Fgfr3c In Complex With Fgf1 Length = 334 | Back alignment and structure |
| >pdb|1CVS|C Chain C, Crystal Structure Of A Dimeric Fgf2-Fgfr1 Complex Length = 225 | Back alignment and structure |
| >pdb|3OJV|C Chain C, Crystal Structure Of Fgf1 Complexed With The Ectodomain Of Fgfr1c Exhibiting An Ordered Ligand Specificity-Determining Betac'-Betae Loop Length = 226 | Back alignment and structure |
| >pdb|1EVT|C Chain C, Crystal Structure Of Fgf1 In Complex With The Extracellular Ligand Binding Domain Of Fgf Receptor 1 (Fgfr1) Length = 225 | Back alignment and structure |
| >pdb|1BIH|A Chain A, Crystal Structure Of The Insect Immune Protein Hemolin: A New Domain Arrangement With Implications For Homophilic Adhesion Length = 395 | Back alignment and structure |
| >pdb|3V2A|R Chain R, Vegfr-2VEGF-A Complex Structure Length = 772 | Back alignment and structure |
| >pdb|3V2A|R Chain R, Vegfr-2VEGF-A Complex Structure Length = 772 | Back alignment and structure |
| >pdb|2V5T|A Chain A, Crystal Structure Of Ncam2 Ig2-3 Length = 189 | Back alignment and structure |
| >pdb|2V5T|A Chain A, Crystal Structure Of Ncam2 Ig2-3 Length = 189 | Back alignment and structure |
| >pdb|2OM5|A Chain A, N-Terminal Fragment Of Human Tax1 Length = 381 | Back alignment and structure |
| >pdb|2OM5|A Chain A, N-Terminal Fragment Of Human Tax1 Length = 381 | Back alignment and structure |
| >pdb|2C5D|C Chain C, Structure Of A Minimal Gas6-Axl Complex Length = 195 | Back alignment and structure |
| >pdb|2EO9|A Chain A, Solution Structure Of The Fifth Ig-Like Domain From Human Roundabout Homo1 Length = 118 | Back alignment and structure |
| >pdb|2EO9|A Chain A, Solution Structure Of The Fifth Ig-Like Domain From Human Roundabout Homo1 Length = 118 | Back alignment and structure |
| >pdb|1E07|A Chain A, Model Of Human Carcinoembryonic Antigen By Homology Modelling And Curve-Fitting To Experimental Solution Scattering Data Length = 642 | Back alignment and structure |
| >pdb|3V6B|R Chain R, Vegfr-2VEGF-E Complex Structure Length = 424 | Back alignment and structure |
| >pdb|1KTK|E Chain E, Complex Of Streptococcal Pyrogenic Enterotoxin C (Spec) With A Human T Cell Receptor Beta Chain (Vbeta2.1) Length = 247 | Back alignment and structure |
| >pdb|3OJ2|C Chain C, Crystal Structure Of Fgf1 Complexed With The Ectodomain Of Fgfr2b Harboring The A172f Pfeiffer Syndrome Mutation Length = 231 | Back alignment and structure |
| >pdb|3S97|C Chain C, Ptprz Cntn1 Complex Length = 201 | Back alignment and structure |
| >pdb|1EV2|E Chain E, Crystal Structure Of Fgf2 In Complex With The Extracellular Ligand Binding Domain Of Fgf Receptor 2 (Fgfr2) Length = 220 | Back alignment and structure |
| >pdb|1E0O|B Chain B, Crystal Structure Of A Ternary Fgf1-Fgfr2-Heparin Complex Length = 219 | Back alignment and structure |
| >pdb|2XYC|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 | Back alignment and structure |
| >pdb|2JLL|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 | Back alignment and structure |
| >pdb|3HG1|E Chain E, Germline-Governed Recognition Of A Cancer Epitope By An Immunodominant Human T Cell Receptor Length = 244 | Back alignment and structure |
| >pdb|1II4|E Chain E, Crystal Structure Of Ser252trp Apert Mutant Fgf Receptor 2 (Fgfr2) In Complex With Fgf2 Length = 220 | Back alignment and structure |
| >pdb|3K0W|A Chain A, Crystal Structure Of The Tandem Ig-Like C2-Type 2 Domains Of The Human Mucosa-Associated Lymphoid Tissue Lymphoma Translocation Protein 1 Length = 218 | Back alignment and structure |
| >pdb|3OJM|B Chain B, Crystal Structure Of Fgf1 Complexed With The Ectodomain Of Fgfr2b Harboring P253r Apert Mutation Length = 231 | Back alignment and structure |
| >pdb|2FDB|P Chain P, Crystal Structure Of Fibroblast Growth Factor (Fgf)8b In Complex With Fgf Receptor (Fgfr) 2c Length = 220 | Back alignment and structure |
| >pdb|1IIL|E Chain E, Crystal Structure Of Pro253arg Apert Mutant Fgf Receptor 2 (Fgfr2) In Complex With Fgf2 Length = 220 | Back alignment and structure |
| >pdb|1RHF|A Chain A, Crystal Structure Of Human Tyro3-D1d2 Length = 182 | Back alignment and structure |
| >pdb|3KVQ|A Chain A, Crystal Structure Of Vegfr2 Extracellular Domain D7 Length = 108 | Back alignment and structure |
| >pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 | Back alignment and structure |
| >pdb|3PUC|A Chain A, Atomic Resolution Structure Of Titin Domain M7 Length = 99 | Back alignment and structure |
| >pdb|2WWK|O Chain O, Crystal Structure Of The Titin M10-Obscurin Like 1 Ig F17r Mutant Complex Length = 109 | Back alignment and structure |
| >pdb|1NUN|B Chain B, Crystal Structure Analysis Of The Fgf10-fgfr2b Complex Length = 230 | Back alignment and structure |
| >pdb|1DJS|A Chain A, Ligand-binding Portion Of Fibroblast Growth Factor Receptor 2 In Complex With Fgf1 Length = 216 | Back alignment and structure |
| >pdb|3LCY|A Chain A, Titin Ig Tandem Domains A164-A165 Length = 197 | Back alignment and structure |
| >pdb|1U2H|A Chain A, X-Ray Structure Of The N-Terminally Truncated Human Apep-1 Length = 99 | Back alignment and structure |
| >pdb|2V9T|A Chain A, Complex Between The Second Lrr Domain Of Slit2 And The First Ig Domain From Robo1 Length = 117 | Back alignment and structure |
| >pdb|2A38|A Chain A, Crystal Structure Of The N-Terminus Of Titin Length = 194 | Back alignment and structure |
| >pdb|1YA5|A Chain A, Crystal Structure Of The Titin Domains Z1z2 In Complex With Telethonin Length = 201 | Back alignment and structure |
| >pdb|2DL9|A Chain A, Solution Structure Of The Ig-Like Domain Of Human Leucine- Rich Repeat-Containing Protein 4 Length = 103 | Back alignment and structure |
| >pdb|3O4L|E Chain E, Genetic And Structural Basis For Selection Of A Ubiquitous T Cell Receptor Deployed In Epstein-Barr Virus Length = 245 | Back alignment and structure |
| >pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 | Back alignment and structure |
| >pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 | Back alignment and structure |
| >pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 | Back alignment and structure |
| >pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 | Back alignment and structure |
| >pdb|1YMM|E Chain E, TcrHLA-Dr2bMBP-Peptide Complex Length = 249 | Back alignment and structure |
| >pdb|1FHG|A Chain A, High Resolution Refinement Of Telokin Length = 154 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 292 | |||
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 4e-65 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 6e-54 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 3e-44 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 1e-34 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 1e-64 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 5e-60 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 7e-52 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 2e-48 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 2e-43 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 5e-28 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 1e-60 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 4e-50 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 2e-49 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 4e-47 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 5e-46 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 4e-45 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 4e-36 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 1e-30 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 3e-27 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 7e-57 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 2e-44 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 3e-38 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 4e-22 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 6e-56 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 1e-47 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 2e-31 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 9e-55 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 5e-53 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 1e-35 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 8e-54 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 4e-47 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 2e-40 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 3e-33 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 6e-24 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 1e-53 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 9e-47 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 2e-33 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 2e-31 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 4e-23 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 4e-53 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 4e-48 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 2e-35 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 5e-34 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 2e-22 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 3e-52 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 1e-48 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 3e-32 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 6e-24 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 4e-06 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 3e-52 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 3e-41 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 2e-40 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 1e-36 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 5e-32 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 2e-25 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 9e-52 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 4e-41 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 1e-37 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 1e-35 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 4e-25 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 6e-49 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 9e-44 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 9e-32 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 1e-29 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 1e-19 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 3e-47 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 8e-40 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 3e-30 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 7e-23 | |
| 2v5t_A | 189 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; p | 9e-44 | |
| 2v5t_A | 189 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; p | 3e-31 | |
| 2v5t_A | 189 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; p | 2e-10 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 2e-43 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 8e-38 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 6e-37 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 5e-34 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 2e-31 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 1e-30 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 2e-26 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 8e-13 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 1e-05 | |
| 2a38_A | 194 | Titin; Z1Z2, structural protein; 2.00A {Homo sapie | 2e-43 | |
| 2a38_A | 194 | Titin; Z1Z2, structural protein; 2.00A {Homo sapie | 4e-34 | |
| 2a38_A | 194 | Titin; Z1Z2, structural protein; 2.00A {Homo sapie | 2e-07 | |
| 2yd1_A | 212 | Tyrosine-protein phosphatase LAR; hydrolase; 1.80A | 3e-43 | |
| 2yd1_A | 212 | Tyrosine-protein phosphatase LAR; hydrolase; 1.80A | 8e-29 | |
| 2yd1_A | 212 | Tyrosine-protein phosphatase LAR; hydrolase; 1.80A | 2e-24 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 4e-42 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 2e-36 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 3e-29 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 1e-07 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 2e-41 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 3e-24 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 5e-07 | |
| 2yd6_A | 212 | PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa | 4e-41 | |
| 2yd6_A | 212 | PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa | 2e-30 | |
| 2yd6_A | 212 | PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa | 2e-22 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 1e-40 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 8e-33 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 2e-23 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 1e-40 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 2e-33 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 3e-31 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 2e-40 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 2e-35 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 4e-35 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 1e-32 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 4e-23 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 3e-14 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 6e-05 | |
| 1epf_A | 191 | NCAM, protein (neural cell adhesion molecule); imm | 7e-40 | |
| 1epf_A | 191 | NCAM, protein (neural cell adhesion molecule); imm | 2e-38 | |
| 1epf_A | 191 | NCAM, protein (neural cell adhesion molecule); imm | 5e-26 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 9e-40 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 5e-30 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 2e-28 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 2e-22 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 4e-14 | |
| 2v44_A | 189 | NCAM2, neural cell adhesion molecule 2; phosphoryl | 1e-39 | |
| 2v44_A | 189 | NCAM2, neural cell adhesion molecule 2; phosphoryl | 3e-37 | |
| 2v44_A | 189 | NCAM2, neural cell adhesion molecule 2; phosphoryl | 6e-26 | |
| 2v44_A | 189 | NCAM2, neural cell adhesion molecule 2; phosphoryl | 7e-09 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 3e-39 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 1e-33 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 6e-28 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 2e-14 | |
| 2v9r_A | 212 | Roundabout homolog 1; proto-oncogene, differentiat | 5e-39 | |
| 2v9r_A | 212 | Roundabout homolog 1; proto-oncogene, differentiat | 1e-28 | |
| 2v9r_A | 212 | Roundabout homolog 1; proto-oncogene, differentiat | 4e-28 | |
| 2v9r_A | 212 | Roundabout homolog 1; proto-oncogene, differentiat | 1e-08 | |
| 2j8h_A | 197 | Titin, connectin; cardiomyopathy, nuclear protein, | 9e-38 | |
| 2j8h_A | 197 | Titin, connectin; cardiomyopathy, nuclear protein, | 1e-30 | |
| 2j8h_A | 197 | Titin, connectin; cardiomyopathy, nuclear protein, | 1e-24 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 1e-37 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 2e-30 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 8e-27 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 2e-12 | |
| 3ojm_B | 231 | Fibroblast growth factor receptor 2; beta trefoil | 3e-37 | |
| 3ojm_B | 231 | Fibroblast growth factor receptor 2; beta trefoil | 3e-34 | |
| 3ojm_B | 231 | Fibroblast growth factor receptor 2; beta trefoil | 2e-20 | |
| 3ojm_B | 231 | Fibroblast growth factor receptor 2; beta trefoil | 2e-07 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 8e-37 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 8e-29 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 4e-20 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 4e-13 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 4e-05 | |
| 2wv3_A | 190 | Neuroplastin; igcam, membrane, glycoprotein, cell | 1e-36 | |
| 2wv3_A | 190 | Neuroplastin; igcam, membrane, glycoprotein, cell | 1e-33 | |
| 2wv3_A | 190 | Neuroplastin; igcam, membrane, glycoprotein, cell | 2e-18 | |
| 2va4_A | 192 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; t | 2e-36 | |
| 2va4_A | 192 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; t | 4e-36 | |
| 2va4_A | 192 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; t | 2e-21 | |
| 2va4_A | 192 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; t | 2e-07 | |
| 1nn8_R | 302 | CD155 antigen, poliovirus receptor; icosahedral vi | 3e-35 | |
| 1nn8_R | 302 | CD155 antigen, poliovirus receptor; icosahedral vi | 5e-22 | |
| 1nn8_R | 302 | CD155 antigen, poliovirus receptor; icosahedral vi | 3e-19 | |
| 1nn8_R | 302 | CD155 antigen, poliovirus receptor; icosahedral vi | 9e-10 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 1e-34 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 2e-34 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 9e-21 | |
| 3grw_A | 241 | Fibroblast growth factor receptor 3; FGFR3, protei | 1e-34 | |
| 3grw_A | 241 | Fibroblast growth factor receptor 3; FGFR3, protei | 2e-34 | |
| 3grw_A | 241 | Fibroblast growth factor receptor 3; FGFR3, protei | 4e-19 | |
| 3grw_A | 241 | Fibroblast growth factor receptor 3; FGFR3, protei | 2e-08 | |
| 2vr9_A | 217 | Roundabout 1, ROBO; immunoglobulin-like domain, AX | 2e-34 | |
| 2vr9_A | 217 | Roundabout 1, ROBO; immunoglobulin-like domain, AX | 2e-29 | |
| 2vr9_A | 217 | Roundabout 1, ROBO; immunoglobulin-like domain, AX | 6e-29 | |
| 2vr9_A | 217 | Roundabout 1, ROBO; immunoglobulin-like domain, AX | 3e-11 | |
| 1rhf_A | 182 | Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 | 2e-34 | |
| 1rhf_A | 182 | Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 | 2e-30 | |
| 1rhf_A | 182 | Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 | 7e-22 | |
| 1rhf_A | 182 | Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 | 6e-08 | |
| 1rhf_A | 182 | Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 | 3e-04 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 7e-34 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 3e-27 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 2e-09 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 2e-33 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 4e-32 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 2e-21 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 5e-15 | |
| 1nbq_A | 209 | JAM, junctional adhesion molecule 1, PAM-1; reovir | 6e-33 | |
| 1nbq_A | 209 | JAM, junctional adhesion molecule 1, PAM-1; reovir | 8e-32 | |
| 1nbq_A | 209 | JAM, junctional adhesion molecule 1, PAM-1; reovir | 6e-20 | |
| 1nbq_A | 209 | JAM, junctional adhesion molecule 1, PAM-1; reovir | 3e-04 | |
| 3oq3_B | 329 | IFN-alpha/beta binding protein C12R; mousepox viru | 1e-32 | |
| 3oq3_B | 329 | IFN-alpha/beta binding protein C12R; mousepox viru | 2e-24 | |
| 3oq3_B | 329 | IFN-alpha/beta binding protein C12R; mousepox viru | 2e-21 | |
| 3lcy_A | 197 | Titin; A-BAND, IG tandem domains, ATP-binding, cal | 1e-32 | |
| 3lcy_A | 197 | Titin; A-BAND, IG tandem domains, ATP-binding, cal | 4e-28 | |
| 3lcy_A | 197 | Titin; A-BAND, IG tandem domains, ATP-binding, cal | 8e-25 | |
| 1f97_A | 212 | Junction adhesion molecule; immunoglobulin superfa | 2e-32 | |
| 1f97_A | 212 | Junction adhesion molecule; immunoglobulin superfa | 1e-31 | |
| 1f97_A | 212 | Junction adhesion molecule; immunoglobulin superfa | 2e-19 | |
| 3s97_C | 201 | Contactin-1; carbonic anhdyrase like immunoglobuli | 2e-31 | |
| 3s97_C | 201 | Contactin-1; carbonic anhdyrase like immunoglobuli | 6e-31 | |
| 3s97_C | 201 | Contactin-1; carbonic anhdyrase like immunoglobuli | 3e-10 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 5e-31 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 6e-28 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 3e-16 | |
| 2ch8_A | 201 | BARF1, P33, 33 kDa early protein; viral protein, i | 2e-30 | |
| 2ch8_A | 201 | BARF1, P33, 33 kDa early protein; viral protein, i | 5e-27 | |
| 2ch8_A | 201 | BARF1, P33, 33 kDa early protein; viral protein, i | 3e-07 | |
| 2c5d_C | 195 | AXL oncogene, tyrosine-protein kinase receptor UFO | 2e-30 | |
| 2c5d_C | 195 | AXL oncogene, tyrosine-protein kinase receptor UFO | 7e-30 | |
| 2c5d_C | 195 | AXL oncogene, tyrosine-protein kinase receptor UFO | 1e-16 | |
| 2c5d_C | 195 | AXL oncogene, tyrosine-protein kinase receptor UFO | 9e-11 | |
| 3u83_A | 331 | Poliovirus receptor-related protein 1; nectin-1, h | 7e-30 | |
| 3u83_A | 331 | Poliovirus receptor-related protein 1; nectin-1, h | 6e-18 | |
| 3u83_A | 331 | Poliovirus receptor-related protein 1; nectin-1, h | 1e-17 | |
| 4dep_C | 349 | Interleukin-1 receptor accessory protein; B-trefoi | 2e-27 | |
| 4dep_C | 349 | Interleukin-1 receptor accessory protein; B-trefoi | 1e-21 | |
| 4dep_C | 349 | Interleukin-1 receptor accessory protein; B-trefoi | 3e-17 | |
| 4dep_C | 349 | Interleukin-1 receptor accessory protein; B-trefoi | 3e-06 | |
| 1z7z_I | 450 | Intercellular adhesion molecule-1; ICAM-1,kilifi,C | 6e-27 | |
| 1z7z_I | 450 | Intercellular adhesion molecule-1; ICAM-1,kilifi,C | 1e-20 | |
| 1z7z_I | 450 | Intercellular adhesion molecule-1; ICAM-1,kilifi,C | 6e-19 | |
| 1z7z_I | 450 | Intercellular adhesion molecule-1; ICAM-1,kilifi,C | 7e-16 | |
| 1z7z_I | 450 | Intercellular adhesion molecule-1; ICAM-1,kilifi,C | 4e-14 | |
| 1z7z_I | 450 | Intercellular adhesion molecule-1; ICAM-1,kilifi,C | 1e-07 | |
| 3jz7_A | 214 | MCAR, CAR, coxsackievirus and adenovirus receptor | 1e-26 | |
| 3jz7_A | 214 | MCAR, CAR, coxsackievirus and adenovirus receptor | 8e-21 | |
| 3jz7_A | 214 | MCAR, CAR, coxsackievirus and adenovirus receptor | 1e-07 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 5e-26 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 9e-21 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 8e-17 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 2e-04 | |
| 2edj_A | 100 | Roundabout homolog 2; KIAA1568 protein, beta sandw | 1e-25 | |
| 2edj_A | 100 | Roundabout homolog 2; KIAA1568 protein, beta sandw | 3e-20 | |
| 2edj_A | 100 | Roundabout homolog 2; KIAA1568 protein, beta sandw | 1e-07 | |
| 2edj_A | 100 | Roundabout homolog 2; KIAA1568 protein, beta sandw | 4e-04 | |
| 2oz4_A | 265 | Intercellular adhesion molecule 1; IGSF domain, st | 1e-25 | |
| 2oz4_A | 265 | Intercellular adhesion molecule 1; IGSF domain, st | 4e-18 | |
| 2oz4_A | 265 | Intercellular adhesion molecule 1; IGSF domain, st | 4e-15 | |
| 2eo9_A | 118 | Roundabout homolog 1; beta-sandwich, IG-fold, H-RO | 1e-25 | |
| 2eo9_A | 118 | Roundabout homolog 1; beta-sandwich, IG-fold, H-RO | 3e-20 | |
| 2eo9_A | 118 | Roundabout homolog 1; beta-sandwich, IG-fold, H-RO | 2e-08 | |
| 2eo9_A | 118 | Roundabout homolog 1; beta-sandwich, IG-fold, H-RO | 5e-08 | |
| 1fhg_A | 154 | Telokin; immunoglobulin fold, beta barrel, contrac | 3e-25 | |
| 1fhg_A | 154 | Telokin; immunoglobulin fold, beta barrel, contrac | 2e-12 | |
| 1fhg_A | 154 | Telokin; immunoglobulin fold, beta barrel, contrac | 2e-06 | |
| 1wio_A | 363 | CD4, T-cell surface glycoprotein CD4; immunoglobul | 5e-25 | |
| 1wio_A | 363 | CD4, T-cell surface glycoprotein CD4; immunoglobul | 1e-17 | |
| 1wio_A | 363 | CD4, T-cell surface glycoprotein CD4; immunoglobul | 2e-06 | |
| 1wio_A | 363 | CD4, T-cell surface glycoprotein CD4; immunoglobul | 3e-04 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 6e-25 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 5e-17 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 5e-14 | |
| 3kvq_A | 108 | Vascular endothelial growth factor receptor 2; veg | 2e-24 | |
| 3kvq_A | 108 | Vascular endothelial growth factor receptor 2; veg | 8e-15 | |
| 3kvq_A | 108 | Vascular endothelial growth factor receptor 2; veg | 2e-07 | |
| 3kvq_A | 108 | Vascular endothelial growth factor receptor 2; veg | 4e-07 | |
| 3mjg_X | 289 | Beta-type platelet-derived growth factor receptor; | 2e-24 | |
| 3mjg_X | 289 | Beta-type platelet-derived growth factor receptor; | 1e-21 | |
| 3mjg_X | 289 | Beta-type platelet-derived growth factor receptor; | 3e-18 | |
| 3rbs_A | 207 | Myomesin-1; immunoglobulin C-SET domain, contractI | 3e-24 | |
| 3rbs_A | 207 | Myomesin-1; immunoglobulin C-SET domain, contractI | 2e-15 | |
| 3rbs_A | 207 | Myomesin-1; immunoglobulin C-SET domain, contractI | 6e-10 | |
| 3rbs_A | 207 | Myomesin-1; immunoglobulin C-SET domain, contractI | 2e-05 | |
| 2r15_A | 212 | Myomesin-1; sarcomeric protein, IG-like domains, h | 5e-24 | |
| 2r15_A | 212 | Myomesin-1; sarcomeric protein, IG-like domains, h | 6e-23 | |
| 2r15_A | 212 | Myomesin-1; sarcomeric protein, IG-like domains, h | 4e-04 | |
| 2fbo_J | 250 | V1V2;, variable region-containing chitin-binding p | 6e-24 | |
| 2fbo_J | 250 | V1V2;, variable region-containing chitin-binding p | 1e-17 | |
| 2kkq_A | 116 | Myotilin; unknown function, actin-binding, cell me | 2e-23 | |
| 2kkq_A | 116 | Myotilin; unknown function, actin-binding, cell me | 1e-11 | |
| 2kkq_A | 116 | Myotilin; unknown function, actin-binding, cell me | 1e-08 | |
| 2kkq_A | 116 | Myotilin; unknown function, actin-binding, cell me | 5e-08 | |
| 1hng_A | 176 | CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra | 3e-23 | |
| 1hng_A | 176 | CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra | 9e-08 | |
| 1hng_A | 176 | CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra | 5e-07 | |
| 2ocw_A | 585 | Polymeric-immunoglobulin receptor; SC, secretory, | 2e-22 | |
| 2ocw_A | 585 | Polymeric-immunoglobulin receptor; SC, secretory, | 1e-21 | |
| 2ocw_A | 585 | Polymeric-immunoglobulin receptor; SC, secretory, | 1e-18 | |
| 2ocw_A | 585 | Polymeric-immunoglobulin receptor; SC, secretory, | 2e-15 | |
| 2ocw_A | 585 | Polymeric-immunoglobulin receptor; SC, secretory, | 1e-07 | |
| 2ocw_A | 585 | Polymeric-immunoglobulin receptor; SC, secretory, | 3e-05 | |
| 3irg_A | 100 | Titin; IG-like, titin, OBSL1, complex, alternative | 4e-22 | |
| 3irg_A | 100 | Titin; IG-like, titin, OBSL1, complex, alternative | 1e-12 | |
| 3irg_A | 100 | Titin; IG-like, titin, OBSL1, complex, alternative | 3e-07 | |
| 3irg_A | 100 | Titin; IG-like, titin, OBSL1, complex, alternative | 1e-04 | |
| 2v9t_A | 117 | Roundabout homolog 1; structural protein-receptor | 1e-21 | |
| 2v9t_A | 117 | Roundabout homolog 1; structural protein-receptor | 4e-14 | |
| 2v9t_A | 117 | Roundabout homolog 1; structural protein-receptor | 1e-08 | |
| 2v9t_A | 117 | Roundabout homolog 1; structural protein-receptor | 3e-07 | |
| 3puc_A | 99 | Titin; I-SET IG-like domain, M-BAND, transferase; | 2e-21 | |
| 3puc_A | 99 | Titin; I-SET IG-like domain, M-BAND, transferase; | 2e-10 | |
| 3puc_A | 99 | Titin; I-SET IG-like domain, M-BAND, transferase; | 7e-08 | |
| 3puc_A | 99 | Titin; I-SET IG-like domain, M-BAND, transferase; | 1e-05 | |
| 1hnf_A | 182 | CD2; T lymphocyte adhesion glycoprotein; HET: NAG; | 2e-21 | |
| 1hnf_A | 182 | CD2; T lymphocyte adhesion glycoprotein; HET: NAG; | 2e-11 | |
| 1hnf_A | 182 | CD2; T lymphocyte adhesion glycoprotein; HET: NAG; | 6e-09 | |
| 2yr3_A | 99 | Myosin light chain kinase, smooth muscle; IG domai | 4e-21 | |
| 2yr3_A | 99 | Myosin light chain kinase, smooth muscle; IG domai | 4e-11 | |
| 2yr3_A | 99 | Myosin light chain kinase, smooth muscle; IG domai | 1e-07 | |
| 2yr3_A | 99 | Myosin light chain kinase, smooth muscle; IG domai | 6e-05 | |
| 3irg_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, co | 4e-21 | |
| 3irg_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, co | 7e-13 | |
| 3irg_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, co | 2e-08 | |
| 3irg_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, co | 6e-07 | |
| 2ens_A | 96 | Advanced glycosylation END product-specific recept | 5e-21 | |
| 2ens_A | 96 | Advanced glycosylation END product-specific recept | 1e-12 | |
| 2ens_A | 96 | Advanced glycosylation END product-specific recept | 2e-09 | |
| 2ens_A | 96 | Advanced glycosylation END product-specific recept | 5e-05 | |
| 3qr2_A | 137 | Basigin; CD147, EMMPRIN, immunoglobulin-like domai | 6e-21 | |
| 3qr2_A | 137 | Basigin; CD147, EMMPRIN, immunoglobulin-like domai | 7e-11 | |
| 3qr2_A | 137 | Basigin; CD147, EMMPRIN, immunoglobulin-like domai | 1e-04 | |
| 3qr2_A | 137 | Basigin; CD147, EMMPRIN, immunoglobulin-like domai | 2e-04 | |
| 3b5h_A | 184 | Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce | 8e-21 | |
| 3b5h_A | 184 | Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce | 6e-17 | |
| 3b5h_A | 184 | Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce | 1e-08 | |
| 3r4d_A | 208 | CEA-related cell adhesion molecule 1, isoform 1/2; | 8e-21 | |
| 3r4d_A | 208 | CEA-related cell adhesion molecule 1, isoform 1/2; | 6e-18 | |
| 3r4d_A | 208 | CEA-related cell adhesion molecule 1, isoform 1/2; | 5e-09 | |
| 1u2h_A | 99 | APEG-1, aortic preferentially expressed protein 1; | 8e-21 | |
| 1u2h_A | 99 | APEG-1, aortic preferentially expressed protein 1; | 2e-13 | |
| 1u2h_A | 99 | APEG-1, aortic preferentially expressed protein 1; | 1e-07 | |
| 1u2h_A | 99 | APEG-1, aortic preferentially expressed protein 1; | 2e-04 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 1e-20 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 1e-20 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 3e-13 | |
| 2kdg_A | 100 | Myotilin; immonoglobulin domain, actin-binding, st | 2e-20 | |
| 2kdg_A | 100 | Myotilin; immonoglobulin domain, actin-binding, st | 4e-13 | |
| 2kdg_A | 100 | Myotilin; immonoglobulin domain, actin-binding, st | 4e-07 | |
| 2kdg_A | 100 | Myotilin; immonoglobulin domain, actin-binding, st | 1e-04 | |
| 1nct_A | 106 | Titin; cell adhesion, glycoprotein, transmembrane, | 2e-20 | |
| 1nct_A | 106 | Titin; cell adhesion, glycoprotein, transmembrane, | 6e-13 | |
| 1nct_A | 106 | Titin; cell adhesion, glycoprotein, transmembrane, | 5e-08 | |
| 1nct_A | 106 | Titin; cell adhesion, glycoprotein, transmembrane, | 2e-05 | |
| 2dm3_A | 110 | KIAA0992 protein, palladin; beta-sandwich, myopall | 3e-20 | |
| 2dm3_A | 110 | KIAA0992 protein, palladin; beta-sandwich, myopall | 5e-12 | |
| 2dm3_A | 110 | KIAA0992 protein, palladin; beta-sandwich, myopall | 5e-07 | |
| 2dm3_A | 110 | KIAA0992 protein, palladin; beta-sandwich, myopall | 3e-06 | |
| 2ny1_B | 184 | T-cell surface glycoprotein CD4; HIV, GP120, CD4, | 8e-20 | |
| 2ny1_B | 184 | T-cell surface glycoprotein CD4; HIV, GP120, CD4, | 4e-18 | |
| 2ny1_B | 184 | T-cell surface glycoprotein CD4; HIV, GP120, CD4, | 5e-08 | |
| 2ny1_B | 184 | T-cell surface glycoprotein CD4; HIV, GP120, CD4, | 5e-05 | |
| 3shs_A | 304 | HOC head outer capsid protein; immunoglobulin-like | 9e-20 | |
| 3shs_A | 304 | HOC head outer capsid protein; immunoglobulin-like | 4e-18 | |
| 3shs_A | 304 | HOC head outer capsid protein; immunoglobulin-like | 2e-13 | |
| 2dm2_A | 110 | Palladin; beta-sandwich, KIAA0992, actin-associate | 2e-19 | |
| 2dm2_A | 110 | Palladin; beta-sandwich, KIAA0992, actin-associate | 8e-11 | |
| 2dm2_A | 110 | Palladin; beta-sandwich, KIAA0992, actin-associate | 2e-07 | |
| 2dm2_A | 110 | Palladin; beta-sandwich, KIAA0992, actin-associate | 2e-05 | |
| 3sbw_C | 222 | Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- | 6e-19 | |
| 3sbw_C | 222 | Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- | 9e-14 | |
| 3qp3_A | 103 | Titin; I-SET IG-like, sarcomere, M-BAND, transfera | 1e-18 | |
| 3qp3_A | 103 | Titin; I-SET IG-like, sarcomere, M-BAND, transfera | 5e-10 | |
| 3qp3_A | 103 | Titin; I-SET IG-like, sarcomere, M-BAND, transfera | 5e-06 | |
| 3qp3_A | 103 | Titin; I-SET IG-like, sarcomere, M-BAND, transfera | 2e-04 | |
| 1g1c_A | 99 | Immunoglobulin-like domain I1 from titin; immunogl | 7e-18 | |
| 1g1c_A | 99 | Immunoglobulin-like domain I1 from titin; immunogl | 1e-09 | |
| 1g1c_A | 99 | Immunoglobulin-like domain I1 from titin; immunogl | 3e-06 | |
| 1g1c_A | 99 | Immunoglobulin-like domain I1 from titin; immunogl | 6e-04 | |
| 2cry_A | 122 | KIN of IRRE-like protein 3; IG fold, KIN of irregu | 1e-17 | |
| 2cry_A | 122 | KIN of IRRE-like protein 3; IG fold, KIN of irregu | 2e-08 | |
| 2cry_A | 122 | KIN of IRRE-like protein 3; IG fold, KIN of irregu | 3e-05 | |
| 3mj6_A | 268 | Junctional adhesion molecule-like; immunoglobulin | 1e-17 | |
| 3mj6_A | 268 | Junctional adhesion molecule-like; immunoglobulin | 9e-15 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 3e-17 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 1e-12 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 1e-07 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 2e-04 | |
| 2cr6_A | 115 | KIAA1556 protein, obscurin; IG-fold, immunoglobuli | 5e-17 | |
| 2cr6_A | 115 | KIAA1556 protein, obscurin; IG-fold, immunoglobuli | 2e-08 | |
| 2cr6_A | 115 | KIAA1556 protein, obscurin; IG-fold, immunoglobuli | 4e-08 | |
| 2cr6_A | 115 | KIAA1556 protein, obscurin; IG-fold, immunoglobuli | 5e-04 | |
| 3bp6_B | 202 | Programmed cell death 1 ligand 2; PD-1, PD-L2, com | 7e-17 | |
| 3bp6_B | 202 | Programmed cell death 1 ligand 2; PD-1, PD-L2, com | 2e-15 | |
| 3bp6_B | 202 | Programmed cell death 1 ligand 2; PD-1, PD-L2, com | 5e-05 | |
| 2cr3_A | 99 | Basic fibroblast growth factor receptor 1; IG fold | 8e-17 | |
| 2cr3_A | 99 | Basic fibroblast growth factor receptor 1; IG fold | 9e-09 | |
| 2cr3_A | 99 | Basic fibroblast growth factor receptor 1; IG fold | 2e-07 | |
| 2cqv_A | 114 | MLCK, myosin light chain kinase, smooth muscle and | 1e-16 | |
| 2cqv_A | 114 | MLCK, myosin light chain kinase, smooth muscle and | 5e-09 | |
| 2cqv_A | 114 | MLCK, myosin light chain kinase, smooth muscle and | 8e-08 | |
| 2cqv_A | 114 | MLCK, myosin light chain kinase, smooth muscle and | 2e-05 | |
| 2x1w_L | 213 | Vascular endothelial growth factor receptor 2; hor | 2e-16 | |
| 2x1w_L | 213 | Vascular endothelial growth factor receptor 2; hor | 7e-09 | |
| 2x1w_L | 213 | Vascular endothelial growth factor receptor 2; hor | 1e-04 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-16 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 7e-08 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-04 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-04 | |
| 1gl4_B | 98 | Basement membrane-specific heparan sulfate proteog | 3e-16 | |
| 1gl4_B | 98 | Basement membrane-specific heparan sulfate proteog | 1e-10 | |
| 1gl4_B | 98 | Basement membrane-specific heparan sulfate proteog | 3e-05 | |
| 1gl4_B | 98 | Basement membrane-specific heparan sulfate proteog | 5e-04 | |
| 2ckn_A | 95 | Basic fibroblast growth factor receptor 1; kinase, | 4e-16 | |
| 2ckn_A | 95 | Basic fibroblast growth factor receptor 1; kinase, | 2e-10 | |
| 2ckn_A | 95 | Basic fibroblast growth factor receptor 1; kinase, | 5e-06 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 6e-16 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 1e-05 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 3e-04 | |
| 1wit_A | 93 | Twitchin 18TH IGSF module; immunoglobulin superfam | 8e-16 | |
| 1wit_A | 93 | Twitchin 18TH IGSF module; immunoglobulin superfam | 3e-10 | |
| 1wit_A | 93 | Twitchin 18TH IGSF module; immunoglobulin superfam | 4e-08 | |
| 1wit_A | 93 | Twitchin 18TH IGSF module; immunoglobulin superfam | 3e-04 | |
| 2e7b_A | 103 | Obscurin; IG-like domain, structural genomics, NPP | 1e-15 | |
| 2e7b_A | 103 | Obscurin; IG-like domain, structural genomics, NPP | 3e-07 | |
| 2e7b_A | 103 | Obscurin; IG-like domain, structural genomics, NPP | 5e-05 | |
| 2e7b_A | 103 | Obscurin; IG-like domain, structural genomics, NPP | 5e-04 | |
| 3ry4_A | 170 | Low affinity immunoglobulin gamma FC region recep; | 1e-15 | |
| 3ry4_A | 170 | Low affinity immunoglobulin gamma FC region recep; | 8e-15 | |
| 3ry4_A | 170 | Low affinity immunoglobulin gamma FC region recep; | 2e-13 | |
| 1wwc_A | 118 | Protein (NT-3 growth factor receptor TRKC); TRK re | 2e-15 | |
| 1wwc_A | 118 | Protein (NT-3 growth factor receptor TRKC); TRK re | 2e-07 | |
| 1wwc_A | 118 | Protein (NT-3 growth factor receptor TRKC); TRK re | 3e-04 | |
| 1wwc_A | 118 | Protein (NT-3 growth factor receptor TRKC); TRK re | 8e-04 | |
| 3bfo_A | 91 | Mucosa-associated lymphoid tissue lymphoma translo | 2e-15 | |
| 3bfo_A | 91 | Mucosa-associated lymphoid tissue lymphoma translo | 9e-12 | |
| 3bfo_A | 91 | Mucosa-associated lymphoid tissue lymphoma translo | 6e-08 | |
| 3bfo_A | 91 | Mucosa-associated lymphoid tissue lymphoma translo | 5e-07 | |
| 2eny_A | 104 | Obscurin; beta-sandwich, IG-fold, structural genom | 3e-15 | |
| 2eny_A | 104 | Obscurin; beta-sandwich, IG-fold, structural genom | 3e-09 | |
| 2eny_A | 104 | Obscurin; beta-sandwich, IG-fold, structural genom | 6e-06 | |
| 2dku_A | 103 | KIAA1556 protein; beta-sandwich, IG-fold, obscurin | 3e-15 | |
| 2dku_A | 103 | KIAA1556 protein; beta-sandwich, IG-fold, obscurin | 2e-07 | |
| 2dku_A | 103 | KIAA1556 protein; beta-sandwich, IG-fold, obscurin | 2e-06 | |
| 2edh_A | 113 | Obscurin; structural genomics, NPPSFA, national pr | 5e-15 | |
| 2edh_A | 113 | Obscurin; structural genomics, NPPSFA, national pr | 2e-08 | |
| 2edh_A | 113 | Obscurin; structural genomics, NPPSFA, national pr | 5e-08 | |
| 2edh_A | 113 | Obscurin; structural genomics, NPPSFA, national pr | 6e-04 | |
| 1f2q_A | 176 | High affinity immunoglobulin epsilon receptor ALP | 6e-15 | |
| 1f2q_A | 176 | High affinity immunoglobulin epsilon receptor ALP | 3e-13 | |
| 1f2q_A | 176 | High affinity immunoglobulin epsilon receptor ALP | 4e-12 | |
| 1f2q_A | 176 | High affinity immunoglobulin epsilon receptor ALP | 3e-06 | |
| 3caf_A | 100 | Fibroblast growth factor receptor 2; FGFR2, D2, AT | 8e-15 | |
| 3caf_A | 100 | Fibroblast growth factor receptor 2; FGFR2, D2, AT | 2e-11 | |
| 3caf_A | 100 | Fibroblast growth factor receptor 2; FGFR2, D2, AT | 1e-06 | |
| 3caf_A | 100 | Fibroblast growth factor receptor 2; FGFR2, D2, AT | 2e-04 | |
| 1vca_A | 202 | VCAM-D1,2, human vascular cell adhesion molecule-1 | 9e-15 | |
| 1vca_A | 202 | VCAM-D1,2, human vascular cell adhesion molecule-1 | 3e-11 | |
| 1vca_A | 202 | VCAM-D1,2, human vascular cell adhesion molecule-1 | 1e-07 | |
| 2dlt_A | 106 | Myosin binding protein C, fast-type; IG-like domai | 1e-14 | |
| 2dlt_A | 106 | Myosin binding protein C, fast-type; IG-like domai | 4e-07 | |
| 2dlt_A | 106 | Myosin binding protein C, fast-type; IG-like domai | 1e-05 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 2e-14 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 2e-06 | |
| 3so5_A | 112 | LIG-3, leucine-rich repeats and immunoglobulin-lik | 3e-14 | |
| 3so5_A | 112 | LIG-3, leucine-rich repeats and immunoglobulin-lik | 4e-07 | |
| 3so5_A | 112 | LIG-3, leucine-rich repeats and immunoglobulin-lik | 2e-05 | |
| 2dm7_A | 108 | KIAA1556 protein; beta-sandwich, IG-fold, obscurin | 3e-14 | |
| 2dm7_A | 108 | KIAA1556 protein; beta-sandwich, IG-fold, obscurin | 4e-07 | |
| 2dm7_A | 108 | KIAA1556 protein; beta-sandwich, IG-fold, obscurin | 1e-06 | |
| 2dm7_A | 108 | KIAA1556 protein; beta-sandwich, IG-fold, obscurin | 1e-04 | |
| 2k1m_A | 95 | Myosin-binding protein C, cardiac-type; IG-I domai | 4e-14 | |
| 2k1m_A | 95 | Myosin-binding protein C, cardiac-type; IG-I domai | 4e-08 | |
| 2k1m_A | 95 | Myosin-binding protein C, cardiac-type; IG-I domai | 6e-07 | |
| 2dav_A | 126 | SLOW MYBP-C, myosin-binding protein C, SLOW-type; | 1e-13 | |
| 2dav_A | 126 | SLOW MYBP-C, myosin-binding protein C, SLOW-type; | 3e-05 | |
| 1wwb_X | 103 | Protein (brain derived neurotrophic factor recepto | 1e-13 | |
| 1wwb_X | 103 | Protein (brain derived neurotrophic factor recepto | 1e-06 | |
| 1wwb_X | 103 | Protein (brain derived neurotrophic factor recepto | 4e-04 | |
| 2edf_A | 103 | Obscurin; beta-sandwich, IG-fold, structural genom | 2e-13 | |
| 2edf_A | 103 | Obscurin; beta-sandwich, IG-fold, structural genom | 1e-06 | |
| 2edf_A | 103 | Obscurin; beta-sandwich, IG-fold, structural genom | 3e-04 | |
| 2cpc_A | 113 | KIAA0657 protein; immunoglobulin domain, IG domain | 2e-13 | |
| 2cpc_A | 113 | KIAA0657 protein; immunoglobulin domain, IG domain | 3e-06 | |
| 2cpc_A | 113 | KIAA0657 protein; immunoglobulin domain, IG domain | 4e-05 | |
| 2cpc_A | 113 | KIAA0657 protein; immunoglobulin domain, IG domain | 7e-05 | |
| 1waa_A | 93 | Titin; metal binding protein, calmodulin-binding, | 3e-13 | |
| 1waa_A | 93 | Titin; metal binding protein, calmodulin-binding, | 3e-07 | |
| 1waa_A | 93 | Titin; metal binding protein, calmodulin-binding, | 3e-06 | |
| 1fnl_A | 175 | Low affinity immunoglobulin gamma FC region recept | 4e-13 | |
| 1fnl_A | 175 | Low affinity immunoglobulin gamma FC region recept | 4e-13 | |
| 1fnl_A | 175 | Low affinity immunoglobulin gamma FC region recept | 1e-11 | |
| 2edk_A | 101 | Myosin-binding protein C, fast-type; IG fold, fast | 5e-13 | |
| 2edk_A | 101 | Myosin-binding protein C, fast-type; IG fold, fast | 1e-08 | |
| 2edk_A | 101 | Myosin-binding protein C, fast-type; IG fold, fast | 1e-04 | |
| 1dr9_A | 201 | B7-1 (CD80), T lymphocyte activation antigen; IG s | 5e-13 | |
| 1dr9_A | 201 | B7-1 (CD80), T lymphocyte activation antigen; IG s | 2e-07 | |
| 1ccz_A | 171 | Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 | 5e-13 | |
| 1ccz_A | 171 | Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 | 5e-06 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 8e-13 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 4e-04 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 5e-04 | |
| 3sgj_C | 204 | Human FCG3A receptor; receptor complex, FC recepto | 8e-13 | |
| 3sgj_C | 204 | Human FCG3A receptor; receptor complex, FC recepto | 1e-11 | |
| 3sgj_C | 204 | Human FCG3A receptor; receptor complex, FC recepto | 3e-10 | |
| 1x44_A | 103 | Myosin-binding protein C, SLOW-type; IG-like domai | 1e-12 | |
| 1x44_A | 103 | Myosin-binding protein C, SLOW-type; IG-like domai | 3e-07 | |
| 1x44_A | 103 | Myosin-binding protein C, SLOW-type; IG-like domai | 6e-07 | |
| 2pet_A | 231 | Lutheran blood group glycoprotein; immunoglobulin | 2e-12 | |
| 2pet_A | 231 | Lutheran blood group glycoprotein; immunoglobulin | 3e-09 | |
| 2yuz_A | 100 | Myosin-binding protein C, SLOW-type; immunoglobuli | 2e-12 | |
| 2yuz_A | 100 | Myosin-binding protein C, SLOW-type; immunoglobuli | 7e-08 | |
| 2yuz_A | 100 | Myosin-binding protein C, SLOW-type; immunoglobuli | 2e-05 | |
| 3cx2_A | 108 | Myosin-binding protein C, cardiac-type; protonatio | 1e-11 | |
| 3cx2_A | 108 | Myosin-binding protein C, cardiac-type; protonatio | 3e-04 | |
| 2eo1_A | 102 | OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 | 1e-11 | |
| 2eo1_A | 102 | OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 | 7e-07 | |
| 2eo1_A | 102 | OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 | 8e-07 | |
| 2if7_A | 193 | SLAM family member 6; NTB-A, homophilic receptor, | 1e-11 | |
| 2if7_A | 193 | SLAM family member 6; NTB-A, homophilic receptor, | 1e-07 | |
| 2if7_A | 193 | SLAM family member 6; NTB-A, homophilic receptor, | 6e-05 | |
| 2bk8_A | 97 | Connectin, M1, titin heart isoform N2-B; IG domain | 2e-11 | |
| 2bk8_A | 97 | Connectin, M1, titin heart isoform N2-B; IG domain | 2e-06 | |
| 2bk8_A | 97 | Connectin, M1, titin heart isoform N2-B; IG domain | 2e-04 | |
| 2bk8_A | 97 | Connectin, M1, titin heart isoform N2-B; IG domain | 4e-04 | |
| 3rbg_A | 124 | Cytotoxic and regulatory T-cell molecule; IGV, crt | 4e-11 | |
| 3eow_R | 221 | Poliovirus receptor; immunoglobulin super family, | 4e-11 | |
| 3eow_R | 221 | Poliovirus receptor; immunoglobulin super family, | 8e-11 | |
| 1pd6_A | 104 | Cardiac MYBP-C;, myosin-binding protein C, cardiac | 5e-11 | |
| 1pd6_A | 104 | Cardiac MYBP-C;, myosin-binding protein C, cardiac | 8e-10 | |
| 1pd6_A | 104 | Cardiac MYBP-C;, myosin-binding protein C, cardiac | 7e-04 | |
| 2yuv_A | 100 | Myosin-binding protein C, SLOW-type; SLOW-type myo | 7e-11 | |
| 2yuv_A | 100 | Myosin-binding protein C, SLOW-type; SLOW-type myo | 8e-08 | |
| 2yuv_A | 100 | Myosin-binding protein C, SLOW-type; SLOW-type myo | 5e-05 | |
| 1mq8_A | 291 | ICAM-1, intercellular adhesion molecule-1, CD54 an | 1e-10 | |
| 1mq8_A | 291 | ICAM-1, intercellular adhesion molecule-1, CD54 an | 2e-08 | |
| 3m45_A | 108 | Cell adhesion molecule 2; IG fold, dimer, disulfid | 1e-10 | |
| 3s35_X | 122 | Vascular endothelial growth factor receptor 2; ant | 2e-10 | |
| 3s35_X | 122 | Vascular endothelial growth factor receptor 2; ant | 5e-04 | |
| 2e7c_A | 118 | Myosin-binding protein C, fast-type; IG-like domai | 3e-10 | |
| 2e7c_A | 118 | Myosin-binding protein C, fast-type; IG-like domai | 2e-07 | |
| 2e7c_A | 118 | Myosin-binding protein C, fast-type; IG-like domai | 7e-05 | |
| 2e7c_A | 118 | Myosin-binding protein C, fast-type; IG-like domai | 2e-04 | |
| 2e6p_A | 104 | Obscurin-like protein 1; IG-like domain, structura | 3e-10 | |
| 2e6p_A | 104 | Obscurin-like protein 1; IG-like domain, structura | 5e-06 | |
| 2e6p_A | 104 | Obscurin-like protein 1; IG-like domain, structura | 5e-05 | |
| 1sy6_A | 204 | T-cell surface glycoprotein CD3 gamma/epsilon chai | 3e-10 | |
| 1sy6_A | 204 | T-cell surface glycoprotein CD3 gamma/epsilon chai | 6e-07 | |
| 1sy6_A | 204 | T-cell surface glycoprotein CD3 gamma/epsilon chai | 6e-07 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 4e-10 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 8e-10 | |
| 2dru_A | 180 | Chimera of CD48 antigen and T-cell surface antige; | 1e-09 | |
| 2dru_A | 180 | Chimera of CD48 antigen and T-cell surface antige; | 3e-05 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 2e-09 | |
| 1he7_A | 126 | High affinity nerve growth factor receptor; transf | 1e-08 | |
| 1he7_A | 126 | High affinity nerve growth factor receptor; transf | 7e-06 | |
| 1gxe_A | 139 | Myosin binding protein C, cardiac-type; cytoskelet | 2e-08 | |
| 1gxe_A | 139 | Myosin binding protein C, cardiac-type; cytoskelet | 9e-05 | |
| 1gxe_A | 139 | Myosin binding protein C, cardiac-type; cytoskelet | 2e-04 | |
| 4f80_A | 226 | Butyrophilin subfamily 3 member A1; B7 superfamily | 3e-08 | |
| 4f80_A | 226 | Butyrophilin subfamily 3 member A1; B7 superfamily | 3e-08 | |
| 3bn3_B | 196 | ICAM-5, intercellular adhesion molecule 5, telence | 1e-07 | |
| 3bn3_B | 196 | ICAM-5, intercellular adhesion molecule 5, telence | 9e-06 | |
| 3vh8_G | 316 | Killer cell immunoglobulin-like receptor 3DL1; imm | 2e-07 | |
| 3vh8_G | 316 | Killer cell immunoglobulin-like receptor 3DL1; imm | 6e-04 | |
| 1uct_A | 218 | Immunoglobulin alpha FC receptor; beta stands, imm | 2e-07 | |
| 1uct_A | 218 | Immunoglobulin alpha FC receptor; beta stands, imm | 7e-06 | |
| 1olz_A | 663 | Semaphorin 4D; developmental protein, CD100, beta- | 4e-07 | |
| 2wqr_A | 323 | IG epsilon chain C region; immune system, immunogl | 7e-07 | |
| 2wqr_A | 323 | IG epsilon chain C region; immune system, immunogl | 6e-04 | |
| 3pv7_A | 248 | B7-H6, IG-like domain-containing protein DKFZP686O | 9e-07 | |
| 3pv7_A | 248 | B7-H6, IG-like domain-containing protein DKFZP686O | 4e-04 | |
| 2d3v_A | 196 | Leukocyte immunoglobulin-like receptor subfamily A | 1e-06 | |
| 2d3v_A | 196 | Leukocyte immunoglobulin-like receptor subfamily A | 6e-06 | |
| 2edn_A | 118 | Myosin-binding protein C, fast-type; beta-sandwich | 2e-06 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 3e-06 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 9e-05 | |
| 2wng_A | 327 | Tyrosine-protein phosphatase non-receptor type sub | 4e-06 | |
| 2wng_A | 327 | Tyrosine-protein phosphatase non-receptor type sub | 4e-06 | |
| 2zg1_A | 214 | Sialic acid-binding IG-like lectin 5; siglec-5 inh | 4e-06 | |
| 2zg1_A | 214 | Sialic acid-binding IG-like lectin 5; siglec-5 inh | 2e-05 | |
| 2e6q_A | 112 | Obscurin-like protein 1; IG-like domain, structura | 5e-06 | |
| 1ugn_A | 198 | LIR1, leukocyte immunoglobulin-like receptor 1; im | 6e-06 | |
| 1ugn_A | 198 | LIR1, leukocyte immunoglobulin-like receptor 1; im | 2e-04 | |
| 1p6f_A | 242 | NKP46, natural cytotoxicity triggering receptor 1; | 1e-05 | |
| 1p6f_A | 242 | NKP46, natural cytotoxicity triggering receptor 1; | 1e-05 | |
| 1gsm_A | 210 | Madcam-1, mucosal addressin cell adhesion molecule | 2e-05 | |
| 3p2t_A | 196 | Leukocyte immunoglobulin-like receptor subfamily 4 | 3e-05 | |
| 3p2t_A | 196 | Leukocyte immunoglobulin-like receptor subfamily 4 | 1e-04 | |
| 1z9m_A | 145 | GAPA225; nectin-like, IG-like domain, V domain, ce | 3e-05 | |
| 3q0h_A | 117 | T cell immunoreceptor with IG and ITIM domains; im | 5e-05 | |
| 1ow0_A | 214 | IG alpha-1 chain C region; IGA1, fcari, CD89, anti | 5e-05 | |
| 2rcj_C | 523 | Light chain; immunoglobulin M, polymeric antibodie | 6e-05 | |
| 1oll_A | 188 | NK receptor; immune system/receptor, NK cell trigg | 6e-05 | |
| 1oll_A | 188 | NK receptor; immune system/receptor, NK cell trigg | 2e-04 | |
| 2vol_A | 207 | Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, | 1e-04 | |
| 1jbj_A | 186 | CD3 epsilon and gamma ectodomain fragment complex; | 1e-04 | |
| 1pko_A | 139 | Myelin oligodendrocyte glycoprotein; IGV-domain, i | 1e-04 | |
| 1iam_A | 185 | ICAM-1, CD54, intercellular adhesion molecule-1; r | 2e-04 | |
| 1bec_A | 238 | 14.3.D T cell antigen receptor; T cell receptor; 1 | 2e-04 | |
| 2gi7_A | 184 | GPVI protein; IG-like domains, blood clotting, cel | 2e-04 | |
| 2w59_A | 231 | IGY FCU3-4; immunoglobulin, avian, immune system; | 2e-04 | |
| 1i1c_A | 239 | IGG2A, IG gamma-2A chain C region; FC, immune syst | 2e-04 | |
| 3qib_D | 270 | 2B4 beta chain; IG domain, immune system; HET: NAG | 3e-04 | |
| 2edo_A | 121 | CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte | 5e-04 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 5e-04 | |
| 3nvq_A | 590 | Semaphorin-7A; beta-propeller, signaling, signalin | 6e-04 | |
| 1nkr_A | 201 | P58-CL42 KIR; inhibitory receptor, natural killer | 7e-04 |
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
Score = 208 bits (531), Expect = 4e-65
Identities = 64/285 (22%), Positives = 103/285 (36%), Gaps = 37/285 (12%)
Query: 1 MITEVKKSDEGKYQCYVQ-NMVGERETKPALLTVHAPPSFVVRPQDQKVGLNGIASFQCV 59
+ + K DEG YQC G ++ A + V P F+ + + + +C
Sbjct: 85 LHSRHHKPDEGLYQCEASLGDSGSIISRTAKVMVAGPLRFLSQTESITAFMGDTVLLKCE 144
Query: 60 AEGSPLPSVFWTQEGSQVLMFPGNAYGHLHVTQEGTLRIQGVQKEDAGFFVCSALSVAGS 119
G P+P++ W + + PG+ + V G L+I +Q D+G + CSA + A +
Sbjct: 145 VIGDPMPTIHWQKNQQDLNPIPGD--SRVVVLPSGALQISRLQPGDSGVYRCSARNPAST 202
Query: 120 TTVR-AFLQVTSV-EDTPPPIVQVGPSNQTLPLHSVAFLPCQAVGSPPPHIRWYKNGNSL 177
T A +++ S PSN A L C G PPP W + +
Sbjct: 203 RTGNEAEVRILSDPGLHRQLYFLQRPSNVIAIEGKDAVLECCVSGYPPPSFTWLRGEEVI 262
Query: 178 PPEDTRINVSSSGSLQI-DVLRDD----------------------------FRAEPKDT 208
+ ++ +L I +V DD F P +
Sbjct: 263 QLRSKKYSLLGGSNLLISNVTDDDSGTYTCVVTYKNENISASAELTVLVPPWFLNHPSNL 322
Query: 209 RVASGETALLECGPPKGQPEPTLHWKKNGQFIDLESSKRVSILGD 253
EC G+P PT++W KNG + S I+G
Sbjct: 323 YAYESMDIEFECA-VSGKPVPTVNWMKNGD--VVIPSDYFQIVGG 364
|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 | Back alignment and structure |
|---|
| >1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 | Back alignment and structure |
|---|
| >1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 | Back alignment and structure |
|---|
| >1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 | Back alignment and structure |
|---|
| >1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 | Back alignment and structure |
|---|
| >2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 | Back alignment and structure |
|---|
| >2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 | Back alignment and structure |
|---|
| >1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 | Back alignment and structure |
|---|
| >1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 | Back alignment and structure |
|---|
| >2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 | Back alignment and structure |
|---|
| >3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 | Back alignment and structure |
|---|
| >3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 | Back alignment and structure |
|---|
| >3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 | Back alignment and structure |
|---|
| >3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 | Back alignment and structure |
|---|
| >3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 | Back alignment and structure |
|---|
| >3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 | Back alignment and structure |
|---|
| >3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 | Back alignment and structure |
|---|
| >2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 | Back alignment and structure |
|---|
| >2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 | Back alignment and structure |
|---|
| >2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 | Back alignment and structure |
|---|
| >3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 | Back alignment and structure |
|---|
| >3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Length = 202 | Back alignment and structure |
|---|
| >3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Length = 202 | Back alignment and structure |
|---|
| >2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 | Back alignment and structure |
|---|
| >1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 | Back alignment and structure |
|---|
| >1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 | Back alignment and structure |
|---|
| >1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 | Back alignment and structure |
|---|
| >2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 | Back alignment and structure |
|---|
| >2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 | Back alignment and structure |
|---|
| >2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 | Back alignment and structure |
|---|
| >2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 | Back alignment and structure |
|---|
| >2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 | Back alignment and structure |
|---|
| >2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 | Back alignment and structure |
|---|
| >2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 | Back alignment and structure |
|---|
| >3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 | Back alignment and structure |
|---|
| >3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 | Back alignment and structure |
|---|
| >3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 | Back alignment and structure |
|---|
| >1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 | Back alignment and structure |
|---|
| >1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 | Back alignment and structure |
|---|
| >1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 | Back alignment and structure |
|---|
| >1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 | Back alignment and structure |
|---|
| >3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 | Back alignment and structure |
|---|
| >2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 | Back alignment and structure |
|---|
| >2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 | Back alignment and structure |
|---|
| >2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 | Back alignment and structure |
|---|
| >3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 | Back alignment and structure |
|---|
| >3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 | Back alignment and structure |
|---|
| >2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 | Back alignment and structure |
|---|
| >2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 | Back alignment and structure |
|---|
| >2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 | Back alignment and structure |
|---|
| >2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 | Back alignment and structure |
|---|
| >2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 | Back alignment and structure |
|---|
| >2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 | Back alignment and structure |
|---|
| >1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 | Back alignment and structure |
|---|
| >1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 | Back alignment and structure |
|---|
| >1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 | Back alignment and structure |
|---|
| >2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 | Back alignment and structure |
|---|
| >1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 | Back alignment and structure |
|---|
| >1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 | Back alignment and structure |
|---|
| >2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Length = 201 | Back alignment and structure |
|---|
| >1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Length = 201 | Back alignment and structure |
|---|
| >1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Length = 171 | Back alignment and structure |
|---|
| >1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Length = 171 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 | Back alignment and structure |
|---|
| >1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 | Back alignment and structure |
|---|
| >1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 | Back alignment and structure |
|---|
| >1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 | Back alignment and structure |
|---|
| >2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Length = 231 | Back alignment and structure |
|---|
| >2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Length = 231 | Back alignment and structure |
|---|
| >2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 | Back alignment and structure |
|---|
| >3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 | Back alignment and structure |
|---|
| >2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 | Back alignment and structure |
|---|
| >1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 | Back alignment and structure |
|---|
| >1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 | Back alignment and structure |
|---|
| >2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 | Back alignment and structure |
|---|
| >2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 | Back alignment and structure |
|---|
| >2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 | Back alignment and structure |
|---|
| >1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 291 | Back alignment and structure |
|---|
| >1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 291 | Back alignment and structure |
|---|
| >3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Length = 108 | Back alignment and structure |
|---|
| >3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 | Back alignment and structure |
|---|
| >3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 | Back alignment and structure |
|---|
| >1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 | Back alignment and structure |
|---|
| >1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Length = 180 | Back alignment and structure |
|---|
| >2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Length = 180 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 | Back alignment and structure |
|---|
| >1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 | Back alignment and structure |
|---|
| >4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Length = 226 | Back alignment and structure |
|---|
| >4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Length = 226 | Back alignment and structure |
|---|
| >3bn3_B ICAM-5, intercellular adhesion molecule 5, telencephalin; I domain, integrin, allosteric mobility, cell adhesi immune system; HET: NAG; 2.10A {Homo sapiens} Length = 196 | Back alignment and structure |
|---|
| >3bn3_B ICAM-5, intercellular adhesion molecule 5, telencephalin; I domain, integrin, allosteric mobility, cell adhesi immune system; HET: NAG; 2.10A {Homo sapiens} Length = 196 | Back alignment and structure |
|---|
| >3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Length = 316 | Back alignment and structure |
|---|
| >3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Length = 316 | Back alignment and structure |
|---|
| >1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Length = 218 | Back alignment and structure |
|---|
| >1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Length = 218 | Back alignment and structure |
|---|
| >1olz_A Semaphorin 4D; developmental protein, CD100, beta-propeller, PSI domain, IG-like domain, extracellular receptor, neurogenesis; 2.0A {Homo sapiens} SCOP: b.1.1.4 b.69.12.1 g.16.2.1 PDB: 3ol2_A* Length = 663 | Back alignment and structure |
|---|
| >2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Length = 323 | Back alignment and structure |
|---|
| >2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Length = 323 | Back alignment and structure |
|---|
| >3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Length = 248 | Back alignment and structure |
|---|
| >3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Length = 248 | Back alignment and structure |
|---|
| >2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Length = 196 | Back alignment and structure |
|---|
| >2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Length = 196 | Back alignment and structure |
|---|
| >2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Length = 327 | Back alignment and structure |
|---|
| >2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Length = 327 | Back alignment and structure |
|---|
| >2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Length = 214 | Back alignment and structure |
|---|
| >2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Length = 214 | Back alignment and structure |
|---|
| >2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Length = 198 | Back alignment and structure |
|---|
| >1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Length = 198 | Back alignment and structure |
|---|
| >1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 242 | Back alignment and structure |
|---|
| >1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 242 | Back alignment and structure |
|---|
| >1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Length = 210 | Back alignment and structure |
|---|
| >3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Length = 196 | Back alignment and structure |
|---|
| >3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Length = 196 | Back alignment and structure |
|---|
| >1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >3q0h_A T cell immunoreceptor with IG and ITIM domains; immune receptor, adhesion, structural genomics, NEW YORK STR genomics research consortium, nysgrc; 1.70A {Homo sapiens} PDB: 3rq3_A 3udw_A* 3ucr_A Length = 117 | Back alignment and structure |
|---|
| >1ow0_A IG alpha-1 chain C region; IGA1, fcari, CD89, antibody, immunoglobulin-LIK immune system; HET: NAG FUL BMA GAL SIA FUC MAN NDG; 3.10A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2qej_A* Length = 214 | Back alignment and structure |
|---|
| >2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Length = 523 | Back alignment and structure |
|---|
| >1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 188 | Back alignment and structure |
|---|
| >1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 188 | Back alignment and structure |
|---|
| >2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A Length = 207 | Back alignment and structure |
|---|
| >1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Length = 186 | Back alignment and structure |
|---|
| >1pko_A Myelin oligodendrocyte glycoprotein; IGV-domain, immune system; 1.45A {Rattus norvegicus} SCOP: b.1.1.1 PDB: 1pkq_E 3csp_A 1py9_A Length = 139 | Back alignment and structure |
|---|
| >1iam_A ICAM-1, CD54, intercellular adhesion molecule-1; rhinovirus receptor, cell adhesion, integrin ligand, glycopr LFA-1 ligand, immunoglobulin fold; HET: NAG; 2.10A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ic1_A* 1d3l_A 1d3e_I 1d3i_I 3tcx_A Length = 185 | Back alignment and structure |
|---|
| >1bec_A 14.3.D T cell antigen receptor; T cell receptor; 1.70A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1jck_A 1l0x_A 1sbb_A 1l0y_A 3c6l_B 1mwa_B* 1g6r_B* 1tcr_B* 2ckb_B 2q86_B* 1lp9_F 2j8u_F 2jcc_F 2uwe_F 3mbe_D* 1d9k_B* 2aq3_A 3mc0_A 3byt_A 3bzd_A ... Length = 238 | Back alignment and structure |
|---|
| >2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Length = 184 | Back alignment and structure |
|---|
| >2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} Length = 231 | Back alignment and structure |
|---|
| >1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* Length = 239 | Back alignment and structure |
|---|
| >3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} Length = 270 | Back alignment and structure |
|---|
| >2edo_A CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte activation marker blast-1, BCM1 surface antigen, leukocyte antigen MEM-102, TCT.1; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3nvq_A Semaphorin-7A; beta-propeller, signaling, signaling protein-protein binding; HET: NAG NDG; 2.40A {Homo sapiens} Length = 590 | Back alignment and structure |
|---|
| >1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Length = 201 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 292 | |||
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 100.0 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 100.0 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 100.0 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 100.0 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 100.0 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 100.0 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 100.0 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 100.0 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 100.0 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 100.0 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 100.0 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 100.0 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 100.0 | |
| 2rcj_C | 523 | Light chain; immunoglobulin M, polymeric antibodie | 100.0 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 100.0 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 100.0 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 100.0 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 100.0 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 100.0 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 100.0 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 100.0 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 100.0 | |
| 1qgc_4 | 438 | Protein (immunoglobulin); virus-antibody complex, | 100.0 | |
| 1wio_A | 363 | CD4, T-cell surface glycoprotein CD4; immunoglobul | 100.0 | |
| 2ocw_A | 585 | Polymeric-immunoglobulin receptor; SC, secretory, | 100.0 | |
| 2rcj_C | 523 | Light chain; immunoglobulin M, polymeric antibodie | 100.0 | |
| 2ocw_A | 585 | Polymeric-immunoglobulin receptor; SC, secretory, | 100.0 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 100.0 | |
| 1igt_B | 444 | IGG2A intact antibody - MAB231; intact immunoglobu | 100.0 | |
| 1z7z_I | 450 | Intercellular adhesion molecule-1; ICAM-1,kilifi,C | 100.0 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 100.0 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 100.0 | |
| 1z7z_I | 450 | Intercellular adhesion molecule-1; ICAM-1,kilifi,C | 99.98 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 99.98 | |
| 1hzh_H | 457 | IGG, immunoglobulin heavy chain; antibody, immune | 99.98 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 99.98 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 99.98 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 99.97 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 99.97 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 99.97 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 99.97 | |
| 2wng_A | 327 | Tyrosine-protein phosphatase non-receptor type sub | 99.97 | |
| 1igy_B | 434 | IGG1 intact antibody MAB61.1.3; intact immunoglobu | 99.97 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 99.97 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 99.97 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 99.97 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 99.97 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 99.97 | |
| 3oq3_B | 329 | IFN-alpha/beta binding protein C12R; mousepox viru | 99.97 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 99.97 | |
| 1iga_A | 475 | IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg | 99.97 | |
| 4dep_C | 349 | Interleukin-1 receptor accessory protein; B-trefoi | 99.97 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 99.97 | |
| 4fqp_A | 313 | Poliovirus receptor; immunoglobulin-like domain, I | 99.96 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 99.96 | |
| 4fom_A | 308 | Poliovirus receptor-related protein 3; immunoglobu | 99.96 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 99.96 | |
| 1wio_A | 363 | CD4, T-cell surface glycoprotein CD4; immunoglobul | 99.96 | |
| 3u83_A | 331 | Poliovirus receptor-related protein 1; nectin-1, h | 99.96 | |
| 3vh8_G | 316 | Killer cell immunoglobulin-like receptor 3DL1; imm | 99.96 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 99.96 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 99.96 | |
| 2oz4_A | 265 | Intercellular adhesion molecule 1; IGSF domain, st | 99.96 | |
| 1zvo_C | 512 | Myeloma immunoglobulin D delta; immunoglobulin fol | 99.95 | |
| 3mjg_X | 289 | Beta-type platelet-derived growth factor receptor; | 99.95 | |
| 1qgc_4 | 438 | Protein (immunoglobulin); virus-antibody complex, | 99.95 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 99.95 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 99.95 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 99.94 | |
| 3oq3_B | 329 | IFN-alpha/beta binding protein C12R; mousepox viru | 99.94 | |
| 2yd1_A | 212 | Tyrosine-protein phosphatase LAR; hydrolase; 1.80A | 99.94 | |
| 2yd6_A | 212 | PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa | 99.94 | |
| 1za6_B | 344 | IGG heavy chain; immunoglobulin fold, CH2-domain-d | 99.94 | |
| 2a38_A | 194 | Titin; Z1Z2, structural protein; 2.00A {Homo sapie | 99.94 | |
| 2j8h_A | 197 | Titin, connectin; cardiomyopathy, nuclear protein, | 99.94 | |
| 2wqr_A | 323 | IG epsilon chain C region; immune system, immunogl | 99.93 | |
| 3u83_A | 331 | Poliovirus receptor-related protein 1; nectin-1, h | 99.93 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 99.93 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 99.93 | |
| 4fqp_A | 313 | Poliovirus receptor; immunoglobulin-like domain, I | 99.93 | |
| 1igt_B | 444 | IGG2A intact antibody - MAB231; intact immunoglobu | 99.93 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 99.93 | |
| 1hzh_H | 457 | IGG, immunoglobulin heavy chain; antibody, immune | 99.93 | |
| 4dep_C | 349 | Interleukin-1 receptor accessory protein; B-trefoi | 99.93 | |
| 4fa8_A | 203 | Secreted protein BARF1; immunoglobulin-like domain | 99.93 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 99.93 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 99.93 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 99.92 | |
| 1epf_A | 191 | NCAM, protein (neural cell adhesion molecule); imm | 99.92 | |
| 3lcy_A | 197 | Titin; A-BAND, IG tandem domains, ATP-binding, cal | 99.92 | |
| 2v5t_A | 189 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; p | 99.92 | |
| 2c5d_C | 195 | AXL oncogene, tyrosine-protein kinase receptor UFO | 99.92 | |
| 2vr9_A | 217 | Roundabout 1, ROBO; immunoglobulin-like domain, AX | 99.92 | |
| 1rhf_A | 182 | Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 | 99.92 | |
| 3ojm_B | 231 | Fibroblast growth factor receptor 2; beta trefoil | 99.92 | |
| 1igy_B | 434 | IGG1 intact antibody MAB61.1.3; intact immunoglobu | 99.91 | |
| 2wv3_A | 190 | Neuroplastin; igcam, membrane, glycoprotein, cell | 99.91 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 99.91 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 99.91 | |
| 2v9r_A | 212 | Roundabout homolog 1; proto-oncogene, differentiat | 99.91 | |
| 1iga_A | 475 | IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg | 99.91 | |
| 4fom_A | 308 | Poliovirus receptor-related protein 3; immunoglobu | 99.91 | |
| 1f97_A | 212 | Junction adhesion molecule; immunoglobulin superfa | 99.91 | |
| 2wng_A | 327 | Tyrosine-protein phosphatase non-receptor type sub | 99.91 | |
| 1nbq_A | 209 | JAM, junctional adhesion molecule 1, PAM-1; reovir | 99.91 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 99.91 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 99.9 | |
| 3vh8_G | 316 | Killer cell immunoglobulin-like receptor 3DL1; imm | 99.9 | |
| 2va4_A | 192 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; t | 99.9 | |
| 2c1o_A | 254 | IGK-C protein; FAB fragment, enantioselective, fin | 99.9 | |
| 3grw_A | 241 | Fibroblast growth factor receptor 3; FGFR3, protei | 99.9 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.89 | |
| 1fnl_A | 175 | Low affinity immunoglobulin gamma FC region recept | 99.89 | |
| 3r4d_A | 208 | CEA-related cell adhesion molecule 1, isoform 1/2; | 99.89 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 99.89 | |
| 1hng_A | 176 | CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra | 99.88 | |
| 3sgj_C | 204 | Human FCG3A receptor; receptor complex, FC recepto | 99.88 | |
| 2v44_A | 189 | NCAM2, neural cell adhesion molecule 2; phosphoryl | 99.88 | |
| 3rbs_A | 207 | Myomesin-1; immunoglobulin C-SET domain, contractI | 99.87 | |
| 1f2q_A | 176 | High affinity immunoglobulin epsilon receptor ALP | 99.87 | |
| 2r15_A | 212 | Myomesin-1; sarcomeric protein, IG-like domains, h | 99.87 | |
| 1za6_B | 344 | IGG heavy chain; immunoglobulin fold, CH2-domain-d | 99.87 | |
| 3mjg_X | 289 | Beta-type platelet-derived growth factor receptor; | 99.87 | |
| 3s97_C | 201 | Contactin-1; carbonic anhdyrase like immunoglobuli | 99.87 | |
| 3jz7_A | 214 | MCAR, CAR, coxsackievirus and adenovirus receptor | 99.87 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 99.87 | |
| 1zvo_C | 512 | Myeloma immunoglobulin D delta; immunoglobulin fol | 99.87 | |
| 2fbo_J | 250 | V1V2;, variable region-containing chitin-binding p | 99.87 | |
| 3mj8_L | 213 | Stimulatory hamster antibody HL4E10 FAB light CHA; | 99.86 | |
| 1uct_A | 218 | Immunoglobulin alpha FC receptor; beta stands, imm | 99.86 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 99.86 | |
| 3bp6_B | 202 | Programmed cell death 1 ligand 2; PD-1, PD-L2, com | 99.86 | |
| 2oz4_A | 265 | Intercellular adhesion molecule 1; IGSF domain, st | 99.86 | |
| 2d3v_A | 196 | Leukocyte immunoglobulin-like receptor subfamily A | 99.85 | |
| 1jbj_A | 186 | CD3 epsilon and gamma ectodomain fragment complex; | 99.85 | |
| 1vca_A | 202 | VCAM-D1,2, human vascular cell adhesion molecule-1 | 99.85 | |
| 2v44_A | 189 | NCAM2, neural cell adhesion molecule 2; phosphoryl | 99.85 | |
| 3rbs_A | 207 | Myomesin-1; immunoglobulin C-SET domain, contractI | 99.85 | |
| 3b5h_A | 184 | Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce | 99.85 | |
| 2gi7_A | 184 | GPVI protein; IG-like domains, blood clotting, cel | 99.84 | |
| 1oll_A | 188 | NK receptor; immune system/receptor, NK cell trigg | 99.84 | |
| 2c1o_A | 254 | IGK-C protein; FAB fragment, enantioselective, fin | 99.84 | |
| 2x1w_L | 213 | Vascular endothelial growth factor receptor 2; hor | 99.84 | |
| 2pet_A | 231 | Lutheran blood group glycoprotein; immunoglobulin | 99.84 | |
| 2ny1_B | 184 | T-cell surface glycoprotein CD4; HIV, GP120, CD4, | 99.84 | |
| 4f80_A | 226 | Butyrophilin subfamily 3 member A1; B7 superfamily | 99.84 | |
| 4fa8_A | 203 | Secreted protein BARF1; immunoglobulin-like domain | 99.84 | |
| 2wqr_A | 323 | IG epsilon chain C region; immune system, immunogl | 99.84 | |
| 2wv3_A | 190 | Neuroplastin; igcam, membrane, glycoprotein, cell | 99.83 | |
| 1ugn_A | 198 | LIR1, leukocyte immunoglobulin-like receptor 1; im | 99.83 | |
| 3p2t_A | 196 | Leukocyte immunoglobulin-like receptor subfamily 4 | 99.83 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 99.83 | |
| 3nl4_L | 213 | Antigen binding fragment, immunoglobulin IGG - LI; | 99.83 | |
| 3s96_B | 218 | 3B5H10 FAB light chain; huntingtin, immune system; | 99.83 | |
| 4frw_A | 218 | Poliovirus receptor-related protein 4; immunoglobu | 99.83 | |
| 3ry4_A | 170 | Low affinity immunoglobulin gamma FC region recep; | 99.83 | |
| 2p1y_A | 238 | Bispecific alpha/beta TCR; autoimmunity, immunoglo | 99.83 | |
| 1hnf_A | 182 | CD2; T lymphocyte adhesion glycoprotein; HET: NAG; | 99.82 | |
| 1nfd_E | 212 | H57 FAB; complex (immunoreceptor-immunoglobulin), | 99.82 | |
| 3tf7_C | 256 | 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; | 99.82 | |
| 3sbw_C | 222 | Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- | 99.82 | |
| 3tv3_L | 211 | PGT128 light chain, IG lambda-2 chain C regions; F | 99.82 | |
| 1epf_A | 191 | NCAM, protein (neural cell adhesion molecule); imm | 99.82 | |
| 3mj6_A | 268 | Junctional adhesion molecule-like; immunoglobulin | 99.81 | |
| 1nkr_A | 201 | P58-CL42 KIR; inhibitory receptor, natural killer | 99.81 | |
| 2a38_A | 194 | Titin; Z1Z2, structural protein; 2.00A {Homo sapie | 99.81 | |
| 2yd1_A | 212 | Tyrosine-protein phosphatase LAR; hydrolase; 1.80A | 99.8 | |
| 2c5d_C | 195 | AXL oncogene, tyrosine-protein kinase receptor UFO | 99.8 | |
| 2j8h_A | 197 | Titin, connectin; cardiomyopathy, nuclear protein, | 99.8 | |
| 1p6f_A | 242 | NKP46, natural cytotoxicity triggering receptor 1; | 99.8 | |
| 3omz_A | 259 | Human vdelta1 gamma delta T cell receptor delta1A; | 99.8 | |
| 3d9a_L | 213 | Light chain of hyhel10 antibody fragment (FAB); ly | 99.79 | |
| 3pv7_A | 248 | B7-H6, IG-like domain-containing protein DKFZP686O | 99.79 | |
| 2d3v_A | 196 | Leukocyte immunoglobulin-like receptor subfamily A | 99.79 | |
| 3juy_B | 256 | 3B3 single chain variant HIV-1 antibody; envelope | 99.79 | |
| 3p2t_A | 196 | Leukocyte immunoglobulin-like receptor subfamily 4 | 99.79 | |
| 1f3r_B | 257 | FV antibody fragment; IG-fold, immuno complex, ant | 99.79 | |
| 2v9r_A | 212 | Roundabout homolog 1; proto-oncogene, differentiat | 99.79 | |
| 3umt_A | 256 | SCFV heavy chain and light chain; stability engine | 99.79 | |
| 1qok_A | 282 | MFE-23 recombinant antibody fragment; immunoglobul | 99.79 | |
| 3uzq_A | 253 | Anti-dengue MAB 4E11; dengue antibody neutralizati | 99.79 | |
| 3gkz_A | 257 | Anti-methamphetamine single chain FV; therapeutic | 99.79 | |
| 1rhf_A | 182 | Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 | 99.79 | |
| 2yd6_A | 212 | PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa | 99.79 | |
| 1ccz_A | 171 | Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 | 99.78 | |
| 2v5t_A | 189 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; p | 99.78 | |
| 1lk3_L | 210 | 9D7 light chain; antigen-antibody complex, immune | 99.78 | |
| 2dru_A | 180 | Chimera of CD48 antigen and T-cell surface antige; | 99.78 | |
| 2r15_A | 212 | Myomesin-1; sarcomeric protein, IG-like domains, h | 99.78 | |
| 1b6u_A | 257 | KIR2DL3, P58 killer cell inhibitory receptor; natu | 99.78 | |
| 1dr9_A | 201 | B7-1 (CD80), T lymphocyte activation antigen; IG s | 99.78 | |
| 2gi7_A | 184 | GPVI protein; IG-like domains, blood clotting, cel | 99.78 | |
| 4fmk_A | 225 | Poliovirus receptor-related protein 2; immunoglobu | 99.78 | |
| 2vr9_A | 217 | Roundabout 1, ROBO; immunoglobulin-like domain, AX | 99.78 | |
| 3jz7_A | 214 | MCAR, CAR, coxsackievirus and adenovirus receptor | 99.77 | |
| 2znx_A | 242 | SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s | 99.77 | |
| 2va4_A | 192 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; t | 99.77 | |
| 3ux9_B | 256 | SCFV antibody; five helices, long loop connecting | 99.77 | |
| 2x1w_L | 213 | Vascular endothelial growth factor receptor 2; hor | 99.77 | |
| 2j6e_L | 234 | IGM, FAB light chain; autoimmune complex human IGM | 99.77 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 99.77 | |
| 1uct_A | 218 | Immunoglobulin alpha FC receptor; beta stands, imm | 99.77 | |
| 3sgj_C | 204 | Human FCG3A receptor; receptor complex, FC recepto | 99.76 | |
| 3ry4_A | 170 | Low affinity immunoglobulin gamma FC region recep; | 99.76 | |
| 1svz_A | 247 | Immunoglobulin;, single-chain FV fragment 1696; an | 99.76 | |
| 3lcy_A | 197 | Titin; A-BAND, IG tandem domains, ATP-binding, cal | 99.76 | |
| 1f97_A | 212 | Junction adhesion molecule; immunoglobulin superfa | 99.76 | |
| 1q0x_L | 212 | FAB 9B1, light chain; anti-morphine antibody, FAB | 99.76 | |
| 2ghw_B | 247 | Anti-SARS SCFV antibody, 80R; S protein, neutraliz | 99.75 | |
| 3r06_A | 213 | Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; | 99.75 | |
| 1sy6_A | 204 | T-cell surface glycoprotein CD3 gamma/epsilon chai | 99.75 | |
| 3s97_C | 201 | Contactin-1; carbonic anhdyrase like immunoglobuli | 99.75 | |
| 3b5h_A | 184 | Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce | 99.75 | |
| 2if7_A | 193 | SLAM family member 6; NTB-A, homophilic receptor, | 99.75 | |
| 2gjj_A | 264 | A21 single-chain antibody fragment against ERBB2; | 99.74 | |
| 3o3u_N | 581 | Maltose-binding periplasmic protein, advanced Gly | 99.74 | |
| 3qib_D | 270 | 2B4 beta chain; IG domain, immune system; HET: NAG | 99.74 | |
| 1vca_A | 202 | VCAM-D1,2, human vascular cell adhesion molecule-1 | 99.74 | |
| 3sob_L | 237 | Antibody light chain; beta propeller, protein bind | 99.74 | |
| 1c1e_H | 219 | Catalytic antibody 1E9 (heavy chain); diels-alder, | 99.74 | |
| 3auv_A | 276 | SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid | 99.73 | |
| 3grw_A | 241 | Fibroblast growth factor receptor 3; FGFR3, protei | 99.73 | |
| 3knb_A | 100 | Titin; IG-like, titin, OBSL1, ATP-binding, calmodu | 99.73 | |
| 1ugn_A | 198 | LIR1, leukocyte immunoglobulin-like receptor 1; im | 99.73 | |
| 2fbo_J | 250 | V1V2;, variable region-containing chitin-binding p | 99.73 | |
| 1fnl_A | 175 | Low affinity immunoglobulin gamma FC region recept | 99.73 | |
| 2ny1_B | 184 | T-cell surface glycoprotein CD4; HIV, GP120, CD4, | 99.73 | |
| 2gki_A | 291 | Nuclease; anti-DNA antibody, catalytic antibody, i | 99.73 | |
| 4i0k_A | 222 | CD276 antigen; immunoglobulin domain, glycoprotein | 99.73 | |
| 3esu_F | 250 | Antibody 14B7* light chain and antibody 14B7* heav | 99.73 | |
| 2xzc_L | 216 | FAB A.17 light chain; immune system; HET: XOP; 1.3 | 99.73 | |
| 3bkj_L | 252 | WO2 IGG2A FAB fragment light chain kappa; abeta, F | 99.73 | |
| 1moe_A | 240 | Anti-CEA MAB T84.66; anti carcinoembryonic antigen | 99.72 | |
| 1nbq_A | 209 | JAM, junctional adhesion molecule 1, PAM-1; reovir | 99.72 | |
| 1q9r_B | 222 | S25-2 FAB (IGG1K) heavy chain; antigen-binding fra | 99.72 | |
| 3sbw_C | 222 | Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- | 99.72 | |
| 3bqu_C | 233 | 3H6 FAB light chain; beta sheet, immune system; 3. | 99.72 | |
| 3mj8_L | 213 | Stimulatory hamster antibody HL4E10 FAB light CHA; | 99.72 | |
| 3ojm_B | 231 | Fibroblast growth factor receptor 2; beta trefoil | 99.72 | |
| 1nqb_A | 256 | Single-chain antibody fragment; multivalent antibo | 99.72 | |
| 1lk3_L | 210 | 9D7 light chain; antigen-antibody complex, immune | 99.71 | |
| 4dzb_B | 246 | Vbeta2 (MAIT T cell receptor); immune system; 1.70 | 99.71 | |
| 3r4d_A | 208 | CEA-related cell adhesion molecule 1, isoform 1/2; | 99.71 | |
| 3d9a_L | 213 | Light chain of hyhel10 antibody fragment (FAB); ly | 99.71 | |
| 3knb_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, AT | 99.71 | |
| 4f80_A | 226 | Butyrophilin subfamily 3 member A1; B7 superfamily | 99.71 | |
| 1mq8_A | 291 | ICAM-1, intercellular adhesion molecule-1, CD54 an | 99.71 | |
| 1op3_H | 225 | FAB 2G12, heavy chain; domain-swapped FAB 2G12, an | 99.71 | |
| 2rgs_A | 218 | I, IG gamma-2B heavy chain; FC-fragment, immunoglo | 99.71 | |
| 1oll_A | 188 | NK receptor; immune system/receptor, NK cell trigg | 99.71 | |
| 4frw_A | 218 | Poliovirus receptor-related protein 4; immunoglobu | 99.71 | |
| 2vol_A | 207 | Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, | 99.71 | |
| 3mj6_A | 268 | Junctional adhesion molecule-like; immunoglobulin | 99.71 | |
| 2zg1_A | 214 | Sialic acid-binding IG-like lectin 5; siglec-5 inh | 99.7 | |
| 1sy6_A | 204 | T-cell surface glycoprotein CD3 gamma/epsilon chai | 99.7 | |
| 1hng_A | 176 | CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra | 99.7 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 99.7 | |
| 1f2q_A | 176 | High affinity immunoglobulin epsilon receptor ALP | 99.7 | |
| 3knb_A | 100 | Titin; IG-like, titin, OBSL1, ATP-binding, calmodu | 99.7 | |
| 4i0k_A | 222 | CD276 antigen; immunoglobulin domain, glycoprotein | 99.7 | |
| 3bp6_B | 202 | Programmed cell death 1 ligand 2; PD-1, PD-L2, com | 99.7 | |
| 3nl4_L | 213 | Antigen binding fragment, immunoglobulin IGG - LI; | 99.7 | |
| 3r06_A | 213 | Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; | 99.69 | |
| 3d9a_H | 210 | Heavy chain of hyhel10 antibody fragment (FAB); ly | 99.69 | |
| 2xzc_L | 216 | FAB A.17 light chain; immune system; HET: XOP; 1.3 | 99.69 | |
| 4acp_A | 240 | IG gamma-1 chain C region; immune system, antibody | 99.68 | |
| 1gsm_A | 210 | Madcam-1, mucosal addressin cell adhesion molecule | 99.68 | |
| 1nkr_A | 201 | P58-CL42 KIR; inhibitory receptor, natural killer | 99.68 | |
| 3tv3_L | 211 | PGT128 light chain, IG lambda-2 chain C regions; F | 99.68 | |
| 3nl4_H | 215 | Antigen binding fragment,immunoglobulin IGG - HEA; | 99.68 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.67 | |
| 1q0x_L | 212 | FAB 9B1, light chain; anti-morphine antibody, FAB | 99.67 | |
| 3pv7_A | 248 | B7-H6, IG-like domain-containing protein DKFZP686O | 99.67 | |
| 3sob_L | 237 | Antibody light chain; beta propeller, protein bind | 99.67 | |
| 3knb_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, AT | 99.67 | |
| 2fbj_H | 220 | IGA-kappa J539 FAB (heavy chain); immunoglobulin; | 99.67 | |
| 3q5y_A | 240 | TCR N15 beta; IG, T cell receptor, antigen peptide | 99.67 | |
| 1mq8_A | 291 | ICAM-1, intercellular adhesion molecule-1, CD54 an | 99.66 | |
| 1p6f_A | 242 | NKP46, natural cytotoxicity triggering receptor 1; | 99.66 | |
| 1mju_H | 227 | Immunoglobulin MS6-12; catalytic antibody, ester h | 99.66 | |
| 2pet_A | 231 | Lutheran blood group glycoprotein; immunoglobulin | 99.66 | |
| 1nqb_A | 256 | Single-chain antibody fragment; multivalent antibo | 99.66 | |
| 4ei6_B | 245 | Vbeta16 XV19 type II natural killer T cell recept | 99.66 | |
| 3m8o_H | 221 | Immunoglobulin A1 heavy chain; immunoglobulin fold | 99.66 | |
| 3nfj_J | 245 | T cell receptor beta chain; immunoglobulin family, | 99.66 | |
| 1jbj_A | 186 | CD3 epsilon and gamma ectodomain fragment complex; | 99.65 | |
| 3s96_B | 218 | 3B5H10 FAB light chain; huntingtin, immune system; | 99.65 | |
| 3eow_R | 221 | Poliovirus receptor; immunoglobulin super family, | 99.65 | |
| 1dr9_A | 201 | B7-1 (CD80), T lymphocyte activation antigen; IG s | 99.65 | |
| 2if7_A | 193 | SLAM family member 6; NTB-A, homophilic receptor, | 99.65 | |
| 1dee_B | 223 | IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin | 99.65 | |
| 1b6u_A | 257 | KIR2DL3, P58 killer cell inhibitory receptor; natu | 99.65 | |
| 3uzq_A | 253 | Anti-dengue MAB 4E11; dengue antibody neutralizati | 99.65 | |
| 1i1c_A | 239 | IGG2A, IG gamma-2A chain C region; FC, immune syst | 99.65 | |
| 2zg1_A | 214 | Sialic acid-binding IG-like lectin 5; siglec-5 inh | 99.65 | |
| 3pl6_D | 268 | MBP peptide / T-cell receptor beta chain chimera; | 99.65 | |
| 1pz5_B | 220 | Heavy chain of FAB (SYA/J6); antibody-antigen stru | 99.65 | |
| 1q9r_B | 222 | S25-2 FAB (IGG1K) heavy chain; antigen-binding fra | 99.65 | |
| 1pz5_B | 220 | Heavy chain of FAB (SYA/J6); antibody-antigen stru | 99.64 | |
| 3bqu_C | 233 | 3H6 FAB light chain; beta sheet, immune system; 3. | 99.64 | |
| 1x9q_A | 268 | SCFV, 4M5.3 anti-fluorescein single chain antibody | 99.64 | |
| 3bkj_L | 252 | WO2 IGG2A FAB fragment light chain kappa; abeta, F | 99.64 | |
| 1c1e_H | 219 | Catalytic antibody 1E9 (heavy chain); diels-alder, | 99.63 | |
| 3bae_H | 228 | WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO | 99.63 | |
| 1mju_H | 227 | Immunoglobulin MS6-12; catalytic antibody, ester h | 99.63 | |
| 2eo9_A | 118 | Roundabout homolog 1; beta-sandwich, IG-fold, H-RO | 99.63 | |
| 3eow_R | 221 | Poliovirus receptor; immunoglobulin super family, | 99.63 | |
| 2xqy_G | 261 | A13-D6.3 monoclonal antibody, envelope glycoprotei | 99.63 | |
| 3umt_A | 256 | SCFV heavy chain and light chain; stability engine | 99.63 | |
| 4fmk_A | 225 | Poliovirus receptor-related protein 2; immunoglobu | 99.63 | |
| 2rgs_A | 218 | I, IG gamma-2B heavy chain; FC-fragment, immunoglo | 99.63 | |
| 1l6x_A | 207 | Immunoglobulin gamma-1 heavy chain constant regio; | 99.63 | |
| 2ghw_B | 247 | Anti-SARS SCFV antibody, 80R; S protein, neutraliz | 99.63 | |
| 3d9a_H | 210 | Heavy chain of hyhel10 antibody fragment (FAB); ly | 99.62 | |
| 3esu_F | 250 | Antibody 14B7* light chain and antibody 14B7* heav | 99.62 | |
| 1f3r_B | 257 | FV antibody fragment; IG-fold, immuno complex, ant | 99.62 | |
| 2vol_A | 207 | Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, | 99.62 | |
| 3fku_X | 280 | Neutralizing antibody F10; influenza, hemagglutini | 99.62 | |
| 2p1y_A | 238 | Bispecific alpha/beta TCR; autoimmunity, immunoglo | 99.62 | |
| 3qib_D | 270 | 2B4 beta chain; IG domain, immune system; HET: NAG | 99.61 | |
| 4dzb_B | 246 | Vbeta2 (MAIT T cell receptor); immune system; 1.70 | 99.61 | |
| 1c5d_H | 215 | Monoclonal antibody against the main immunogenic t | 99.61 | |
| 3liz_H | 253 | 4C3 monoclonal antibody heavy chain; hydrolase-imm | 99.61 | |
| 1nfd_E | 212 | H57 FAB; complex (immunoreceptor-immunoglobulin), | 99.61 | |
| 1moe_A | 240 | Anti-CEA MAB T84.66; anti carcinoembryonic antigen | 99.61 | |
| 3to4_D | 253 | NKT vbeta2 (mouse variable domain, human constant; | 99.61 | |
| 2j6e_L | 234 | IGM, FAB light chain; autoimmune complex human IGM | 99.61 | |
| 3qp3_A | 103 | Titin; I-SET IG-like, sarcomere, M-BAND, transfera | 99.61 | |
| 2w59_A | 231 | IGY FCU3-4; immunoglobulin, avian, immune system; | 99.6 | |
| 3juy_B | 256 | 3B3 single chain variant HIV-1 antibody; envelope | 99.6 | |
| 1u2h_A | 99 | APEG-1, aortic preferentially expressed protein 1; | 99.6 | |
| 3auv_A | 276 | SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid | 99.6 | |
| 2w59_A | 231 | IGY FCU3-4; immunoglobulin, avian, immune system; | 99.6 | |
| 2cqv_A | 114 | MLCK, myosin light chain kinase, smooth muscle and | 99.6 | |
| 2yr3_A | 99 | Myosin light chain kinase, smooth muscle; IG domai | 99.6 | |
| 3gkz_A | 257 | Anti-methamphetamine single chain FV; therapeutic | 99.6 | |
| 2fbj_H | 220 | IGA-kappa J539 FAB (heavy chain); immunoglobulin; | 99.6 | |
| 2kkq_A | 116 | Myotilin; unknown function, actin-binding, cell me | 99.6 | |
| 3ux9_B | 256 | SCFV antibody; five helices, long loop connecting | 99.59 | |
| 1g1c_A | 99 | Immunoglobulin-like domain I1 from titin; immunogl | 99.59 | |
| 2edj_A | 100 | Roundabout homolog 2; KIAA1568 protein, beta sandw | 99.59 | |
| 3bn9_D | 257 | E2 FAB heavy chain; antibody-protease complex, pro | 99.59 | |
| 3kvq_A | 108 | Vascular endothelial growth factor receptor 2; veg | 99.59 | |
| 2znx_A | 242 | SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s | 99.59 | |
| 2kdg_A | 100 | Myotilin; immonoglobulin domain, actin-binding, st | 99.59 | |
| 1dee_B | 223 | IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin | 99.59 | |
| 1bec_A | 238 | 14.3.D T cell antigen receptor; T cell receptor; 1 | 99.59 | |
| 3liz_H | 253 | 4C3 monoclonal antibody heavy chain; hydrolase-imm | 99.59 | |
| 1wit_A | 93 | Twitchin 18TH IGSF module; immunoglobulin superfam | 99.59 | |
| 1qok_A | 282 | MFE-23 recombinant antibody fragment; immunoglobul | 99.59 | |
| 3puc_A | 99 | Titin; I-SET IG-like domain, M-BAND, transferase; | 99.59 | |
| 1hxm_B | 242 | Gamma-delta T-cell receptor; IG domain, TCR, GDTCR | 99.59 | |
| 3bae_H | 228 | WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO | 99.59 | |
| 3irg_A | 100 | Titin; IG-like, titin, OBSL1, complex, alternative | 99.58 | |
| 2lu7_A | 84 | Obscurin-like protein 1; structural genomics, nort | 99.58 | |
| 3shs_A | 304 | HOC head outer capsid protein; immunoglobulin-like | 99.58 | |
| 2wbj_D | 279 | OB TCR; transmembrane, immune response, T cell rec | 99.58 | |
| 1svz_A | 247 | Immunoglobulin;, single-chain FV fragment 1696; an | 99.58 | |
| 1hnf_A | 182 | CD2; T lymphocyte adhesion glycoprotein; HET: NAG; | 99.58 | |
| 1op3_H | 225 | FAB 2G12, heavy chain; domain-swapped FAB 2G12, an | 99.58 | |
| 1gsm_A | 210 | Madcam-1, mucosal addressin cell adhesion molecule | 99.58 | |
| 1he7_A | 126 | High affinity nerve growth factor receptor; transf | 99.57 | |
| 3tf7_C | 256 | 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; | 99.57 | |
| 2gki_A | 291 | Nuclease; anti-DNA antibody, catalytic antibody, i | 99.57 | |
| 3irg_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, co | 99.57 | |
| 2dru_A | 180 | Chimera of CD48 antigen and T-cell surface antige; | 99.56 | |
| 3cx2_A | 108 | Myosin-binding protein C, cardiac-type; protonatio | 99.56 | |
| 1l6x_A | 207 | Immunoglobulin gamma-1 heavy chain constant regio; | 99.56 | |
| 1dn0_B | 232 | IGM-kappa cold agglutinin (heavy chain); FAB, anti | 99.56 | |
| 2gjj_A | 264 | A21 single-chain antibody fragment against ERBB2; | 99.56 | |
| 2kdg_A | 100 | Myotilin; immonoglobulin domain, actin-binding, st | 99.56 | |
| 3tv3_H | 239 | PGT128 heavy chain, IG gamma-1 chain C region; FAB | 99.56 | |
| 1x9q_A | 268 | SCFV, 4M5.3 anti-fluorescein single chain antibody | 99.55 | |
| 2dm2_A | 110 | Palladin; beta-sandwich, KIAA0992, actin-associate | 99.55 | |
| 1dn0_B | 232 | IGM-kappa cold agglutinin (heavy chain); FAB, anti | 99.55 | |
| 2lvc_A | 91 | Obscurin-like protein 1; structural genomics, nort | 99.55 | |
| 1fhg_A | 154 | Telokin; immunoglobulin fold, beta barrel, contrac | 99.55 | |
| 4acp_A | 240 | IG gamma-1 chain C region; immune system, antibody | 99.55 | |
| 1g1c_A | 99 | Immunoglobulin-like domain I1 from titin; immunogl | 99.55 | |
| 1i1c_A | 239 | IGG2A, IG gamma-2A chain C region; FC, immune syst | 99.54 | |
| 1ow0_A | 214 | IG alpha-1 chain C region; IGA1, fcari, CD89, anti | 99.54 | |
| 3m8o_H | 221 | Immunoglobulin A1 heavy chain; immunoglobulin fold | 99.54 | |
| 2dav_A | 126 | SLOW MYBP-C, myosin-binding protein C, SLOW-type; | 99.54 | |
| 1wit_A | 93 | Twitchin 18TH IGSF module; immunoglobulin superfam | 99.53 | |
| 1ccz_A | 171 | Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 | 99.53 | |
| 3qhz_H | 232 | Human monoclonal antibody DEL2D1, FAB heavy chain; | 99.53 | |
| 4ei6_B | 245 | Vbeta16 XV19 type II natural killer T cell recept | 99.53 | |
| 3qp3_A | 103 | Titin; I-SET IG-like, sarcomere, M-BAND, transfera | 99.53 | |
| 3fku_X | 280 | Neutralizing antibody F10; influenza, hemagglutini | 99.53 | |
| 2aty_A | 376 | Complement receptor chimeric conjugate CR2-IG; imm | 99.53 | |
| 3nl4_H | 215 | Antigen binding fragment,immunoglobulin IGG - HEA; | 99.53 | |
| 3omz_A | 259 | Human vdelta1 gamma delta T cell receptor delta1A; | 99.53 | |
| 3u2s_H | 248 | PG9 heavy chain; greek KEY, immunoglobulin, immune | 99.52 | |
| 2cqv_A | 114 | MLCK, myosin light chain kinase, smooth muscle and | 99.52 | |
| 3q5y_A | 240 | TCR N15 beta; IG, T cell receptor, antigen peptide | 99.52 | |
| 2bk8_A | 97 | Connectin, M1, titin heart isoform N2-B; IG domain | 99.52 | |
| 2e7c_A | 118 | Myosin-binding protein C, fast-type; IG-like domai | 99.52 | |
| 1waa_A | 93 | Titin; metal binding protein, calmodulin-binding, | 99.52 | |
| 1ypz_F | 230 | T-cell receptor gamma chain, beta-2-microglobulin; | 99.52 | |
| 2ckn_A | 95 | Basic fibroblast growth factor receptor 1; kinase, | 99.52 | |
| 1nct_A | 106 | Titin; cell adhesion, glycoprotein, transmembrane, | 99.52 | |
| 2xqy_G | 261 | A13-D6.3 monoclonal antibody, envelope glycoprotei | 99.51 | |
| 1c5d_H | 215 | Monoclonal antibody against the main immunogenic t | 99.51 | |
| 1gxe_A | 139 | Myosin binding protein C, cardiac-type; cytoskelet | 99.51 | |
| 3irg_A | 100 | Titin; IG-like, titin, OBSL1, complex, alternative | 99.51 | |
| 1u2h_A | 99 | APEG-1, aortic preferentially expressed protein 1; | 99.51 | |
| 1oga_E | 252 | TRBC1, T-cell receptor beta chain C region; immune | 99.51 | |
| 2edj_A | 100 | Roundabout homolog 2; KIAA1568 protein, beta sandw | 99.51 | |
| 1ypz_E | 207 | T cell receptor delta, beta-2-microglobulin; H2-T2 | 99.51 | |
| 2cry_A | 122 | KIN of IRRE-like protein 3; IG fold, KIN of irregu | 99.5 | |
| 2dm3_A | 110 | KIAA0992 protein, palladin; beta-sandwich, myopall | 99.5 | |
| 2bk8_A | 97 | Connectin, M1, titin heart isoform N2-B; IG domain | 99.5 | |
| 3pl6_D | 268 | MBP peptide / T-cell receptor beta chain chimera; | 99.5 | |
| 2dm2_A | 110 | Palladin; beta-sandwich, KIAA0992, actin-associate | 99.5 | |
| 1hxm_B | 242 | Gamma-delta T-cell receptor; IG domain, TCR, GDTCR | 99.5 | |
| 2eo9_A | 118 | Roundabout homolog 1; beta-sandwich, IG-fold, H-RO | 99.5 | |
| 3puc_A | 99 | Titin; I-SET IG-like domain, M-BAND, transferase; | 99.49 | |
| 3bn9_D | 257 | E2 FAB heavy chain; antibody-protease complex, pro | 99.49 | |
| 1gxe_A | 139 | Myosin binding protein C, cardiac-type; cytoskelet | 99.49 | |
| 3caf_A | 100 | Fibroblast growth factor receptor 2; FGFR2, D2, AT | 99.49 | |
| 2yuz_A | 100 | Myosin-binding protein C, SLOW-type; immunoglobuli | 99.49 | |
| 2ckn_A | 95 | Basic fibroblast growth factor receptor 1; kinase, | 99.49 | |
| 2edn_A | 118 | Myosin-binding protein C, fast-type; beta-sandwich | 99.49 | |
| 3qhz_H | 232 | Human monoclonal antibody DEL2D1, FAB heavy chain; | 99.49 | |
| 2kkq_A | 116 | Myotilin; unknown function, actin-binding, cell me | 99.48 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.48 | |
| 1waa_A | 93 | Titin; metal binding protein, calmodulin-binding, | 99.48 | |
| 2yuz_A | 100 | Myosin-binding protein C, SLOW-type; immunoglobuli | 99.48 | |
| 2dm3_A | 110 | KIAA0992 protein, palladin; beta-sandwich, myopall | 99.48 | |
| 2e7c_A | 118 | Myosin-binding protein C, fast-type; IG-like domai | 99.48 | |
| 3nfj_J | 245 | T cell receptor beta chain; immunoglobulin family, | 99.47 | |
| 3kvq_A | 108 | Vascular endothelial growth factor receptor 2; veg | 99.47 | |
| 1wwb_X | 103 | Protein (brain derived neurotrophic factor recepto | 99.47 | |
| 2lu7_A | 84 | Obscurin-like protein 1; structural genomics, nort | 99.46 | |
| 3bfo_A | 91 | Mucosa-associated lymphoid tissue lymphoma translo | 99.46 | |
| 2yr3_A | 99 | Myosin light chain kinase, smooth muscle; IG domai | 99.46 | |
| 2v9t_A | 117 | Roundabout homolog 1; structural protein-receptor | 99.46 | |
| 1nct_A | 106 | Titin; cell adhesion, glycoprotein, transmembrane, | 99.46 | |
| 3irg_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, co | 99.46 | |
| 3bfo_A | 91 | Mucosa-associated lymphoid tissue lymphoma translo | 99.46 | |
| 3tv3_H | 239 | PGT128 heavy chain, IG gamma-1 chain C region; FAB | 99.46 | |
| 2aty_A | 376 | Complement receptor chimeric conjugate CR2-IG; imm | 99.45 | |
| 2v9t_A | 117 | Roundabout homolog 1; structural protein-receptor | 99.45 | |
| 3u2s_H | 248 | PG9 heavy chain; greek KEY, immunoglobulin, immune | 99.44 | |
| 2cr3_A | 99 | Basic fibroblast growth factor receptor 1; IG fold | 99.44 | |
| 3caf_A | 100 | Fibroblast growth factor receptor 2; FGFR2, D2, AT | 99.44 | |
| 3m45_A | 108 | Cell adhesion molecule 2; IG fold, dimer, disulfid | 99.44 | |
| 3n9g_H | 230 | FAB fragment of MAB CR4354, heavy chain; human neu | 99.44 | |
| 2edh_A | 113 | Obscurin; structural genomics, NPPSFA, national pr | 99.44 | |
| 2dlt_A | 106 | Myosin binding protein C, fast-type; IG-like domai | 99.44 | |
| 1wwb_X | 103 | Protein (brain derived neurotrophic factor recepto | 99.43 | |
| 4hwu_A | 95 | Fibroblast growth factor receptor 2; FGFR2, KGFR, | 99.43 | |
| 1gl4_B | 98 | Basement membrane-specific heparan sulfate proteog | 99.43 | |
| 1x44_A | 103 | Myosin-binding protein C, SLOW-type; IG-like domai | 99.42 | |
| 3s35_X | 122 | Vascular endothelial growth factor receptor 2; ant | 99.42 | |
| 1fhg_A | 154 | Telokin; immunoglobulin fold, beta barrel, contrac | 99.42 | |
| 2ens_A | 96 | Advanced glycosylation END product-specific recept | 99.42 | |
| 2lvc_A | 91 | Obscurin-like protein 1; structural genomics, nort | 99.42 | |
| 2wbj_D | 279 | OB TCR; transmembrane, immune response, T cell rec | 99.42 | |
| 1bec_A | 238 | 14.3.D T cell antigen receptor; T cell receptor; 1 | 99.42 | |
| 3cx2_A | 108 | Myosin-binding protein C, cardiac-type; protonatio | 99.41 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 99.41 | |
| 3f8u_B | 401 | Tapasin; endoplasmic reticulum, glycoprotein, immu | 99.41 | |
| 2edn_A | 118 | Myosin-binding protein C, fast-type; beta-sandwich | 99.41 | |
| 3o3u_N | 581 | Maltose-binding periplasmic protein, advanced Gly | 99.41 | |
| 1wwc_A | 118 | Protein (NT-3 growth factor receptor TRKC); TRK re | 99.4 | |
| 3so5_A | 112 | LIG-3, leucine-rich repeats and immunoglobulin-lik | 99.4 | |
| 1oga_E | 252 | TRBC1, T-cell receptor beta chain C region; immune | 99.4 | |
| 2edf_A | 103 | Obscurin; beta-sandwich, IG-fold, structural genom | 99.4 | |
| 1he7_A | 126 | High affinity nerve growth factor receptor; transf | 99.39 | |
| 2k1m_A | 95 | Myosin-binding protein C, cardiac-type; IG-I domai | 99.39 | |
| 2cr6_A | 115 | KIAA1556 protein, obscurin; IG-fold, immunoglobuli | 99.39 | |
| 3rbg_A | 124 | Cytotoxic and regulatory T-cell molecule; IGV, crt | 99.39 | |
| 3mlr_H | 226 | Human monoclonal anti-HIV-1 GP120 V3 antibody 255 | 99.39 | |
| 2dav_A | 126 | SLOW MYBP-C, myosin-binding protein C, SLOW-type; | 99.39 | |
| 3n9g_H | 230 | FAB fragment of MAB CR4354, heavy chain; human neu | 99.38 | |
| 3to4_D | 253 | NKT vbeta2 (mouse variable domain, human constant; | 99.38 | |
| 2edk_A | 101 | Myosin-binding protein C, fast-type; IG fold, fast | 99.38 | |
| 3r08_E | 82 | T-cell surface glycoprotein CD3 epsilon chain; ant | 99.38 | |
| 3qr2_A | 137 | Basigin; CD147, EMMPRIN, immunoglobulin-like domai | 99.38 | |
| 2e6p_A | 104 | Obscurin-like protein 1; IG-like domain, structura | 99.38 | |
| 2edk_A | 101 | Myosin-binding protein C, fast-type; IG fold, fast | 99.38 | |
| 3sob_H | 256 | Antibody heavy chain, low-density lipoprotein rece | 99.38 | |
| 1hxm_A | 229 | Gamma-delta T-cell receptor; IG domain, TCR, GDTCR | 99.37 | |
| 3iu4_H | 263 | CHP3 FAB heavy chain; antibody, ganglioside, idiot | 99.37 | |
| 1pd6_A | 104 | Cardiac MYBP-C;, myosin-binding protein C, cardiac | 99.37 | |
| 2eny_A | 104 | Obscurin; beta-sandwich, IG-fold, structural genom | 99.37 | |
| 1gl4_B | 98 | Basement membrane-specific heparan sulfate proteog | 99.37 | |
| 2eny_A | 104 | Obscurin; beta-sandwich, IG-fold, structural genom | 99.37 | |
| 1wwc_A | 118 | Protein (NT-3 growth factor receptor TRKC); TRK re | 99.37 | |
| 3shs_A | 304 | HOC head outer capsid protein; immunoglobulin-like | 99.37 | |
| 2dlt_A | 106 | Myosin binding protein C, fast-type; IG-like domai | 99.36 | |
| 1x44_A | 103 | Myosin-binding protein C, SLOW-type; IG-like domai | 99.36 | |
| 2cr3_A | 99 | Basic fibroblast growth factor receptor 1; IG fold | 99.36 | |
| 2dku_A | 103 | KIAA1556 protein; beta-sandwich, IG-fold, obscurin | 99.35 | |
| 1ypz_F | 230 | T-cell receptor gamma chain, beta-2-microglobulin; | 99.35 | |
| 2cpc_A | 113 | KIAA0657 protein; immunoglobulin domain, IG domain | 99.35 | |
| 2yuv_A | 100 | Myosin-binding protein C, SLOW-type; SLOW-type myo | 99.34 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 99.34 | |
| 2cry_A | 122 | KIN of IRRE-like protein 3; IG fold, KIN of irregu | 99.34 |
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.1e-41 Score=285.44 Aligned_cols=273 Identities=23% Similarity=0.380 Sum_probs=216.3
Q ss_pred cccCCcCCCeeEEEEEEecccccccccEEEEEeCCCcEEeCCC-ccEEecCCcEEEEEEEeeeCCCeeEEEECCeEEeec
Q psy15128 2 ITEVKKSDEGKYQCYVQNMVGERETKPALLTVHAPPSFVVRPQ-DQKVGLNGIASFQCVAEGSPLPSVFWTQEGSQVLMF 80 (292)
Q Consensus 2 i~~v~~~D~G~Y~C~~~~~~~~~~~~~~~l~v~~~p~~~~~~~-~~~~~~g~~~~l~C~~~~~~~~~v~W~~~~~~~~~~ 80 (292)
|.+++.+|+|.|+|.+.|..|..... +.|.|..+|.+..... ...+.+|+.+.|.|.+.|.|.+.+.|++++..+...
T Consensus 257 i~~v~~~D~G~Y~C~a~N~~g~~~~~-~~l~V~~~p~~~~~~~~~~~v~~g~~~~l~C~~~g~P~p~v~W~k~~~~l~~~ 335 (570)
T 3b43_A 257 VLKVTKGDAGQYTCYASNVAGKDSCS-AQLGVQEPPRFIKKLEPSRIVKQDEHTRYECKIGGSPEIKVLWYKDETEIQES 335 (570)
T ss_dssp ESSBCGGGCEEEEEEEEETTEEEEEE-EEECCBCCCEEEECCCSBCCEESSCEEEEEEEEESSSSCEEEEEETTEECCCS
T ss_pred EcccCcccCEEEEEEEECCCCcEEEE-EEEEeecCCcccccCCCccEEcCCCcEEEEEEEeeCCCCEEEEeECCEECCCC
Confidence 67899999999999999998887666 8999999998776543 345788999999999999999999999999876321
Q ss_pred cCCCcceeEEeeecEEEEccCCCCCCeEEEEEEEeCCcCeeEEEEEEEEeecCCCCCeEEeCCCCceecCCCeEEEEeEe
Q psy15128 81 PGNAYGHLHVTQEGTLRIQGVQKEDAGFFVCSALSVAGSTTVRAFLQVTSVEDTPPPIVQVGPSNQTLPLHSVAFLPCQA 160 (292)
Q Consensus 81 ~~~~~~~~~~~~~~~l~i~~~~~~d~g~Y~C~~~~~~~~~~~~~~l~v~~~~~~~~~~~~~~~~~~~~~~g~~v~l~C~~ 160 (292)
.............|.|.+++.+|+|.|+|.|.|..|.......|.|.. +|.+...+....+.+|+.+.|.|.+
T Consensus 336 --~~~~~~~~~~~~~L~i~~v~~~D~G~Y~C~a~N~~g~~~~~~~l~V~~-----~P~~~~~~~~~~~~~G~~v~l~C~~ 408 (570)
T 3b43_A 336 --SKFRMSFVESVAVLEMYNLSVEDSGDYTCEAHNAAGSASSSTSLKVKE-----PPVFRKKPHPVETLKGADVHLECEL 408 (570)
T ss_dssp --SSEEEEEETTEEEEEEESCCGGGCEEEEEEEEBTTBCCEEEEEECEEC-----CCEECSCCCCEEECTTCCEEEEEEE
T ss_pred --CcEEEEEECCEEEEEECCCCcccCEEEEEEEEeCCCEEEEEEEEEecC-----CCeeecCCCceeecCCCEEEEEEEE
Confidence 111111122345799999999999999999999999888888877763 6666666777778899999999999
Q ss_pred ccCCCCceEEEeCCeeCCCCCccEEEcCC---CcEEEEeeecCCCCCC-----------------------------cce
Q psy15128 161 VGSPPPHIRWYKNGNSLPPEDTRINVSSS---GSLQIDVLRDDFRAEP-----------------------------KDT 208 (292)
Q Consensus 161 ~~~p~~~~~W~~~~~~l~~~~~~~~~~~~---~~l~i~~~~~~d~g~~-----------------------------~~~ 208 (292)
.+.|.|.+.|+|++.++.... ++.+..+ ..|.|.++..+|+|.| ...
T Consensus 409 ~g~P~p~v~W~k~g~~l~~~~-~~~~~~~~~~~~L~i~~v~~~D~G~Y~C~A~N~~G~~~~~~~l~v~~~P~~~~~~~~~ 487 (570)
T 3b43_A 409 QGTPPFQVSWHKDKRELRSGK-KYKIMSENFLTSIHILNVDSADIGEYQCKASNDVGSDTCVGSITLKAPPRFVKKLSDI 487 (570)
T ss_dssp ESSSSCCCEEEETTEECCSSS-SEEEEEETTEEEEEECSCCGGGCEEEEEEEECSSCEEEEEEEEEECCCCEEEECCCCB
T ss_pred ecCCCCEEEEEECCEECcCCC-CEEEEEcCCEEEEEECCCChhhCEEEEEEEEECCCeEEEEEEEEeccCCcccccCCCc
Confidence 999999999999999987653 3333222 3688999999999922 344
Q ss_pred EEeCCCceEEEeeCCCCCCCCeEEEeEcCeEeccCCCceEEecCCCccccccccccccccccccccceeEEEEeeccccc
Q psy15128 209 RVASGETALLECGPPKGQPEPTLHWKKNGQFIDLESSKRVSILGDPWFDSRRSRSIFGSVLGALSDDQWKLIAKNIRNQQ 288 (292)
Q Consensus 209 ~~~~g~~~~l~C~~~~~~p~~~~~W~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~~~g~y~C~a~n~~g~~ 288 (292)
.+.+|+.+.|.|.+ .|.|++.+.|++++..+.. .+.++.+...+ ....|.|..+..+|+|.|+|.|+|.+|.+
T Consensus 488 ~~~~g~~~~l~c~~-~g~p~~~v~W~k~~~~~~~-~~~~~~~~~~~-----~~~~L~i~~~~~~d~G~Y~C~a~N~~G~~ 560 (570)
T 3b43_A 488 STVVGEEVQLQATI-EGAEPISVAWFKDKGEIVR-ESDNIWISYSE-----NIATLQFSRAEPANAGKYTCQIKNEAGTQ 560 (570)
T ss_dssp CCBTTCCEEEEEEE-ESCSSCCCEEEETTEECCC-CTTTEEECCCS-----SEEEEEESSCCTTCCEEEEEEEECSSCEE
T ss_pred eecCCCeEEEEEEE-ecCCCCEEEEEeCCeEecc-CCCeEEEEECC-----CEEEEEECcCCHHHCEEEEEEEEECCcEE
Confidence 56789999999998 8999999999999866532 23334332221 12368899999999999999999999998
Q ss_pred cc
Q psy15128 289 QH 290 (292)
Q Consensus 289 ~~ 290 (292)
+.
T Consensus 561 ~~ 562 (570)
T 3b43_A 561 EC 562 (570)
T ss_dssp EE
T ss_pred EE
Confidence 64
|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* | Back alignment and structure |
|---|
| >2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J | Back alignment and structure |
|---|
| >2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} | Back alignment and structure |
|---|
| >1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R | Back alignment and structure |
|---|
| >1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A | Back alignment and structure |
|---|
| >4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A | Back alignment and structure |
|---|
| >3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* | Back alignment and structure |
|---|
| >1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A | Back alignment and structure |
|---|
| >1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A | Back alignment and structure |
|---|
| >2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* | Back alignment and structure |
|---|
| >4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R | Back alignment and structure |
|---|
| >1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* | Back alignment and structure |
|---|
| >4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C | Back alignment and structure |
|---|
| >1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A | Back alignment and structure |
|---|
| >1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A | Back alignment and structure |
|---|
| >4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 | Back alignment and structure |
|---|
| >2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D | Back alignment and structure |
|---|
| >2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} | Back alignment and structure |
|---|
| >3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* | Back alignment and structure |
|---|
| >1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* | Back alignment and structure |
|---|
| >2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* | Back alignment and structure |
|---|
| >2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... | Back alignment and structure |
|---|
| >4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A | Back alignment and structure |
|---|
| >4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* | Back alignment and structure |
|---|
| >2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A | Back alignment and structure |
|---|
| >3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A | Back alignment and structure |
|---|
| >4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A | Back alignment and structure |
|---|
| >2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A | Back alignment and structure |
|---|
| >1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A | Back alignment and structure |
|---|
| >3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A | Back alignment and structure |
|---|
| >3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* | Back alignment and structure |
|---|
| >1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A | Back alignment and structure |
|---|
| >1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} | Back alignment and structure |
|---|
| >3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... | Back alignment and structure |
|---|
| >3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* | Back alignment and structure |
|---|
| >2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A | Back alignment and structure |
|---|
| >3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D | Back alignment and structure |
|---|
| >1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A | Back alignment and structure |
|---|
| >3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A | Back alignment and structure |
|---|
| >1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* | Back alignment and structure |
|---|
| >2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* | Back alignment and structure |
|---|
| >2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X | Back alignment and structure |
|---|
| >2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* | Back alignment and structure |
|---|
| >3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* | Back alignment and structure |
|---|
| >2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* | Back alignment and structure |
|---|
| >3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A | Back alignment and structure |
|---|
| >1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 | Back alignment and structure |
|---|
| >1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... | Back alignment and structure |
|---|
| >2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* | Back alignment and structure |
|---|
| >1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C | Back alignment and structure |
|---|
| >3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A | Back alignment and structure |
|---|
| >3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A | Back alignment and structure |
|---|
| >3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* | Back alignment and structure |
|---|
| >1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H | Back alignment and structure |
|---|
| >3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* | Back alignment and structure |
|---|
| >1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... | Back alignment and structure |
|---|
| >2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} | Back alignment and structure |
|---|
| >4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} | Back alignment and structure |
|---|
| >3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* | Back alignment and structure |
|---|
| >2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... | Back alignment and structure |
|---|
| >3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L | Back alignment and structure |
|---|
| >1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G | Back alignment and structure |
|---|
| >1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... | Back alignment and structure |
|---|
| >3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A | Back alignment and structure |
|---|
| >3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C | Back alignment and structure |
|---|
| >1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H | Back alignment and structure |
|---|
| >1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* | Back alignment and structure |
|---|
| >4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* | Back alignment and structure |
|---|
| >3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... | Back alignment and structure |
|---|
| >3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O | Back alignment and structure |
|---|
| >4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A | Back alignment and structure |
|---|
| >1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 | Back alignment and structure |
|---|
| >1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* | Back alignment and structure |
|---|
| >2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} | Back alignment and structure |
|---|
| >1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A | Back alignment and structure |
|---|
| >3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* | Back alignment and structure |
|---|
| >2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A | Back alignment and structure |
|---|
| >1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* | Back alignment and structure |
|---|
| >1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* | Back alignment and structure |
|---|
| >3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* | Back alignment and structure |
|---|
| >4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} | Back alignment and structure |
|---|
| >3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* | Back alignment and structure |
|---|
| >3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... | Back alignment and structure |
|---|
| >2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... | Back alignment and structure |
|---|
| >4acp_A IG gamma-1 chain C region; immune system, antibody, kifunensine; HET: NAG; 2.49A {Homo sapiens} PDB: 2j6e_A* | Back alignment and structure |
|---|
| >1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* | Back alignment and structure |
|---|
| >1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A | Back alignment and structure |
|---|
| >3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... | Back alignment and structure |
|---|
| >3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* | Back alignment and structure |
|---|
| >3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* | Back alignment and structure |
|---|
| >3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O | Back alignment and structure |
|---|
| >2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* | Back alignment and structure |
|---|
| >3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A | Back alignment and structure |
|---|
| >1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 | Back alignment and structure |
|---|
| >1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... | Back alignment and structure |
|---|
| >2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A | Back alignment and structure |
|---|
| >1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H | Back alignment and structure |
|---|
| >4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D | Back alignment and structure |
|---|
| >3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B | Back alignment and structure |
|---|
| >1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A | Back alignment and structure |
|---|
| >3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A | Back alignment and structure |
|---|
| >1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* | Back alignment and structure |
|---|
| >2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H | Back alignment and structure |
|---|
| >1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A | Back alignment and structure |
|---|
| >1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* | Back alignment and structure |
|---|
| >2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A | Back alignment and structure |
|---|
| >3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} | Back alignment and structure |
|---|
| >1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* | Back alignment and structure |
|---|
| >1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... | Back alignment and structure |
|---|
| >1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* | Back alignment and structure |
|---|
| >3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L | Back alignment and structure |
|---|
| >1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H | Back alignment and structure |
|---|
| >3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... | Back alignment and structure |
|---|
| >1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xqy_G A13-D6.3 monoclonal antibody, envelope glycoprotein H; immune system-viral protein complex, envelope protein; HET: NAG; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D | Back alignment and structure |
|---|
| >4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* | Back alignment and structure |
|---|
| >2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} | Back alignment and structure |
|---|
| >1l6x_A Immunoglobulin gamma-1 heavy chain constant regio; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2iwg_A* 3v7m_A* 3d6g_A* 3agv_A* 1oqo_A* 1oqx_A* 3v95_A* 2wah_A* 3sgj_A* 3sgk_A* 2dtq_A* 2dts_A* 3ave_A* 3ay4_A* 3do3_A* 2gj7_A* 1t83_A* 1t89_A* 1dn2_A* 3dnk_A ... | Back alignment and structure |
|---|
| >2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... | Back alignment and structure |
|---|
| >3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* | Back alignment and structure |
|---|
| >1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A | Back alignment and structure |
|---|
| >3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A | Back alignment and structure |
|---|
| >3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} | Back alignment and structure |
|---|
| >4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E | Back alignment and structure |
|---|
| >1c5d_H Monoclonal antibody against the main immunogenic the human muscle acetylcholine receptor...; immunoglobulin, immune system; 2.40A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 2arj_H 3b9k_H* 2gk0_H 2gjz_H 1fn4_B 3mj8_H 3mj9_H* | Back alignment and structure |
|---|
| >3liz_H 4C3 monoclonal antibody heavy chain; hydrolase-immune system complex; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 3rvv_D* 3rvu_D 3rvt_D* 3rvw_D* 3rvx_D 1lo4_H 1ub6_H 3r06_B 3r08_H | Back alignment and structure |
|---|
| >1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >3to4_D NKT vbeta2 (mouse variable domain, human constant; mouse CD1D, mouse NKT, immune system; HET: AGH NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} | Back alignment and structure |
|---|
| >3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} | Back alignment and structure |
|---|
| >3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L | Back alignment and structure |
|---|
| >2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A | Back alignment and structure |
|---|
| >2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bn9_D E2 FAB heavy chain; antibody-protease complex, protein-protein complex, enzyme- inhibitor complex, disease mutation, glycoprotein, hydrolase; 2.17A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kr3_H 2xtj_E | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 | Back alignment and structure |
|---|
| >2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H | Back alignment and structure |
|---|
| >1bec_A 14.3.D T cell antigen receptor; T cell receptor; 1.70A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1jck_A 1l0x_A 1sbb_A 1l0y_A 3c6l_B 1mwa_B* 1g6r_B* 1tcr_B* 2ckb_B 2q86_B* 1lp9_F 2j8u_F 2jcc_F 2uwe_F 3mbe_D* 1d9k_B* 2aq3_A 3mc0_A 3byt_A 3bzd_A ... | Back alignment and structure |
|---|
| >3liz_H 4C3 monoclonal antibody heavy chain; hydrolase-immune system complex; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 3rvv_D* 3rvu_D 3rvt_D* 3rvw_D* 3rvx_D 1lo4_H 1ub6_H 3r06_B 3r08_H | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A | Back alignment and structure |
|---|
| >1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} | Back alignment and structure |
|---|
| >1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... | Back alignment and structure |
|---|
| >2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} | Back alignment and structure |
|---|
| >2wbj_D OB TCR; transmembrane, immune response, T cell receptor, MHC II, MEM receptor, molecular mimicry, multiple sclerosis, immune SYS autoimmunity; HET: NAG BMA MAN; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A | Back alignment and structure |
|---|
| >1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* | Back alignment and structure |
|---|
| >1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* | Back alignment and structure |
|---|
| >1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X | Back alignment and structure |
|---|
| >3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} | Back alignment and structure |
|---|
| >2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A | Back alignment and structure |
|---|
| >1l6x_A Immunoglobulin gamma-1 heavy chain constant regio; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2iwg_A* 3v7m_A* 3d6g_A* 3agv_A* 1oqo_A* 1oqx_A* 3v95_A* 2wah_A* 3sgj_A* 3sgk_A* 2dtq_A* 2dts_A* 3ave_A* 3ay4_A* 3do3_A* 2gj7_A* 1t83_A* 1t89_A* 1dn2_A* 3dnk_A ... | Back alignment and structure |
|---|
| >1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H | Back alignment and structure |
|---|
| >2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tv3_H PGT128 heavy chain, IG gamma-1 chain C region; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_H* 3twc_H* 3tje_H* 3thm_H* 4fqq_H 2xzc_H* 2xza_H* 3b2u_H* 3b2v_H* 3mly_H 3mlz_H 4fq2_H 2ykl_H* 3tnm_H 4fqc_H* 4fq1_H* 2yk1_H* 3mlx_H 2jix_D 2vxq_H ... | Back alignment and structure |
|---|
| >1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H | Back alignment and structure |
|---|
| >2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A | Back alignment and structure |
|---|
| >4acp_A IG gamma-1 chain C region; immune system, antibody, kifunensine; HET: NAG; 2.49A {Homo sapiens} PDB: 2j6e_A* | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* | Back alignment and structure |
|---|
| >1ow0_A IG alpha-1 chain C region; IGA1, fcari, CD89, antibody, immunoglobulin-LIK immune system; HET: NAG FUL BMA GAL SIA FUC MAN NDG; 3.10A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2qej_A* | Back alignment and structure |
|---|
| >3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B | Back alignment and structure |
|---|
| >2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A | Back alignment and structure |
|---|
| >1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B | Back alignment and structure |
|---|
| >3qhz_H Human monoclonal antibody DEL2D1, FAB heavy chain; immunoglobulin, immune recognition, influenza A hemagglutini system; 1.55A {Homo sapiens} PDB: 3lzf_H* 3qrg_H* 3mod_H 3mob_H 3moa_H 3lev_H* 3idg_B 3d0l_B 3d0v_B 3idi_B 3idj_B 3idm_B* 3idn_B* 1tjg_H* 1tjh_H* 1tji_H* 2pr4_H 3drq_B 2p8m_B 2p8p_B ... | Back alignment and structure |
|---|
| >4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} | Back alignment and structure |
|---|
| >3u2s_H PG9 heavy chain; greek KEY, immunoglobulin, immune recognition, immune system; HET: PCA TYS BU3 NAG BMA MAN; 1.80A {Homo sapiens} PDB: 3u4e_H* 3u36_H 3mug_B* 3lrs_H* 3mme_H* 2qsc_H* | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A | Back alignment and structure |
|---|
| >1ypz_F T-cell receptor gamma chain, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A | Back alignment and structure |
|---|
| >2xqy_G A13-D6.3 monoclonal antibody, envelope glycoprotein H; immune system-viral protein complex, envelope protein; HET: NAG; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1c5d_H Monoclonal antibody against the main immunogenic the human muscle acetylcholine receptor...; immunoglobulin, immune system; 2.40A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 2arj_H 3b9k_H* 2gk0_H 2gjz_H 1fn4_B 3mj8_H 3mj9_H* | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} | Back alignment and structure |
|---|
| >1oga_E TRBC1, T-cell receptor beta chain C region; immune system/receptor, immune system/receptor/complex, TCR, MHC, immunodominance, FLU, complex; 1.40A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 2vlm_E 2vlk_E 2vlj_E 2vlr_E 2xna_B 2xn9_B 2axh_A 2axj_A 3scm_D* 3sda_D* 3sdc_D* 3sdd_D* 3qi9_D* 3mff_B* 2ak4_E 3he7_D* 2eyr_B 3pqy_E 3kxf_E 2cde_B ... | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ypz_E T cell receptor delta, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} | Back alignment and structure |
|---|
| >3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} | Back alignment and structure |
|---|
| >3bn9_D E2 FAB heavy chain; antibody-protease complex, protein-protein complex, enzyme- inhibitor complex, disease mutation, glycoprotein, hydrolase; 2.17A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kr3_H 2xtj_E | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A | Back alignment and structure |
|---|
| >2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qhz_H Human monoclonal antibody DEL2D1, FAB heavy chain; immunoglobulin, immune recognition, influenza A hemagglutini system; 1.55A {Homo sapiens} PDB: 3lzf_H* 3qrg_H* 3mod_H 3mob_H 3moa_H 3lev_H* 3idg_B 3d0l_B 3d0v_B 3idi_B 3idj_B 3idm_B* 3idn_B* 1tjg_H* 1tjh_H* 1tji_H* 2pr4_H 3drq_B 2p8m_B 2p8p_B ... | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A | Back alignment and structure |
|---|
| >2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 | Back alignment and structure |
|---|
| >1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X | Back alignment and structure |
|---|
| >2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A | Back alignment and structure |
|---|
| >3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3tv3_H PGT128 heavy chain, IG gamma-1 chain C region; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_H* 3twc_H* 3tje_H* 3thm_H* 4fqq_H 2xzc_H* 2xza_H* 3b2u_H* 3b2v_H* 3mly_H 3mlz_H 4fq2_H 2ykl_H* 3tnm_H 4fqc_H* 4fq1_H* 2yk1_H* 3mlx_H 2jix_D 2vxq_H ... | Back alignment and structure |
|---|
| >2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3u2s_H PG9 heavy chain; greek KEY, immunoglobulin, immune recognition, immune system; HET: PCA TYS BU3 NAG BMA MAN; 1.80A {Homo sapiens} PDB: 3u4e_H* 3u36_H 3mug_B* 3lrs_H* 3mme_H* 2qsc_H* | Back alignment and structure |
|---|
| >2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A | Back alignment and structure |
|---|
| >3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} | Back alignment and structure |
|---|
| >3n9g_H FAB fragment of MAB CR4354, heavy chain; human neutralizing antibody, immun anti-WEST NIle virus; 1.43A {Homo sapiens} PDB: 3iyw_H 3qeh_A 3sqo_H 4hk0_A 4hk3_J 4hkx_A* 3u0t_D 3c08_H 3lmj_H 3lqa_H* 3c09_H* 4dn3_H 3pp4_H 3pp3_H 4hkb_J 2jb5_H* 2jb6_B* 2eh7_H 2eh8_H 3jwd_H* ... | Back alignment and structure |
|---|
| >2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X | Back alignment and structure |
|---|
| >4hwu_A Fibroblast growth factor receptor 2; FGFR2, KGFR, CD332, IG-C2 type 1 domain, IG superfamily, IMM system, structural genomics, PSI-biology; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A | Back alignment and structure |
|---|
| >2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wbj_D OB TCR; transmembrane, immune response, T cell receptor, MHC II, MEM receptor, molecular mimicry, multiple sclerosis, immune SYS autoimmunity; HET: NAG BMA MAN; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1bec_A 14.3.D T cell antigen receptor; T cell receptor; 1.70A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1jck_A 1l0x_A 1sbb_A 1l0y_A 3c6l_B 1mwa_B* 1g6r_B* 1tcr_B* 2ckb_B 2q86_B* 1lp9_F 2j8u_F 2jcc_F 2uwe_F 3mbe_D* 1d9k_B* 2aq3_A 3mc0_A 3byt_A 3bzd_A ... | Back alignment and structure |
|---|
| >3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3f8u_B Tapasin; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A | Back alignment and structure |
|---|
| >1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1oga_E TRBC1, T-cell receptor beta chain C region; immune system/receptor, immune system/receptor/complex, TCR, MHC, immunodominance, FLU, complex; 1.40A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 2vlm_E 2vlk_E 2vlj_E 2vlr_E 2xna_B 2xn9_B 2axh_A 2axj_A 3scm_D* 3sda_D* 3sdc_D* 3sdd_D* 3qi9_D* 3mff_B* 2ak4_E 3he7_D* 2eyr_B 3pqy_E 3kxf_E 2cde_B ... | Back alignment and structure |
|---|
| >2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X | Back alignment and structure |
|---|
| >2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3mlr_H Human monoclonal anti-HIV-1 GP120 V3 antibody 255 heavy chain; human monoclonal antibody, FAB, third variable antibody-antigen interaction; 1.80A {Homo sapiens} PDB: 3mls_H 3mlt_H 3mlu_H 3mlv_H | Back alignment and structure |
|---|
| >2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >3n9g_H FAB fragment of MAB CR4354, heavy chain; human neutralizing antibody, immun anti-WEST NIle virus; 1.43A {Homo sapiens} PDB: 3iyw_H 3qeh_A 3sqo_H 4hk0_A 4hk3_J 4hkx_A* 3u0t_D 3c08_H 3lmj_H 3lqa_H* 3c09_H* 4dn3_H 3pp4_H 3pp3_H 4hkb_J 2jb5_H* 2jb6_B* 2eh7_H 2eh8_H 3jwd_H* ... | Back alignment and structure |
|---|
| >3to4_D NKT vbeta2 (mouse variable domain, human constant; mouse CD1D, mouse NKT, immune system; HET: AGH NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3r08_E T-cell surface glycoprotein CD3 epsilon chain; antibody, T-cell receptor, signalling, immune SY; 4.10A {Cricetulus migratorius} | Back alignment and structure |
|---|
| >3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A | Back alignment and structure |
|---|
| >2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sob_H Antibody heavy chain, low-density lipoprotein receptor-related protein; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_B 3uls_H 3ulu_D* 3ulv_D* | Back alignment and structure |
|---|
| >1hxm_A Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} | Back alignment and structure |
|---|
| >2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ypz_F T-cell receptor gamma chain, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 292 | ||||
| d1koaa1 | 97 | b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha | 2e-14 | |
| d2cqva1 | 101 | b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T | 3e-14 | |
| d2cqva1 | 101 | b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T | 2e-04 | |
| d2cqva1 | 101 | b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T | 0.001 | |
| d1biha4 | 89 | b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr | 1e-13 | |
| d1biha4 | 89 | b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr | 1e-04 | |
| d1biha4 | 89 | b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr | 3e-04 | |
| d1qz1a3 | 100 | b.1.1.4 (A:190-289) Neural cell adhesion molecule | 1e-13 | |
| d1qz1a3 | 100 | b.1.1.4 (A:190-289) Neural cell adhesion molecule | 6e-05 | |
| d1g1ca_ | 98 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 5e-13 | |
| d1g1ca_ | 98 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 4e-04 | |
| d1fhga_ | 102 | b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) | 7e-13 | |
| d1fhga_ | 102 | b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) | 0.003 | |
| d1cs6a3 | 91 | b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall | 2e-12 | |
| d1cs6a3 | 91 | b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall | 2e-05 | |
| d1cs6a3 | 91 | b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall | 0.002 | |
| d1cs6a4 | 89 | b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall | 3e-12 | |
| d1tnna_ | 91 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 7e-12 | |
| d1tnna_ | 91 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 0.004 | |
| d2fdbp2 | 109 | b.1.1.4 (P:2252-2360) Fibroblast growth factor rec | 2e-11 | |
| d2fdbp2 | 109 | b.1.1.4 (P:2252-2360) Fibroblast growth factor rec | 3e-07 | |
| d3dara1 | 97 | b.1.1.4 (A:153-249) Fibroblast growth factor recep | 2e-11 | |
| d3dara1 | 97 | b.1.1.4 (A:153-249) Fibroblast growth factor recep | 2e-05 | |
| d3dara1 | 97 | b.1.1.4 (A:153-249) Fibroblast growth factor recep | 5e-04 | |
| d2crya1 | 115 | b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRR | 4e-11 | |
| d1epfa2 | 92 | b.1.1.4 (A:98-189) Neural cell adhesion molecule ( | 2e-10 | |
| d1epfa2 | 92 | b.1.1.4 (A:98-189) Neural cell adhesion molecule ( | 0.001 | |
| d1epfa2 | 92 | b.1.1.4 (A:98-189) Neural cell adhesion molecule ( | 0.002 | |
| d1biha1 | 94 | b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi | 6e-10 | |
| d2dava1 | 113 | b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t | 7e-10 | |
| d1rhfa1 | 91 | b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor | 8e-10 | |
| d1rhfa1 | 91 | b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor | 1e-05 | |
| d1rhfa1 | 91 | b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor | 0.003 | |
| d1nbqa2 | 104 | b.1.1.4 (A:130-233) Junction adhesion molecule, JA | 8e-10 | |
| d1nbqa2 | 104 | b.1.1.4 (A:130-233) Junction adhesion molecule, JA | 0.002 | |
| d1nbqa2 | 104 | b.1.1.4 (A:130-233) Junction adhesion molecule, JA | 0.004 | |
| d2c9aa1 | 96 | b.1.1.4 (A:184-279) Receptor-type tyrosine-protein | 1e-09 | |
| d2c9aa1 | 96 | b.1.1.4 (A:184-279) Receptor-type tyrosine-protein | 3e-04 | |
| d1cs6a1 | 97 | b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus | 2e-09 | |
| d1cs6a1 | 97 | b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus | 3e-04 | |
| d2avga1 | 110 | b.1.1.4 (A:1-110) Cardiac myosin binding protein C | 6e-09 | |
| d1wwca_ | 105 | b.1.1.4 (A:) NT3 binding domain of trkC receptor { | 8e-09 | |
| d1wwbx_ | 103 | b.1.1.4 (X:) Ligand binding domain of trkB recepto | 1e-08 | |
| d1f97a2 | 110 | b.1.1.4 (A:129-238) Junction adhesion molecule, JA | 2e-08 | |
| d1f97a2 | 110 | b.1.1.4 (A:129-238) Junction adhesion molecule, JA | 6e-04 | |
| d1gl4b_ | 89 | b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu | 3e-08 | |
| d1gl4b_ | 89 | b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu | 0.002 | |
| d1gl4b_ | 89 | b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu | 0.003 | |
| d3b5ha1 | 101 | b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo | 3e-08 | |
| d1iray2 | 103 | b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor | 9e-08 | |
| d1iray2 | 103 | b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor | 8e-04 | |
| d1he7a_ | 107 | b.1.1.4 (A:) High affinity nerve growth factor rec | 2e-07 | |
| d1he7a_ | 107 | b.1.1.4 (A:) High affinity nerve growth factor rec | 0.003 | |
| d1biha3 | 97 | b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr | 2e-07 | |
| d1biha3 | 97 | b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr | 0.003 | |
| d2aw2a1 | 104 | b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator | 3e-07 | |
| d1zxqa1 | 106 | b.1.1.3 (A:87-192) Intercellular cell adhesion mol | 5e-07 | |
| d1zxqa1 | 106 | b.1.1.3 (A:87-192) Intercellular cell adhesion mol | 1e-04 | |
| d1wiua_ | 93 | b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el | 5e-07 | |
| d1n26a1 | 93 | b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chai | 9e-07 | |
| d1gxea_ | 130 | b.1.1.4 (A:) Cardiac myosin binding protein C, dif | 1e-06 | |
| d1gxea_ | 130 | b.1.1.4 (A:) Cardiac myosin binding protein C, dif | 0.002 | |
| d1x44a1 | 90 | b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty | 1e-06 | |
| d1pd6a_ | 94 | b.1.1.4 (A:) Cardiac myosin binding protein C, dif | 3e-06 | |
| d1iama1 | 103 | b.1.1.3 (A:83-185) Intercellular cell adhesion mol | 3e-06 | |
| d1iama1 | 103 | b.1.1.3 (A:83-185) Intercellular cell adhesion mol | 0.002 | |
| d1ccza1 | 93 | b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-ter | 9e-06 | |
| d1f97a1 | 102 | b.1.1.1 (A:27-128) Junction adhesion molecule, JAM | 1e-05 | |
| d1pkoa_ | 126 | b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein ( | 1e-05 | |
| d1pkoa_ | 126 | b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein ( | 0.002 | |
| d2oz4a3 | 84 | b.1.1.4 (A:367-450) Intercellular adhesion molecul | 2e-05 | |
| d2oz4a3 | 84 | b.1.1.4 (A:367-450) Intercellular adhesion molecul | 1e-04 | |
| d1hnga1 | 98 | b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus no | 3e-05 | |
| d1iray3 | 107 | b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor | 4e-05 | |
| d1tiua_ | 89 | b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig re | 4e-05 | |
| d1iray1 | 101 | b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {H | 1e-04 | |
| d1iray1 | 101 | b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {H | 3e-04 | |
| d1nbqa1 | 105 | b.1.1.1 (A:25-129) Junction adhesion molecule, JAM | 2e-04 | |
| d2ifga1 | 92 | b.1.1.4 (A:192-283) High affinity nerve growth fac | 2e-04 | |
| d2ifga1 | 92 | b.1.1.4 (A:192-283) High affinity nerve growth fac | 0.002 | |
| d1f2qa1 | 82 | b.1.1.4 (A:4-85) IgE high affinity receptor alpha | 3e-04 | |
| d1dr9a1 | 105 | b.1.1.1 (A:1-105) CD80, N-terminal domain {Human ( | 9e-04 | |
| d1rhfa2 | 85 | b.1.1.4 (A:98-182) Tyrosine-protein kinase recepto | 0.001 | |
| d1rhfa2 | 85 | b.1.1.4 (A:98-182) Tyrosine-protein kinase recepto | 0.004 | |
| d1l6za1 | 107 | b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, C | 0.001 | |
| d2fcba1 | 85 | b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD3 | 0.003 | |
| d1l6za2 | 96 | b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, | 0.003 | |
| d2fcba2 | 88 | b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (C | 0.004 |
| >d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Immunoglobulin family: I set domains domain: Twitchin species: Nematode (Caenorhabditis elegans) [TaxId: 6239]
Score = 65.7 bits (159), Expect = 2e-14
Identities = 26/101 (25%), Positives = 41/101 (40%), Gaps = 5/101 (4%)
Query: 37 PSFVVRPQDQKVGLNGIASFQCVAEGSPLPSVFWTQEGSQVLMFPGNAYGHLHVTQEGTL 96
P F+V+P +VG A+F C S P V W ++ + + Y + + L
Sbjct: 2 PRFIVKPYGTEVGEGQSANFYCRVIASSPPVVTWHKDDRE--LKQSVKYMKRYNGNDYGL 59
Query: 97 RIQGVQKEDAGFFVCSALSVAGSTTVRAFLQVTSVEDTPPP 137
I V+ +D G + A + G+ FL VT P
Sbjct: 60 TINRVKGDDKGEYTVRAKNSYGTKEEIVFLNVT---RHSEP 97
|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 | Back information, alignment and structure |
|---|
| >d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 | Back information, alignment and structure |
|---|
| >d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 | Back information, alignment and structure |
|---|
| >d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 | Back information, alignment and structure |
|---|
| >d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 | Back information, alignment and structure |
|---|
| >d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 | Back information, alignment and structure |
|---|
| >d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 | Back information, alignment and structure |
|---|
| >d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 | Back information, alignment and structure |
|---|
| >d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 | Back information, alignment and structure |
|---|
| >d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 | Back information, alignment and structure |
|---|
| >d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 | Back information, alignment and structure |
|---|
| >d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 | Back information, alignment and structure |
|---|
| >d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 | Back information, alignment and structure |
|---|
| >d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 | Back information, alignment and structure |
|---|
| >d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 | Back information, alignment and structure |
|---|
| >d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 | Back information, alignment and structure |
|---|
| >d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 98 | Back information, alignment and structure |
|---|
| >d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 | Back information, alignment and structure |
|---|
| >d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 | Back information, alignment and structure |
|---|
| >d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 292 | |||
| d1cs6a4 | 89 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 99.71 | |
| d1cs6a4 | 89 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 99.69 | |
| d1koaa1 | 97 | Twitchin {Nematode (Caenorhabditis elegans) [TaxId | 99.68 | |
| d1qz1a3 | 100 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 99.67 | |
| d2cqva1 | 101 | Telokin {Human (Homo sapiens) [TaxId: 9606]} | 99.67 | |
| d1rhfa1 | 91 | Tyrosine-protein kinase receptor tyro3, N-terminal | 99.67 | |
| d1g1ca_ | 98 | Titin {Human (Homo sapiens), different modules [Ta | 99.67 | |
| d1biha4 | 89 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 99.66 | |
| d1tnna_ | 91 | Titin {Human (Homo sapiens), different modules [Ta | 99.66 | |
| d1wiua_ | 93 | Twitchin {Nematode (Caenorhabditis elegans) [TaxId | 99.66 | |
| d1biha4 | 89 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 99.66 | |
| d1koaa1 | 97 | Twitchin {Nematode (Caenorhabditis elegans) [TaxId | 99.66 | |
| d1fhga_ | 102 | Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 | 99.66 | |
| d1fhga_ | 102 | Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 | 99.65 | |
| d1cs6a3 | 91 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 99.65 | |
| d1g1ca_ | 98 | Titin {Human (Homo sapiens), different modules [Ta | 99.64 | |
| d1wiua_ | 93 | Twitchin {Nematode (Caenorhabditis elegans) [TaxId | 99.64 | |
| d2cqva1 | 101 | Telokin {Human (Homo sapiens) [TaxId: 9606]} | 99.64 | |
| d1nbqa2 | 104 | Junction adhesion molecule, JAM, C-terminal domain | 99.64 | |
| d1biha3 | 97 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 99.63 | |
| d1biha3 | 97 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 99.62 | |
| d1epfa2 | 92 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 99.61 | |
| d1tnna_ | 91 | Titin {Human (Homo sapiens), different modules [Ta | 99.61 | |
| d3dara1 | 97 | Fibroblast growth factor receptor, FGFR {Human (Ho | 99.61 | |
| d1epfa2 | 92 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 99.61 | |
| d1cs6a2 | 105 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 99.6 | |
| d1biha1 | 94 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 99.6 | |
| d3dara1 | 97 | Fibroblast growth factor receptor, FGFR {Human (Ho | 99.6 | |
| d1f97a2 | 110 | Junction adhesion molecule, JAM, C-terminal domain | 99.59 | |
| d1gl4b_ | 89 | Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: | 99.59 | |
| d2nxyb2 | 84 | CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 | 99.59 | |
| d1rhfa2 | 85 | Tyrosine-protein kinase receptor tyro3, second dom | 99.59 | |
| d1qz1a3 | 100 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 99.58 | |
| d1rhfa1 | 91 | Tyrosine-protein kinase receptor tyro3, N-terminal | 99.58 | |
| d1he7a_ | 107 | High affinity nerve growth factor receptor TrkA, d | 99.57 | |
| d2nxyb2 | 84 | CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 | 99.57 | |
| d1vcaa2 | 90 | Vascular cell adhesion molecule-1 (VCAM-1) {Human | 99.57 | |
| d1olza1 | 92 | Semaphorin 4d Ig-like domain {Human (Homo sapiens) | 99.56 | |
| d1rhfa2 | 85 | Tyrosine-protein kinase receptor tyro3, second dom | 99.56 | |
| d1epfa1 | 97 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 99.56 | |
| d2avga1 | 110 | Cardiac myosin binding protein C, different domain | 99.56 | |
| d1epfa1 | 97 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 99.56 | |
| d1gl4b_ | 89 | Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: | 99.56 | |
| d1gsma1 | 90 | Mucosal addressin cell adhesion molecule-1 (MADCAM | 99.56 | |
| d2ifga1 | 92 | High affinity nerve growth factor receptor TrkA, d | 99.56 | |
| d1vcaa2 | 90 | Vascular cell adhesion molecule-1 (VCAM-1) {Human | 99.55 | |
| d2dava1 | 113 | Myosin-binding protein C, slow-type {Human (Homo s | 99.55 | |
| d1cs6a1 | 97 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 99.55 | |
| d3b5ha1 | 101 | Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 | 99.55 | |
| d1cs6a3 | 91 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 99.55 | |
| d2fdbp2 | 109 | Fibroblast growth factor receptor, FGFR {Human (Ho | 99.54 | |
| d1x44a1 | 90 | Myosin-binding protein C, slow-type {Human (Homo s | 99.54 | |
| d2oz4a3 | 84 | Intercellular adhesion molecule-1, ICAM-1 {Human ( | 99.54 | |
| d2fcba2 | 88 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 99.53 | |
| d1f97a1 | 102 | Junction adhesion molecule, JAM, N-terminal domain | 99.53 | |
| d1fnla2 | 89 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 99.52 | |
| d2aw2a1 | 104 | B- and T-lymphocyte attenuator CD272 {Human (Homo | 99.52 | |
| d2fdbp2 | 109 | Fibroblast growth factor receptor, FGFR {Human (Ho | 99.51 | |
| d1gsma1 | 90 | Mucosal addressin cell adhesion molecule-1 (MADCAM | 99.51 | |
| d1wwbx_ | 103 | Ligand binding domain of trkB receptor {Human (Hom | 99.51 | |
| d1biha1 | 94 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 99.51 | |
| d2ifga1 | 92 | High affinity nerve growth factor receptor TrkA, d | 99.51 | |
| d2aw2a1 | 104 | B- and T-lymphocyte attenuator CD272 {Human (Homo | 99.51 | |
| d1fnla2 | 89 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 99.51 | |
| d1l6za2 | 96 | Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t | 99.5 | |
| d1nbqa1 | 105 | Junction adhesion molecule, JAM, N-terminal domain | 99.5 | |
| d1wwca_ | 105 | NT3 binding domain of trkC receptor {Human (Homo s | 99.5 | |
| d1f97a2 | 110 | Junction adhesion molecule, JAM, C-terminal domain | 99.49 | |
| d1cs6a1 | 97 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 99.49 | |
| d1n26a1 | 93 | Interleukin-6 receptor alpha chain, N-terminal dom | 99.49 | |
| d2fcba2 | 88 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 99.49 | |
| d1pd6a_ | 94 | Cardiac myosin binding protein C, different domain | 99.48 | |
| d1iray3 | 107 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 99.48 | |
| d1gxea_ | 130 | Cardiac myosin binding protein C, different domain | 99.48 | |
| d2oz4a3 | 84 | Intercellular adhesion molecule-1, ICAM-1 {Human ( | 99.48 | |
| d1tiua_ | 89 | Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI | 99.47 | |
| d1gxea_ | 130 | Cardiac myosin binding protein C, different domain | 99.47 | |
| d2avga1 | 110 | Cardiac myosin binding protein C, different domain | 99.46 | |
| d1nbqa2 | 104 | Junction adhesion molecule, JAM, C-terminal domain | 99.46 | |
| d1iray2 | 103 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 99.46 | |
| d3b5ha1 | 101 | Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 | 99.46 | |
| d1olza1 | 92 | Semaphorin 4d Ig-like domain {Human (Homo sapiens) | 99.44 | |
| d1nbqa1 | 105 | Junction adhesion molecule, JAM, N-terminal domain | 99.44 | |
| d1f2qa2 | 89 | IgE high affinity receptor alpha subunit {Human (H | 99.44 | |
| d1x44a1 | 90 | Myosin-binding protein C, slow-type {Human (Homo s | 99.44 | |
| d2dava1 | 113 | Myosin-binding protein C, slow-type {Human (Homo s | 99.44 | |
| d1n26a1 | 93 | Interleukin-6 receptor alpha chain, N-terminal dom | 99.44 | |
| d1iray1 | 101 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 99.43 | |
| d2c9aa1 | 96 | Receptor-type tyrosine-protein phosphatase mu {Hum | 99.43 | |
| d1wwca_ | 105 | NT3 binding domain of trkC receptor {Human (Homo s | 99.41 | |
| d1wwbx_ | 103 | Ligand binding domain of trkB receptor {Human (Hom | 99.41 | |
| d2c9aa1 | 96 | Receptor-type tyrosine-protein phosphatase mu {Hum | 99.41 | |
| d1fnla1 | 84 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 99.41 | |
| d1iray3 | 107 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 99.4 | |
| d1cs6a2 | 105 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 99.4 | |
| d1f2qa2 | 89 | IgE high affinity receptor alpha subunit {Human (H | 99.39 | |
| d1l6za2 | 96 | Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t | 99.39 | |
| d1iray1 | 101 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 99.38 | |
| d2crya1 | 115 | Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s | 99.38 | |
| d1f2qa1 | 82 | IgE high affinity receptor alpha subunit {Human (H | 99.37 | |
| d1pd6a_ | 94 | Cardiac myosin binding protein C, different domain | 99.37 | |
| d1iray2 | 103 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 99.37 | |
| d1biha2 | 111 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 99.37 | |
| d2crya1 | 115 | Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s | 99.37 | |
| d1iama1 | 103 | Intercellular cell adhesion molecule-1 (ICAM-1) {H | 99.35 | |
| d1iama1 | 103 | Intercellular cell adhesion molecule-1 (ICAM-1) {H | 99.35 | |
| d2fcba1 | 85 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 99.35 | |
| d1f97a1 | 102 | Junction adhesion molecule, JAM, N-terminal domain | 99.34 | |
| d1he7a_ | 107 | High affinity nerve growth factor receptor TrkA, d | 99.34 | |
| d1zxqa1 | 106 | Intercellular cell adhesion molecule-2 (ICAM-2) {H | 99.33 | |
| d1zxqa1 | 106 | Intercellular cell adhesion molecule-2 (ICAM-2) {H | 99.32 | |
| d2fcba1 | 85 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 99.32 | |
| d1fnla1 | 84 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 99.27 | |
| d1f2qa1 | 82 | IgE high affinity receptor alpha subunit {Human (H | 99.26 | |
| d1tiua_ | 89 | Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI | 99.25 | |
| d1biha2 | 111 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 99.22 | |
| d1ccza1 | 93 | CD2-binding domain of CD58, N-terminal domain {Hum | 99.18 | |
| d1hnga1 | 98 | CD2, first domain {Rat (Rattus norvegicus) [TaxId: | 99.11 | |
| d1ccza1 | 93 | CD2-binding domain of CD58, N-terminal domain {Hum | 99.08 | |
| d1hnga1 | 98 | CD2, first domain {Rat (Rattus norvegicus) [TaxId: | 99.06 | |
| d1l6za1 | 107 | Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t | 98.95 | |
| d1pkoa_ | 126 | Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra | 98.9 | |
| d1neua_ | 119 | Myelin membrane adhesion molecule P0 {Rat (Rattus | 98.78 | |
| d1eaja_ | 124 | Coxsackie virus and adenovirus receptor (Car), dom | 98.76 | |
| d1vcaa1 | 109 | Vascular cell adhesion molecule-1 (VCAM-1) {Human | 98.75 | |
| d1ucta1 | 99 | Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa | 98.75 | |
| d1olla1 | 95 | Ligand binding domain of NK receptor NKp46 {Human | 98.75 | |
| d2nxyb1 | 97 | CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 | 98.72 | |
| d1a0ql1 | 106 | Immunoglobulin light chain kappa variable domain, | 98.69 | |
| d1nezg_ | 122 | CD8 {Mouse (Mus musculus) [TaxId: 10090]} | 98.68 | |
| d1pkoa_ | 126 | Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra | 98.66 | |
| d1i8ka_ | 106 | Immunoglobulin light chain kappa variable domain, | 98.65 | |
| d2nxyb1 | 97 | CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 | 98.64 | |
| d1xeda_ | 116 | Polymeric-immunoglobulin receptor, PIGR {Human (Ho | 98.61 | |
| d1c5cl1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.61 | |
| d2bnqd1 | 113 | T-cell antigen receptor {Human (Homo sapiens), alp | 98.61 | |
| d2cdea1 | 114 | T-cell antigen receptor {Human (Homo sapiens), bet | 98.6 | |
| d1kcvl1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.6 | |
| d1l6za1 | 107 | Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t | 98.59 | |
| d1j1pl_ | 107 | Immunoglobulin light chain kappa variable domain, | 98.57 | |
| d1ospl1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.57 | |
| d1akjd_ | 114 | CD8 {Human (Homo sapiens) [TaxId: 9606]} | 98.56 | |
| d1lp9e1 | 115 | T-cell antigen receptor {Mouse (Mus musculus), alp | 98.55 | |
| d1tvda_ | 116 | T-cell antigen receptor {Human (Homo sapiens), del | 98.54 | |
| d1jhll_ | 108 | Immunoglobulin light chain kappa variable domain, | 98.53 | |
| d1vesa_ | 113 | Novel antigen receptor 12Y-2 {Spotted wobbegong (O | 98.52 | |
| d1tjgl1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.52 | |
| d3cx5k1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.52 | |
| d2ij0c1 | 118 | T-cell antigen receptor {Human (Homo sapiens), bet | 98.51 | |
| d1mqkl_ | 109 | Immunoglobulin light chain kappa variable domain, | 98.51 | |
| d1mexl1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.5 | |
| d1lk3l1 | 106 | Immunoglobulin light chain kappa variable domain, | 98.5 | |
| d1op3k1 | 106 | Immunoglobulin light chain kappa variable domain, | 98.5 | |
| d1dr9a2 | 95 | CD80, second domain {Human (Homo sapiens) [TaxId: | 98.5 | |
| d1ucta1 | 99 | Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa | 98.47 | |
| d1vcaa1 | 109 | Vascular cell adhesion molecule-1 (VCAM-1) {Human | 98.47 | |
| d1i9ea_ | 115 | T-cell antigen receptor {Mouse (Mus musculus), alp | 98.47 | |
| d1u3ha1 | 110 | T-cell antigen receptor {Mouse (Mus musculus), alp | 98.47 | |
| d3bp5a1 | 114 | Programmed cell death protein 1, PD1, extracellula | 98.46 | |
| d1olla1 | 95 | Ligand binding domain of NK receptor NKp46 {Human | 98.46 | |
| d1d5il1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.45 | |
| d1j8hd1 | 115 | T-cell antigen receptor {Human (Homo sapiens), alp | 98.45 | |
| d1bwwa_ | 109 | Immunoglobulin light chain kappa variable domain, | 98.44 | |
| d1sq2n_ | 112 | Novel antigen receptor (against lysozyme) {Nurse s | 98.44 | |
| d2atpb1 | 115 | CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 | 98.44 | |
| d1ospl1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.44 | |
| d3bp5a1 | 114 | Programmed cell death protein 1, PD1, extracellula | 98.43 | |
| d2aq2a1 | 110 | T-cell antigen receptor {Mouse (Mus musculus), bet | 98.43 | |
| d2cdea1 | 114 | T-cell antigen receptor {Human (Homo sapiens), bet | 98.43 | |
| d1dr9a1 | 105 | CD80, N-terminal domain {Human (Homo sapiens) [Tax | 98.42 | |
| d2esvd1 | 110 | T-cell antigen receptor {Human (Homo sapiens), alp | 98.42 | |
| d1k5nb_ | 100 | beta2-microglobulin {Human (Homo sapiens) [TaxId: | 98.42 | |
| d1akjd_ | 114 | CD8 {Human (Homo sapiens) [TaxId: 9606]} | 98.41 | |
| d1hkfa_ | 108 | NK cell activating receptor NKP44 {Human (Homo sap | 98.41 | |
| d1k5nb_ | 100 | beta2-microglobulin {Human (Homo sapiens) [TaxId: | 98.4 | |
| d2ak4d1 | 114 | T-cell antigen receptor {Human (Homo sapiens), alp | 98.4 | |
| d1bd2d1 | 111 | T-cell antigen receptor {Human (Homo sapiens), alp | 98.39 | |
| d1tvda_ | 116 | T-cell antigen receptor {Human (Homo sapiens), del | 98.39 | |
| d8faba1 | 103 | Immunoglobulin light chain lambda variable domain, | 98.39 | |
| d1yqvl1 | 104 | Immunoglobulin light chain kappa variable domain, | 98.38 | |
| d2bnqd1 | 113 | T-cell antigen receptor {Human (Homo sapiens), alp | 98.38 | |
| d1c5cl1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.37 | |
| d1ucta2 | 96 | Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa | 98.37 | |
| d2ak4d1 | 114 | T-cell antigen receptor {Human (Homo sapiens), alp | 98.37 | |
| d1muja1 | 100 | Class II MHC alpha chain, C-terminal domain {Mouse | 98.37 | |
| d1eaja_ | 124 | Coxsackie virus and adenovirus receptor (Car), dom | 98.37 | |
| d1i8ka_ | 106 | Immunoglobulin light chain kappa variable domain, | 98.36 | |
| d1neua_ | 119 | Myelin membrane adhesion molecule P0 {Rat (Rattus | 98.35 | |
| d2fx7l1 | 108 | Immunoglobulin light chain kappa variable domain, | 98.35 | |
| d1h5ba_ | 113 | T-cell antigen receptor {Mouse (Mus musculus), alp | 98.34 | |
| d1ogad1 | 115 | T-cell antigen receptor {Human (Homo sapiens), alp | 98.34 | |
| d1a0ql1 | 106 | Immunoglobulin light chain kappa variable domain, | 98.34 | |
| d1lk2b_ | 99 | beta2-microglobulin {Mouse (Mus musculus) [TaxId: | 98.33 | |
| d1dr9a1 | 105 | CD80, N-terminal domain {Human (Homo sapiens) [Tax | 98.32 | |
| d1sq2n_ | 112 | Novel antigen receptor (against lysozyme) {Nurse s | 98.32 | |
| d1nezg_ | 122 | CD8 {Mouse (Mus musculus) [TaxId: 10090]} | 98.32 | |
| d1vesa_ | 113 | Novel antigen receptor 12Y-2 {Spotted wobbegong (O | 98.31 | |
| d1lk2b_ | 99 | beta2-microglobulin {Mouse (Mus musculus) [TaxId: | 98.31 | |
| d1tjgl1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.31 | |
| d1mjul2 | 107 | Immunoglobulin light chain kappa constant domain, | 98.3 | |
| d1f3rb2 | 119 | Immunoglobulin light chain kappa variable domain, | 98.3 | |
| d2atpb1 | 115 | CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 | 98.29 | |
| d2gsia1 | 111 | Immunoglobulin light chain kappa variable domain, | 98.28 | |
| d1fp5a2 | 105 | Immunoglobulin heavy chain epsilon constant domain | 98.28 | |
| d1fo0a_ | 115 | T-cell antigen receptor {Mouse (Mus musculus), alp | 98.28 | |
| d2esvd1 | 110 | T-cell antigen receptor {Human (Homo sapiens), alp | 98.28 | |
| d1w72l1 | 109 | Immunoglobulin light chain lambda variable domain, | 98.28 | |
| d1ugna2 | 98 | Ligand binding domain of lir-1 (ilt2) {Human (Homo | 98.27 | |
| d1hxmb1 | 123 | T-cell antigen receptor {Human (Homo sapiens), del | 98.26 | |
| d1j1pl_ | 107 | Immunoglobulin light chain kappa variable domain, | 98.26 | |
| d1ogae1 | 114 | T-cell antigen receptor {Human (Homo sapiens), bet | 98.26 | |
| d1kcvl1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.26 | |
| d1jhll_ | 108 | Immunoglobulin light chain kappa variable domain, | 98.26 | |
| d1mjul1 | 112 | Immunoglobulin light chain kappa variable domain, | 98.26 | |
| d1de4a1 | 94 | Hemochromatosis protein Hfe, alpha-3 domain {Human | 98.26 | |
| d1q9ra1 | 113 | Immunoglobulin light chain kappa variable domain, | 98.25 | |
| d1i9ea_ | 115 | T-cell antigen receptor {Mouse (Mus musculus), alp | 98.25 | |
| d1de4a1 | 94 | Hemochromatosis protein Hfe, alpha-3 domain {Human | 98.25 | |
| d1nfde1 | 108 | Immunoglobulin light chain lambda variable domain, | 98.25 | |
| d1olla2 | 93 | Ligand binding domain of NK receptor NKp46 {Human | 98.25 | |
| d1lk3l1 | 106 | Immunoglobulin light chain kappa variable domain, | 98.24 | |
| d2gj6d1 | 94 | T-cell antigen receptor {Mouse (Mus musculus), bet | 98.24 | |
| d1op3k1 | 106 | Immunoglobulin light chain kappa variable domain, | 98.23 | |
| d1ncna_ | 110 | CD86 (b7-2), N-terminal domain {Human (Homo sapien | 98.23 | |
| d1muja1 | 100 | Class II MHC alpha chain, C-terminal domain {Mouse | 98.23 | |
| d2g5ra1 | 121 | N-terminal domain of sialic acid binding Ig-like l | 98.23 | |
| d1lp9e1 | 115 | T-cell antigen receptor {Mouse (Mus musculus), alp | 98.23 | |
| d8faba1 | 103 | Immunoglobulin light chain lambda variable domain, | 98.23 | |
| d1q0xl2 | 102 | Immunoglobulin light chain lambda constant domain, | 98.22 | |
| d1j8hd1 | 115 | T-cell antigen receptor {Human (Homo sapiens), alp | 98.22 | |
| d1ncwl1 | 112 | Immunoglobulin light chain kappa variable domain, | 98.22 | |
| d2esve1 | 111 | T-cell antigen receptor {Human (Homo sapiens), bet | 98.22 | |
| d2fx7l1 | 108 | Immunoglobulin light chain kappa variable domain, | 98.22 | |
| d1o0va1 | 104 | Immunoglobulin heavy chain epsilon constant domain | 98.22 | |
| d1lgva1 | 112 | Immunoglobulin light chain lambda variable domain, | 98.22 | |
| d1ogad1 | 115 | T-cell antigen receptor {Human (Homo sapiens), alp | 98.22 | |
| d1kgcd1 | 112 | T-cell antigen receptor {Human (Homo sapiens), alp | 98.22 | |
| d1ac6a_ | 110 | T-cell antigen receptor {Mouse (Mus musculus), alp | 98.21 | |
| d1j05a_ | 111 | Immunoglobulin light chain kappa variable domain, | 98.21 | |
| d1n4xl_ | 113 | Immunoglobulin light chain kappa variable domain, | 98.2 | |
| d1mqkl_ | 109 | Immunoglobulin light chain kappa variable domain, | 98.2 | |
| d2ij0c1 | 118 | T-cell antigen receptor {Human (Homo sapiens), bet | 98.2 | |
| d1oaql_ | 110 | Immunoglobulin light chain lambda variable domain, | 98.2 | |
| d1t7va1 | 94 | Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Hu | 98.19 | |
| d1rzfl1 | 111 | Immunoglobulin light chain lambda variable domain, | 98.19 | |
| d1fo0a_ | 115 | T-cell antigen receptor {Mouse (Mus musculus), alp | 98.19 | |
| d1mexl1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.18 | |
| d1kgce1 | 112 | T-cell antigen receptor {Human (Homo sapiens), bet | 98.18 | |
| d3cx5k1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.17 | |
| d1kgcd1 | 112 | T-cell antigen receptor {Human (Homo sapiens), alp | 98.17 | |
| d1j8he1 | 113 | T-cell antigen receptor {Human (Homo sapiens), bet | 98.16 | |
| d1t7va1 | 94 | Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Hu | 98.16 | |
| d1u3ha1 | 110 | T-cell antigen receptor {Mouse (Mus musculus), alp | 98.16 | |
| d2h26a1 | 96 | CD1, alpha-3 domain {Human (Homo sapiens), CD1a [T | 98.16 | |
| d1fp5a2 | 105 | Immunoglobulin heavy chain epsilon constant domain | 98.16 | |
| d1d5il1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.16 | |
| d1dqta_ | 117 | Immunoreceptor CTLA-4 (CD152), N-terminal fragment | 98.15 | |
| d1xeda_ | 116 | Polymeric-immunoglobulin receptor, PIGR {Human (Ho | 98.15 | |
| d2rhea_ | 114 | Immunoglobulin light chain lambda variable domain, | 98.15 | |
| d1hdma1 | 103 | Class II MHC alpha chain, C-terminal domain {Human | 98.15 | |
| d2ntsp1 | 113 | T-cell antigen receptor {Human (Homo sapiens), bet | 98.14 | |
| d1bwwa_ | 109 | Immunoglobulin light chain kappa variable domain, | 98.14 | |
| d1hdmb1 | 98 | Class II MHC beta chain, C-terminal domain {Human | 98.13 | |
| d1hdmb1 | 98 | Class II MHC beta chain, C-terminal domain {Human | 98.13 | |
| d1xaua_ | 104 | B and T lymphocyte attenuator, Btla {Mouse (Mus mu | 98.13 | |
| d1dr9a2 | 95 | CD80, second domain {Human (Homo sapiens) [TaxId: | 98.13 | |
| d1j05a_ | 111 | Immunoglobulin light chain kappa variable domain, | 98.13 | |
| d1nfdb1 | 113 | T-cell antigen receptor {Mouse (Mus musculus), bet | 98.12 | |
| d1fnga1 | 101 | Class II MHC alpha chain, C-terminal domain {Mouse | 98.12 | |
| d1rzfl2 | 102 | Immunoglobulin light chain lambda constant domain, | 98.12 | |
| d1i8lc_ | 118 | Immunoreceptor CTLA-4 (CD152), N-terminal fragment | 98.11 | |
| d1bd2d1 | 111 | T-cell antigen receptor {Human (Homo sapiens), alp | 98.11 | |
| d1nfde2 | 104 | Immunoglobulin light chain lambda constant domain, | 98.11 | |
| d1c5cl2 | 107 | Immunoglobulin light chain kappa constant domain, | 98.11 | |
| d1fnga1 | 101 | Class II MHC alpha chain, C-terminal domain {Mouse | 98.11 | |
| d1hxma1 | 120 | T-cell antigen receptor {Human (Homo sapiens), gam | 98.1 | |
| d1nkra1 | 96 | Killer cell inhibitory receptor {Human (Homo sapie | 98.1 | |
| d2bnub1 | 112 | T-cell antigen receptor {Human (Homo sapiens), bet | 98.09 | |
| d1w72l1 | 109 | Immunoglobulin light chain lambda variable domain, | 98.09 | |
| d1smoa_ | 113 | TREM-1 (triggering receptor expressed on myeloid c | 98.09 | |
| d1rzfl1 | 111 | Immunoglobulin light chain lambda variable domain, | 98.09 | |
| d1qfoa_ | 118 | N-terminal domain of sialoadhesin {Mouse (Mus musc | 98.09 | |
| d1uvqa1 | 99 | Class II MHC alpha chain, C-terminal domain {Human | 98.08 | |
| d1nkra2 | 99 | Killer cell inhibitory receptor {Human (Homo sapie | 98.07 | |
| d1cd0a_ | 111 | Immunoglobulin light chain lambda variable domain, | 98.07 | |
| d1ypzf1 | 120 | T-cell antigen receptor {Human (Homo sapiens), gam | 98.07 | |
| d1d5mb1 | 98 | Class II MHC beta chain, C-terminal domain {Human | 98.07 | |
| d1ymmd1 | 96 | T-cell antigen receptor {Human (Homo sapiens), alp | 98.07 | |
| d1h5ba_ | 113 | T-cell antigen receptor {Mouse (Mus musculus), alp | 98.06 | |
| d1d5mb1 | 98 | Class II MHC beta chain, C-terminal domain {Human | 98.06 | |
| d1f3rb2 | 119 | Immunoglobulin light chain kappa variable domain, | 98.06 | |
| d1lgva1 | 112 | Immunoglobulin light chain lambda variable domain, | 98.05 | |
| d2esve1 | 111 | T-cell antigen receptor {Human (Homo sapiens), bet | 98.05 | |
| d1u9ka_ | 110 | TREM-1 (triggering receptor expressed on myeloid c | 98.05 | |
| d1dn0b2 | 105 | Immunoglobulin heavy chain mu constant domain 1, C | 98.05 | |
| d1ucta2 | 96 | Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa | 98.05 | |
| d1fo0b_ | 112 | T-cell antigen receptor {Mouse (Mus musculus), bet | 98.04 | |
| d2ntsp1 | 113 | T-cell antigen receptor {Human (Homo sapiens), bet | 98.04 | |
| d1hkfa_ | 108 | NK cell activating receptor NKP44 {Human (Homo sap | 98.03 | |
| d2cdeb1 | 112 | T-cell antigen receptor {Human (Homo sapiens), bet | 98.03 | |
| d1ugna1 | 96 | Ligand binding domain of lir-1 (ilt2) {Human (Homo | 98.03 | |
| d1kgce1 | 112 | T-cell antigen receptor {Human (Homo sapiens), bet | 98.01 | |
| d2rhea_ | 114 | Immunoglobulin light chain lambda variable domain, | 98.01 | |
| d1oaql_ | 110 | Immunoglobulin light chain lambda variable domain, | 98.0 | |
| d1ogae1 | 114 | T-cell antigen receptor {Human (Homo sapiens), bet | 98.0 | |
| d2g5ra1 | 121 | N-terminal domain of sialic acid binding Ig-like l | 98.0 | |
| d2gj6d1 | 94 | T-cell antigen receptor {Mouse (Mus musculus), bet | 97.99 | |
| d1ac6a_ | 110 | T-cell antigen receptor {Mouse (Mus musculus), alp | 97.99 | |
| d1uvqa1 | 99 | Class II MHC alpha chain, C-terminal domain {Human | 97.98 | |
| d2gsia1 | 111 | Immunoglobulin light chain kappa variable domain, | 97.98 | |
| d1cd0a_ | 111 | Immunoglobulin light chain lambda variable domain, | 97.97 | |
| d1uvqb1 | 97 | Class II MHC beta chain, C-terminal domain {Human | 97.96 | |
| d1ymmd1 | 96 | T-cell antigen receptor {Human (Homo sapiens), alp | 97.96 | |
| d2aq2a1 | 110 | T-cell antigen receptor {Mouse (Mus musculus), bet | 97.96 | |
| d1l6xa2 | 102 | Immunoglobulin heavy chain gamma constant domain 3 | 97.95 | |
| d1l6xa2 | 102 | Immunoglobulin heavy chain gamma constant domain 3 | 97.95 | |
| d1mjuh2 | 102 | Immunoglobulin heavy chain gamma constant domain 1 | 97.95 | |
| d3frua1 | 91 | Fc (IgG) receptor, alpha-3 domain {Rat (Rattus nor | 97.95 | |
| d1mjul1 | 112 | Immunoglobulin light chain kappa variable domain, | 97.95 | |
| d1ncna_ | 110 | CD86 (b7-2), N-terminal domain {Human (Homo sapien | 97.94 | |
| d1q9ra1 | 113 | Immunoglobulin light chain kappa variable domain, | 97.94 | |
| d1q0xl2 | 102 | Immunoglobulin light chain lambda constant domain, | 97.94 | |
| d2bnub1 | 112 | T-cell antigen receptor {Human (Homo sapiens), bet | 97.94 | |
| d1ow0a2 | 108 | Immunoglobulin heavy chain alpha constant domain 3 | 97.94 | |
| d1dn0b2 | 105 | Immunoglobulin heavy chain mu constant domain 1, C | 97.94 | |
| d1a2yb_ | 116 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.94 | |
| d1olla2 | 93 | Ligand binding domain of NK receptor NKp46 {Human | 97.93 | |
| d1c5db1 | 117 | Immunoglobulin heavy chain variable domain, VH {Ra | 97.93 | |
| d2cdeb1 | 112 | T-cell antigen receptor {Human (Homo sapiens), bet | 97.92 | |
| d3frua1 | 91 | Fc (IgG) receptor, alpha-3 domain {Rat (Rattus nor | 97.92 | |
| d1nfde1 | 108 | Immunoglobulin light chain lambda variable domain, | 97.92 | |
| d1qfoa_ | 118 | N-terminal domain of sialoadhesin {Mouse (Mus musc | 97.92 | |
| d1jpth1 | 117 | Immunoglobulin heavy chain variable domain, VH {En | 97.92 | |
| d1yqvl1 | 104 | Immunoglobulin light chain kappa variable domain, | 97.92 | |
| d1kcvh2 | 101 | Immunoglobulin heavy chain gamma constant domain 1 | 97.92 | |
| d1rzfl2 | 102 | Immunoglobulin light chain lambda constant domain, | 97.92 | |
| d1igtb4 | 102 | Immunoglobulin heavy chain gamma constant domain 3 | 97.91 | |
| d1kxvc_ | 119 | Camelid IG heavy chain variable domain, VHh {Camel | 97.91 | |
| d1cqka_ | 101 | Immunoglobulin heavy chain gamma constant domain 3 | 97.91 | |
| d1n4xl_ | 113 | Immunoglobulin light chain kappa variable domain, | 97.91 | |
| d2mhaa1 | 89 | Class I MHC, alpha-3 domain {Mouse (Mus musculus) | 97.91 | |
| d1nlbh1 | 118 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.9 | |
| d1um5h1 | 117 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.9 | |
| d1indh1 | 114 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.9 | |
| d1dn0b1 | 120 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.89 | |
| d1smoa_ | 113 | TREM-1 (triggering receptor expressed on myeloid c | 97.89 | |
| d1i1ca2 | 102 | Immunoglobulin heavy chain gamma constant domain 3 | 97.89 | |
| d1igtb4 | 102 | Immunoglobulin heavy chain gamma constant domain 3 | 97.89 | |
| d1ncwl1 | 112 | Immunoglobulin light chain kappa variable domain, | 97.89 | |
| d1iqdb1 | 117 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.88 | |
| d1mjul2 | 107 | Immunoglobulin light chain kappa constant domain, | 97.88 | |
| d1i1ca2 | 102 | Immunoglobulin heavy chain gamma constant domain 3 | 97.88 | |
| d1f3dh1 | 115 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.87 | |
| d2agjh1 | 120 | Immunoglobulin heavy chain variable domain, VH {En | 97.87 | |
| d1jnhb1 | 117 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.87 | |
| d1hdma1 | 103 | Class II MHC alpha chain, C-terminal domain {Human | 97.87 | |
| d1ypzf1 | 120 | T-cell antigen receptor {Human (Homo sapiens), gam | 97.87 | |
| d1ct8b1 | 118 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.87 | |
| d1mfah1 | 117 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.86 | |
| d1uvqb1 | 97 | Class II MHC beta chain, C-terminal domain {Human | 97.86 | |
| d3b5ha2 | 80 | Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 | 97.85 | |
| d1cqka_ | 101 | Immunoglobulin heavy chain gamma constant domain 3 | 97.85 | |
| d1hxma1 | 120 | T-cell antigen receptor {Human (Homo sapiens), gam | 97.85 | |
| d1pg7x1 | 120 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.85 | |
| d1nfde2 | 104 | Immunoglobulin light chain lambda constant domain, | 97.85 | |
| d1nfdb1 | 113 | T-cell antigen receptor {Mouse (Mus musculus), bet | 97.84 | |
| d2jelh1 | 118 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.84 | |
| d7fabh1 | 116 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.84 | |
| d1ow0a2 | 108 | Immunoglobulin heavy chain alpha constant domain 3 | 97.84 | |
| d1igtb3 | 119 | Immunoglobulin heavy chain gamma constant domain 2 | 97.84 | |
| d1xaua_ | 104 | B and T lymphocyte attenuator, Btla {Mouse (Mus mu | 97.84 | |
| d1i3ua_ | 127 | Camelid IG heavy chain variable domain, VHh {Llama | 97.84 | |
| d1mjuh1 | 116 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.84 | |
| d1dn0b1 | 120 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.83 | |
| d1vgeh1 | 122 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.83 | |
| d2fbjh1 | 118 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.82 | |
| d1i1ca1 | 103 | Immunoglobulin heavy chain gamma constant domain 2 | 97.81 | |
| d1rz7h1 | 119 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.81 | |
| d2ck0h1 | 109 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.81 | |
| d1hxmb2 | 107 | T-cell antigen receptor {Human (Homo sapiens), del | 97.81 | |
| d1ugna2 | 98 | Ligand binding domain of lir-1 (ilt2) {Human (Homo | 97.81 | |
| d1oari_ | 103 | Immunoglobulin heavy chain variable domain, VH {Ra | 97.8 | |
| d1eapb1 | 119 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.8 | |
| d2nxyd1 | 128 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.8 | |
| d1lo4h1 | 118 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.8 | |
| d2mhaa1 | 89 | Class I MHC, alpha-3 domain {Mouse (Mus musculus) | 97.79 | |
| d1l6xa1 | 105 | Immunoglobulin heavy chain gamma constant domain 2 | 97.79 | |
| d1qnzh_ | 119 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.79 | |
| d1o0va1 | 104 | Immunoglobulin heavy chain epsilon constant domain | 97.79 | |
| d1zvya1 | 124 | Camelid IG heavy chain variable domain, VHh {Camel | 97.79 | |
| d1ieha_ | 135 | Camelid IG heavy chain variable domain, VHh {Llama | 97.78 | |
| d1ogae2 | 127 | T-cell antigen receptor {Human (Homo sapiens), bet | 97.78 | |
| d1oari_ | 103 | Immunoglobulin heavy chain variable domain, VH {Ra | 97.78 | |
| d1sjva_ | 107 | Camelid IG heavy chain variable domain, VHh {Llama | 97.78 | |
| d1j8he1 | 113 | T-cell antigen receptor {Human (Homo sapiens), bet | 97.78 | |
| d1mqkh_ | 123 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.78 | |
| d1nkra1 | 96 | Killer cell inhibitory receptor {Human (Homo sapie | 97.78 | |
| d1rhhb1 | 130 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.77 | |
| d1nkra2 | 99 | Killer cell inhibitory receptor {Human (Homo sapie | 97.77 | |
| d1k5na1 | 95 | Class I MHC, alpha-3 domain {Human (Homo sapiens) | 97.77 | |
| d1lmka1 | 126 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.77 | |
| d1n0xh1 | 127 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.77 | |
| d1ugna1 | 96 | Ligand binding domain of lir-1 (ilt2) {Human (Homo | 97.76 | |
| d1j05b_ | 121 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.76 | |
| d1yjdc1 | 118 | CD28 {Human (Homo sapiens) [TaxId: 9606]} | 97.76 | |
| d2b1hh1 | 124 | Immunoglobulin heavy chain variable domain, VH {En | 97.76 | |
| d2h26a1 | 96 | CD1, alpha-3 domain {Human (Homo sapiens), CD1a [T | 97.76 | |
| d1ad9b1 | 120 | Immunoglobulin heavy chain variable domain, VH {En | 97.76 | |
| d1k5na1 | 95 | Class I MHC, alpha-3 domain {Human (Homo sapiens) | 97.75 | |
| d1c5cl2 | 107 | Immunoglobulin light chain kappa constant domain, | 97.75 | |
| d1dlfh_ | 120 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.75 | |
| d1ncwh1 | 119 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.74 | |
| d1r0ah1 | 123 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.74 | |
| d1xiwa_ | 91 | CD3 epsilon chain ectodomain fragment {Human (Homo | 97.74 | |
| d1hxmb1 | 123 | T-cell antigen receptor {Human (Homo sapiens), del | 97.73 | |
| d1kxvc_ | 119 | Camelid IG heavy chain variable domain, VHh {Camel | 97.73 | |
| d1fp5a1 | 103 | Immunoglobulin heavy chain epsilon constant domain | 97.73 | |
| d1sjva_ | 107 | Camelid IG heavy chain variable domain, VHh {Llama | 97.72 | |
| d1nlbh1 | 118 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.72 | |
| d1rihh1 | 125 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.71 | |
| d1tjgh1 | 132 | Immunoglobulin heavy chain variable domain, VH {En | 97.7 | |
| d1hxma2 | 86 | T-cell antigen receptor {Human (Homo sapiens), gam | 97.7 | |
| d1hyrc1 | 94 | Class I MHC homolog, alpha-3 domain {Human (Homo s | 97.7 | |
| d1op3h1 | 125 | Immunoglobulin heavy chain variable domain, VH {En | 97.69 | |
| d1hyrc1 | 94 | Class I MHC homolog, alpha-3 domain {Human (Homo s | 97.68 | |
| d2fx7h1 | 127 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.68 | |
| d1c5ch2 | 103 | Immunoglobulin heavy chain gamma constant domain 1 | 97.68 | |
| d1i1ca1 | 103 | Immunoglobulin heavy chain gamma constant domain 2 | 97.68 | |
| d1u58a1 | 98 | Immunomodulatory protein m144, alpha-3 domain {Mur | 97.68 | |
| d1i8lc_ | 118 | Immunoreceptor CTLA-4 (CD152), N-terminal fragment | 97.68 | |
| d1bz7b1 | 122 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.67 | |
| d2p49b1 | 121 | Camelid IG heavy chain variable domain, VHh {Camel | 97.67 | |
| d1etzb1 | 126 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.67 | |
| d1q9rb1 | 122 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.67 | |
| d1rjca1 | 126 | Camelid IG heavy chain variable domain, VHh {Camel | 97.66 | |
| d1rzga1 | 130 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.65 | |
| d1ai1h1 | 120 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.65 | |
| d1yedb1 | 124 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.64 | |
| d1hxmb2 | 107 | T-cell antigen receptor {Human (Homo sapiens), del | 97.63 | |
| d1l6xa1 | 105 | Immunoglobulin heavy chain gamma constant domain 2 | 97.63 | |
| d2fb4h1 | 127 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.62 | |
| d1dqta_ | 117 | Immunoreceptor CTLA-4 (CD152), N-terminal fragment | 97.62 | |
| d2agjh1 | 120 | Immunoglobulin heavy chain variable domain, VH {En | 97.62 | |
| d1ol0a_ | 121 | Immunoglobulin heavy chain variable domain, VH {En | 97.62 | |
| d1c5db1 | 117 | Immunoglobulin heavy chain variable domain, VH {Ra | 97.62 | |
| d1fp5a1 | 103 | Immunoglobulin heavy chain epsilon constant domain | 97.62 | |
| d2fbjh1 | 118 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.62 | |
| d1eapb1 | 119 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.61 | |
| d1rjca1 | 126 | Camelid IG heavy chain variable domain, VHh {Camel | 97.61 | |
| d1dfbh1 | 126 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.59 | |
| d3c2ah1 | 131 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.59 | |
| d1iqdb1 | 117 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.58 | |
| d7fabh1 | 116 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.58 | |
| d1nfdf1 | 121 | Immunoglobulin heavy chain variable domain, VH {Ha | 97.57 | |
| d1igtb3 | 119 | Immunoglobulin heavy chain gamma constant domain 2 | 97.57 | |
| d1jpth1 | 117 | Immunoglobulin heavy chain variable domain, VH {En | 97.57 | |
| d1u58a1 | 98 | Immunomodulatory protein m144, alpha-3 domain {Mur | 97.56 | |
| d1rzfh1 | 133 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.55 | |
| d1jbja2 | 100 | CD3 epsilon chain ectodomain fragment {Mouse (Mus | 97.53 | |
| d1fo0b_ | 112 | T-cell antigen receptor {Mouse (Mus musculus), bet | 97.52 | |
| d3cx5j1 | 127 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.52 | |
| d1vgeh1 | 122 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.52 | |
| d1ogae2 | 127 | T-cell antigen receptor {Human (Homo sapiens), bet | 97.52 | |
| d1zvya1 | 124 | Camelid IG heavy chain variable domain, VHh {Camel | 97.52 | |
| d1u9ka_ | 110 | TREM-1 (triggering receptor expressed on myeloid c | 97.52 | |
| d2fbjh2 | 102 | Immunoglobulin heavy chain alpha constant domain 1 | 97.51 | |
| d1um5h1 | 117 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.51 | |
| d2ck0h1 | 109 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.48 | |
| d3b5ha2 | 80 | Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 | 97.48 | |
| d1jnhb1 | 117 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.47 | |
| d1rz7h1 | 119 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.46 | |
| d1a2yb_ | 116 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.46 | |
| d1indh1 | 114 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.46 | |
| d1dfbh1 | 126 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.45 | |
| d1f3dh1 | 115 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.45 | |
| d1qnzh_ | 119 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.45 | |
| d2p49b1 | 121 | Camelid IG heavy chain variable domain, VHh {Camel | 97.43 | |
| d1fltx_ | 95 | Second domain of the Flt-1 receptor {Human (Homo s | 97.43 | |
| d2jelh1 | 118 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.41 | |
| d1bz7b1 | 122 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.4 | |
| d1etzb1 | 126 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.4 | |
| d1b2wh1 | 117 | Immunoglobulin heavy chain variable domain, VH {En | 97.4 | |
| d1pg7x1 | 120 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.4 | |
| d2nxyd1 | 128 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.39 | |
| d1mfah1 | 117 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.39 | |
| d1mqkh_ | 123 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.39 | |
| d1ncwh1 | 119 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.38 | |
| d1ct8b1 | 118 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.38 | |
| d1ol0a_ | 121 | Immunoglobulin heavy chain variable domain, VH {En | 97.38 | |
| d2fbjh2 | 102 | Immunoglobulin heavy chain alpha constant domain 1 | 97.37 | |
| d1mjuh1 | 116 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.36 | |
| d1dlfh_ | 120 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.35 | |
| d1tjgh1 | 132 | Immunoglobulin heavy chain variable domain, VH {En | 97.35 | |
| d1op3h1 | 125 | Immunoglobulin heavy chain variable domain, VH {En | 97.35 | |
| d1r0ah1 | 123 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.34 | |
| d1xiwa_ | 91 | CD3 epsilon chain ectodomain fragment {Human (Homo | 97.34 | |
| d1rhhb1 | 130 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.33 | |
| d1ieha_ | 135 | Camelid IG heavy chain variable domain, VHh {Llama | 97.32 | |
| d1kcvh2 | 101 | Immunoglobulin heavy chain gamma constant domain 1 | 97.31 | |
| d1rzfh1 | 133 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.3 |
| >d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Immunoglobulin family: I set domains domain: Axonin-1 species: Chicken (Gallus gallus) [TaxId: 9031]
Probab=99.71 E-value=1.2e-16 Score=98.15 Aligned_cols=87 Identities=26% Similarity=0.510 Sum_probs=72.9
Q ss_pred CcEEeCCCccEEecCCcEEEEEEEeeeCCCeeEEEECCeEEeeccCCCcceeEEeeecEEEEccCCCCCCeEEEEEEEeC
Q psy15128 37 PSFVVRPQDQKVGLNGIASFQCVAEGSPLPSVFWTQEGSQVLMFPGNAYGHLHVTQEGTLRIQGVQKEDAGFFVCSALSV 116 (292)
Q Consensus 37 p~~~~~~~~~~~~~g~~~~l~C~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~g~Y~C~~~~~ 116 (292)
|.+...+.+..+..|+++.|.|.+.|.|.|.+.|++++..+.. ..+.. ...+.|.|.++..+|.|.|+|.+.|.
T Consensus 2 P~f~~~~~~~~v~~G~~~~l~C~~~g~P~p~v~W~k~g~~i~~-----~~~~~-~~~~~L~i~~v~~~D~G~Y~C~a~N~ 75 (89)
T d1cs6a4 2 PDWLDVITDTEADIGSDLRWSCVASGKPRPAVRWLRDGQPLAS-----QNRIE-VSGGELRFSKLVLEDSGMYQCVAENK 75 (89)
T ss_dssp EEEEECCCCEEEETTCCEEEECEEEEESCCEEEEEETTEECCC-----CSSEE-EETTEEEESSCCGGGCEEEEEEEEET
T ss_pred CCeEEECCCEEECCCCcEEEEEEEEEEcCCEEEEEEeeccccc-----cceee-eeeeeEEEEeecccCCEEEEEEEEeC
Confidence 6677888889999999999999999999999999999987631 12222 23568999999999999999999999
Q ss_pred CcCeeEEEEEEEE
Q psy15128 117 AGSTTVRAFLQVT 129 (292)
Q Consensus 117 ~~~~~~~~~l~v~ 129 (292)
.|.......|.|.
T Consensus 76 ~G~~~~~~~l~V~ 88 (89)
T d1cs6a4 76 HGTVYASAELTVQ 88 (89)
T ss_dssp TEEEEEEEEEEEE
T ss_pred CCEEEEEEEEEEE
Confidence 9987777777764
|
| >d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} | Back information, alignment and structure |
|---|
| >d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} | Back information, alignment and structure |
|---|
| >d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} | Back information, alignment and structure |
|---|
| >d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k5nb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k5nb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lk2b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} | Back information, alignment and structure |
|---|
| >d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} | Back information, alignment and structure |
|---|
| >d1lk2b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1mjul2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1de4a1 b.1.1.2 (A:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1de4a1 b.1.1.2 (A:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q0xl2 b.1.1.2 (L:108-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o0va1 b.1.1.2 (A:228-330) Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t7va1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t7va1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2h26a1 b.1.1.2 (A:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hdma1 b.1.1.2 (A:94-196) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fnga1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rzfl2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nfde2 b.1.1.2 (E:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1c5cl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnga1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uvqa1 b.1.1.2 (A:85-183) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d5mb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d5mb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dn0b2 b.1.1.2 (B:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fo0b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uvqa1 b.1.1.2 (A:85-183) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uvqb1 b.1.1.2 (B:95-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l6xa2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l6xa2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mjuh2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3frua1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q0xl2 b.1.1.2 (L:108-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ow0a2 b.1.1.2 (A:343-450) Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dn0b2 b.1.1.2 (B:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a2yb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3frua1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jpth1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kcvh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rzfl2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1igtb4 b.1.1.2 (B:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kxvc_ b.1.1.1 (C:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} | Back information, alignment and structure |
|---|
| >d1cqka_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2mhaa1 b.1.1.2 (A:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nlbh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1um5h1 b.1.1.1 (H:3-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1indh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i1ca2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1igtb4 b.1.1.2 (B:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mjul2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i1ca2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1f3dh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2agjh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1jnhb1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hdma1 b.1.1.2 (A:94-196) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ct8b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mfah1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uvqb1 b.1.1.2 (B:95-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3b5ha2 b.1.1.4 (A:23-102) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cqka_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pg7x1 b.1.1.1 (X:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nfde2 b.1.1.2 (E:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2jelh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d7fabh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ow0a2 b.1.1.2 (A:343-450) Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1igtb3 b.1.1.2 (B:236-361) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i3ua_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} | Back information, alignment and structure |
|---|
| >d1mjuh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i1ca1 b.1.1.2 (A:239-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rz7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hxmb2 b.1.1.2 (B:124-230) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1eapb1 b.1.1.1 (B:1-124) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2nxyd1 b.1.1.1 (D:3001-3128) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lo4h1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2mhaa1 b.1.1.2 (A:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l6xa1 b.1.1.2 (A:237-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qnzh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1o0va1 b.1.1.2 (A:228-330) Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zvya1 b.1.1.1 (A:2-125) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} | Back information, alignment and structure |
|---|
| >d1ieha_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} | Back information, alignment and structure |
|---|
| >d1ogae2 b.1.1.2 (E:119-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1sjva_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} | Back information, alignment and structure |
|---|
| >d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mqkh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rhhb1 b.1.1.1 (B:3-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k5na1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmka1 b.1.1.1 (A:2-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n0xh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j05b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yjdc1 b.1.1.1 (C:1-118) CD28 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b1hh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d2h26a1 b.1.1.2 (A:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ad9b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1k5na1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c5cl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dlfh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncwh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r0ah1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xiwa_ b.1.1.4 (A:) CD3 epsilon chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kxvc_ b.1.1.1 (C:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} | Back information, alignment and structure |
|---|
| >d1fp5a1 b.1.1.2 (A:336-438) Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sjva_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} | Back information, alignment and structure |
|---|
| >d1nlbh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rihh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tjgh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1hxma2 b.1.1.2 (A:121-206) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hyrc1 b.1.1.2 (C:181-274) Class I MHC homolog, alpha-3 domain {Human (Homo sapiens), Mic-a [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1op3h1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1hyrc1 b.1.1.2 (C:181-274) Class I MHC homolog, alpha-3 domain {Human (Homo sapiens), Mic-a [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fx7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c5ch2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i1ca1 b.1.1.2 (A:239-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1u58a1 b.1.1.2 (A:145-242) Immunomodulatory protein m144, alpha-3 domain {Murine cytomegalovirus [TaxId: 10366]} | Back information, alignment and structure |
|---|
| >d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bz7b1 b.1.1.1 (B:1-122) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2p49b1 b.1.1.1 (B:1-121) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} | Back information, alignment and structure |
|---|
| >d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q9rb1 b.1.1.1 (B:1-111) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rjca1 b.1.1.1 (A:2-127) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} | Back information, alignment and structure |
|---|
| >d1rzga1 b.1.1.1 (A:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ai1h1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yedb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hxmb2 b.1.1.2 (B:124-230) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l6xa1 b.1.1.2 (A:237-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fb4h1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2agjh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1ol0a_ b.1.1.1 (A:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fp5a1 b.1.1.2 (A:336-438) Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1eapb1 b.1.1.1 (B:1-124) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rjca1 b.1.1.1 (A:2-127) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} | Back information, alignment and structure |
|---|
| >d1dfbh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c2ah1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d7fabh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nfdf1 b.1.1.1 (F:1-114) Immunoglobulin heavy chain variable domain, VH {Hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1igtb3 b.1.1.2 (B:236-361) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jpth1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1u58a1 b.1.1.2 (A:145-242) Immunomodulatory protein m144, alpha-3 domain {Murine cytomegalovirus [TaxId: 10366]} | Back information, alignment and structure |
|---|
| >d1rzfh1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jbja2 b.1.1.4 (A:1-100) CD3 epsilon chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fo0b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3cx5j1 b.1.1.1 (J:1-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogae2 b.1.1.2 (E:119-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zvya1 b.1.1.1 (A:2-125) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} | Back information, alignment and structure |
|---|
| >d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fbjh2 b.1.1.2 (H:119-220) Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1um5h1 b.1.1.1 (H:3-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3b5ha2 b.1.1.4 (A:23-102) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jnhb1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rz7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a2yb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1indh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dfbh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f3dh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qnzh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2p49b1 b.1.1.1 (B:1-121) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} | Back information, alignment and structure |
|---|
| >d1fltx_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jelh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bz7b1 b.1.1.1 (B:1-122) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b2wh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1pg7x1 b.1.1.1 (X:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2nxyd1 b.1.1.1 (D:3001-3128) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mfah1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mqkh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncwh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ct8b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ol0a_ b.1.1.1 (A:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d2fbjh2 b.1.1.2 (H:119-220) Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mjuh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dlfh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tjgh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1op3h1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1r0ah1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xiwa_ b.1.1.4 (A:) CD3 epsilon chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rhhb1 b.1.1.1 (B:3-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ieha_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} | Back information, alignment and structure |
|---|
| >d1kcvh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rzfh1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|