Psyllid ID: psy15135

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000
MSIELAYSVREEAFTCRICQAVFDKYVRLCGHLRTVHNEKPEKSNLCFVCAKVFATRATLTLHIKQMHGGGQTDYVREKEVCEICSARVVNLAEHKLCHEPPRFTCEYCVKPFRRTQELRNHVKAVHLTETPEERPRCEVCGKTFGLKEYLRRHMRTHRVERKYNGFESAALCFICGFYHKHKKMIYRHIKEHIEPKKQEKKVCDICSAEVIHLGTHQKVAHSGVTYNCKFCSMKFTRVGQMNIHIKTVHLKHMLEKKFVCQYCNKEFPFQGYLNKHMKTHNHHGNGPGGGGHVTYTCKQCNLTFTNKHLFRNHKLFEADEFFDGEVPLYESSSDKEDVEEEEEMEEEVWQCRHCPLKHRSHDLLLRHYTKEHGGYDWASVCYYCGYFNGHKKMIYLHIKDHVAPKKREMKICDICCAEVLHLQQHQKAAHSGVCYDCTFCGKGFTRKAELNIHIKAVHLKHQLEQRFVCQYCNKDFPFMKYLKRHLRVHSNDVQVPHPYKCTACNAAFNTKSALNVHRKTCPNLELLNRDLLPNQTGTDDEKKLEQKEMAKKPTVTEPAGEEAFTCRICQAVFDKYVRLCGHLRTVHNEKPEKSNLCFVCAKVFATRATLTLHIKQMHGGGQTDYVREKEVCEICSARVVNLAEHKLCHEPPRFTCEYCVKPFRRTQELRNHVKAVHLTETPEERPRCEVCGKTFGLKEYLRRHMRTHRVERKYKCVCGDGFNFNVSLKVHMAKCAFYLKSLEKEGESDHGGYETSSLCYHCGYYSKNRSTLKNHVRVEHGENQAKRKEKKICDICSAEVVHLAIHKKHSHSGQYHVCPHCGKKFTRKAELQLHIKGIHLKHQLEKTYICEYCHKEFTFYNYLRRHMRVHTNEKPYKCKDCGAAFNHNVSLKNHKNSSCPKRDMTATPPAPRRTESNTRHSHLSSNSTSPSHNGPVDLGHNPAMHSAPTLATSSNVRIPKFDRRQHQRSMMEMIQNSSNIATNVPFPAVFDAAHMYYYG
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccHHHccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccHHHHHHHcccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccHHHccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccEEEccccccEEcccccccEccccHHHHHHHHccccccccccccHHcccccccccHHHHHHHHHcccccccEccccccccccEccccHHHHHHHHccccccEcccccccEccccHHHHHHHHHHHHcccccccEcccccccEccccHHHHHHHHccccccccccccccEcccccccEccccHHHHHHHHcccccccEccHccccEccccHHHHHHHHcccccccEcccccccEccccHHHHHHHEHEEccccccccEccHccccEccccHHHHHHHHccccccccccccccccEcccccccEccccHHHHHHHHcccccccccccccEccccHHHHHHHHcccccccEcccccccEcccccHHHHHHHcccccccccEcccccccEccccHHHHHHHHcccccccEccHccccEccccHHHHHHHHcccccccEccHccccEccccHHHHHEEEcccccccccccEcccccccEcccccHHHHHHHcccccccccccEcccccccEccccHHHHHHHHcccccccccccccccEcccccccHEcccccHHEHEEEccccccccccHccccEccccHHHHHHHHccccccccccccHHcccccccccHHHHHHHHHccccccccccccHHccccEcccccHHHHHHHccccccEcccccccEccccHHHHHHHHEccccccccccEcccccccEccccHHHHHHHHccccccEEEcccccEccccHHHHHEcccccccccHHHHHHHHccccccccEcccccccEccccHHHHHHHHccccccccccccccccccEccccHHHHHHHHccccccccccHcccccccccHHHHHHHHHcHEHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHcccccccEccHccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccEccccccccccccHHHHccEEEccccccEcccccEEEEc
MSIELAYSVREEAFTCRICQAVFDKYVRLCGHlrtvhnekpeksnlcFVCAKVFATRATLTLHIKqmhgggqtdyvREKEVCEICSARVVNLAehklchepprftceycvkpfrrtqELRNHVkavhltetpeerprcevcgktfglKEYLRRHMRThrverkyngfesAALCFICGFYHKHKKMIYRHIKEhiepkkqekkvCDICSAEVIHLGThqkvahsgvtynckfcsmkftrvgqMNIHIKTVHLKHMLEKKFVCQycnkefpfqgylnkhmkthnhhgngpgggghvtytckqcnltftnkhlfrnhklfeadeffdgevplyesssdkedveEEEEMEEEVWqcrhcplkhrshdlLLRHYtkehggydwaSVCYYCGYFNGHKKMIYLHIKdhvapkkremkICDICCAEVLHLQQHQKaahsgvcydctfcgkgftrkAELNIHIKAVHLKHQLEQRFVCQYCNKDFPFMKYLKRHLRvhsndvqvphpykctacnaafntKSALNvhrktcpnlellnrdllpnqtgtddEKKLEQKEmakkptvtepageeafTCRICQAVFDKYVRLCGHlrtvhnekpeksnlcFVCAKVFATRATLTLHIKqmhgggqtdyvREKEVCEICSARVVNLAehklchepprftceycvkpfrrtqELRNHVkavhltetpeerprcevcgktfglKEYLRRHMRThrverkykcvcgdgfnfNVSLKVHMAKCAFYLKSLEkegesdhggyetsslcyhcgyysknrstlknhVRVEHGENQAKRKEKKICDICSAEVVHLAIHKkhshsgqyhvcphcgkkftRKAELQLHIKGIHLKHQLEKTYICEYCHKEFTFYNYLRRHMrvhtnekpykckdcgaafnhnvslknhknsscpkrdmtatppaprrtesntrhshlssnstspshngpvdlghnpamhsaptlatssnvripkfdrrQHQRSMMEMIQNSsniatnvpfpavfdaaHMYYYG
msielaysvreeaFTCRICQAVFDKYVRLCGHLRtvhnekpeksnlCFVCAKVFATRATLTLHIKqmhgggqtdYVREKEVCEICSARVVNLAehklchepprftCEYCVKPFRRTQELRNHVkavhltetpeerprcevcgktfglkeylrRHMRThrverkyngfeSAALCFICGFYHKHKKMIYRHIKEHIEPKKQEKKVCDICSAEVIHLGTHQKVAHSGVTYNCKFCSMKFTRVGQMNIHIKTVHLKHMLEKKFVCQYCNKEFPFQGYLNKHMKTHNHHGNGPGGGGHVTYTCKQCNLTFTNKHLFRNHKLFeadeffdgevplYESSSDKEDVEEEEEMEEEVWQCRHCPLKHRSHDLLLRHYTKEHGGYDWASVCYYCGYFNGHKKMIYLHIKDHVAPKKREMKICDICCAEVLHLQQHQKAAHSGVCYDCTFCGKGFTRKAELNIHIKAVHLKHQLEQRFVCQYCNKDFPFMKYLKRHLRVHSNDVQVPHPYKCTACNAAFNTKSALNVHRKTCPNLellnrdllpnqtgtddekkleqkemakkptvtepageeaFTCRICQAVFDKYVRLCGHLRtvhnekpeksnlCFVCAKVFATRATLTLHIKqmhgggqtdYVREKEVCEICSARVVNLAehklchepprftCEYCVKPFRRTQELRNHVkavhltetpeerprcevcgktfglkeylrrHMRTHRVERKYKCVCGDGFNFNVSLKVHMAKCAFYLKSLEKEGESDHGGYETSSLCYHCGYYSKNRSTLKNHVRVEhgenqakrkekkiCDICSAEVVHLAIHKKhshsgqyhVCPHCGKKFTRKAELQLHIKGIHLKHQLEKTYICEYCHKEFTFYNYLRRHMRVHTNEKPYKCKDCGAAFNHNVSlknhknsscpkrdmtatppaprrtesntrhshlssnstspshNGPVDLGHNPAMHSAptlatssnvripKFDRRQHQRSMMEMIQNSsniatnvpfPAVFDAAHMYYYG
MSIELAYSVREEAFTCRICQAVFDKYVRLCGHLRTVHNEKPEKSNLCFVCAKVFATRATLTLHIKQMHGGGQTDYVREKEVCEICSARVVNLAEHKLCHEPPRFTCEYCVKPFRRTQELRNHVKAVHLTETPEERPRCEVCGKTFGLKEYLRRHMRTHRVERKYNGFESAALCFICGFYHKHKKMIYRHIKEHIEPKKQEKKVCDICSAEVIHLGTHQKVAHSGVTYNCKFCSMKFTRVGQMNIHIKTVHLKHMLEKKFVCQYCNKEFPFQGYLNKHMKThnhhgngpgggghVTYTCKQCNLTFTNKHLFRNHKLFEADEFFDGEVPLYesssdkedveeeeemeeevWQCRHCPLKHRSHDLLLRHYTKEHGGYDWASVCYYCGYFNGHKKMIYLHIKDHVAPKKREMKICDICCAEVLHLQQHQKAAHSGVCYDCTFCGKGFTRKAELNIHIKAVHLKHQLEQRFVCQYCNKDFPFMKYLKRHLRVHSNDVQVPHPYKCTACNAAFNTKSALNVHRKTCPNLELLNRDLLPNQTGTDDEKKLEQKEMAKKPTVTEPAGEEAFTCRICQAVFDKYVRLCGHLRTVHNEKPEKSNLCFVCAKVFATRATLTLHIKQMHGGGQTDYVREKEVCEICSARVVNLAEHKLCHEPPRFTCEYCVKPFRRTQELRNHVKAVHLTETPEERPRCEVCGKTFGLKEYLRRHMRTHRVERKYKCVCGDGFNFNVSLKVHMAKCAFYLKSLEKEGESDHGGYETSSLCYHCGYYSKNRSTLKNHVRVEHGENQAKRKEKKICDICSAEVVHLAIHKKHSHSGQYHVCPHCGKKFTRKAELQLHIKGIHLKHQLEKTYICEYCHKEFTFYNYLRRHMRVHTNEKPYKCKDCGAAFNHNVSLKNHKNSSCPKRDMTATPPAPRRTEsntrhshlssnstspshnGPVDLGHNPAMHSAPTLATSSNVRIPKFDRRQHQRSMMEMIQNSSNIATNVPFPAVFDAAHMYYYG
****LAYSVREEAFTCRICQAVFDKYVRLCGHLRTVHNEKPEKSNLCFVCAKVFATRATLTLHIKQMHGGGQTDYVREKEVCEICSARVVNLAEHKLCHEPPRFTCEYCVKPFRRTQELRNHVKAVHLTETPEERPRCEVCGKTFGLKEYLRRHMRTHRVERKYNGFESAALCFICGFYHKHKKMIYRHIKEHIEPKKQEKKVCDICSAEVIHLGTHQKVAHSGVTYNCKFCSMKFTRVGQMNIHIKTVHLKHMLEKKFVCQYCNKEFPFQGYLNKHMKTHNHHGNGPGGGGHVTYTCKQCNLTFTNKHLFRNHKLFEADEFFDGEVPL********************WQCRHCPLKHRSHDLLLRHYTKEHGGYDWASVCYYCGYFNGHKKMIYLHIKDHVAPKKREMKICDICCAEVLHLQQHQKAAHSGVCYDCTFCGKGFTRKAELNIHIKAVHLKHQLEQRFVCQYCNKDFPFMKYLKRHLRVHSNDVQVPHPYKCTACNAAFNTKSALNVHRKTCPNLELLNR********************************EAFTCRICQAVFDKYVRLCGHLRTVHNEKPEKSNLCFVCAKVFATRATLTLHIKQMHGGGQTDYVREKEVCEICSARVVNLAEHKLCHEPPRFTCEYCVKPFRRTQELRNHVKAVHLTETPEERPRCEVCGKTFGLKEYLRRHMRTHRVERKYKCVCGDGFNFNVSLKVHMAKCAFYLKSLE*******GGYETSSLCYHCGYYSKNRSTLKNHV*************KKICDICSAEVVHLAIHKKHSHSGQYHVCPHCGKKFTRKAELQLHIKGIHLKHQLEKTYICEYCHKEFTFYNYLRRHMRVHTNEKPYKCKDCGAAFNHNV******************************************************************************************IATNVPFPAVFDAAHMYYY*
MSIELAYSVREEAFTCRICQAVFDKYVRLCGHLRTVHNEKPEKSNLCFVCAKVFATRATLTLHIKQMHGGGQTDYVREKEVCEICSARVVNLAEHKLCHEPPRFTCEYCVKPFRRTQELRNHVKAVHLTETPEERPRCEVCGKTFGLKEYLRRHMRTHRVERKYNGFESAALCFICGFYHKHKKMIYRHIKEHIEPKKQEKKVCDICSAEVIHLGTHQKVAHSGVTYNCKFCSMKFTRVGQMNIHIKTVHLKHMLEKKFVCQYCNKEFPFQGYLNKHMKTHNHHGNGPGGGGHVTYTCKQCNLTFTNKHLFRNHKLFEADEFFDGEVPLYESSSDKEDVEEEEEMEEEVWQCRHCPLKHRSHDLLLRHYTKEHGGYDWASVCYYCGYFNGHKKMIYLHIKDHVAPKKREMKICDICCAEVLHLQQHQKAAHSGVCYDCTFCGKGFTRKAELNIHIKAVHLKHQLEQRFVCQYCNKDFPFMKYLKRHLRVHSNDVQVPHPYKCTACNAAFNTKSALNVHRKTCPNLELLNRDLLPNQTGTDDEKKLEQKEMAKKPTVTEPAGEEAFTCRICQAVFDKYVRLCGHLRTVHNEKPEKSNLCFVCAKVFATRATLTLHIKQMHGGGQTDYVREKEVCEICSARVVNLAEHKLCHEPPRFTCEYCVKPFRRTQELRNHVKAVHLTETPEERPRCEVCGKTFGLKEYLRRHMRTHRVERKYKCVCGDGFNFNVSLKVHMAKCAFYLKSLEKEGESDHGGYETSSLCYHCGYYSKNRSTLKNHVRVEHGENQAKRKEKKICDICSAEVVHLAIHKKHSHSGQYHVCPHCGKKFTRKAELQLHIKGIHLKHQLEKTYICEYCHKEFTFYNYLRRHMRVHTNEKPYKCKDCGAAFNHNVSLKNHKNSSCPKRDMTATPPAPRRTESNTRHSHLSSNSTSPSHNGPVDLGHNPAMHSAPTLATSSNVRIPKFDRRQHQRSMMEMIQNSSNIATNVPFPAVFDAAHMY***
MSIELAYSVREEAFTCRICQAVFDKYVRLCGHLRTVHNEKPEKSNLCFVCAKVFATRATLTLHIKQMHGGGQTDYVREKEVCEICSARVVNLAEHKLCHEPPRFTCEYCVKPFRRTQELRNHVKAVHLTETPEERPRCEVCGKTFGLKEYLRRHMRTHRVERKYNGFESAALCFICGFYHKHKKMIYRHIKEHIEPKKQEKKVCDICSAEVIHLGTHQKVAHSGVTYNCKFCSMKFTRVGQMNIHIKTVHLKHMLEKKFVCQYCNKEFPFQGYLNKHMKTHNHHGNGPGGGGHVTYTCKQCNLTFTNKHLFRNHKLFEADEFFDGEVPLY********************QCRHCPLKHRSHDLLLRHYTKEHGGYDWASVCYYCGYFNGHKKMIYLHIKDHVAPKKREMKICDICCAEVLHL********SGVCYDCTFCGKGFTRKAELNIHIKAVHLKHQLEQRFVCQYCNKDFPFMKYLKRHLRVHSNDVQVPHPYKCTACNAAFNTKSALNVHRKTCPNLELLNRDLLPNQTGTDDEKKLEQKEM***********EEAFTCRICQAVFDKYVRLCGHLRTVHNEKPEKSNLCFVCAKVFATRATLTLHIKQMHGGGQTDYVREKEVCEICSARVVNLAEHKLCHEPPRFTCEYCVKPFRRTQELRNHVKAVHLTETPEERPRCEVCGKTFGLKEYLRRHMRTHRVERKYKCVCGDGFNFNVSLKVHMAKCAFYLKSLE**********ETSSLCYHCGYYSKNRSTLKNHVRVE***********KICDICSAEVVHLAIHK********HVCPHCGKKFTRKAELQLHIKGIHLKHQLEKTYICEYCHKEFTFYNYLRRHMRVHTNEKPYKCKDCGAAFNHNVSLKN***************************************NGPVDLGHNPAMHSAPTLATSSNVRIPKFDRRQHQRSMMEMIQNSSNIATNVPFPAVFDAAHMYYYG
*SIELAYSVREEAFTCRICQAVFDKYVRLCGHLRTVHNEKPEKSNLCFVCAKVFATRATLTLHIKQMHGGGQTDYVREKEVCEICSARVVNLAEHKLCHEPPRFTCEYCVKPFRRTQELRNHVKAVHLTETPEERPRCEVCGKTFGLKEYLRRHMRTHRVERKYNGFESAALCFICGFYHKHKKMIYRHIKEHIEPKKQEKKVCDICSAEVIHLGTHQKVAHSGVTYNCKFCSMKFTRVGQMNIHIKTVHLKHMLEKKFVCQYCNKEFPFQGYLNKHMKTHNHHGNGPGGGGHVTYTCKQCNLTFTNKHLFRNHKLFEADEFFDGEVPLYESSSDKEDVEEEEEMEEEVWQCRHCPLKHRSHDLLLRHYTKEHGGYDWASVCYYCGYFNGHKKMIYLHIKDHVAPKKREMKICDICCAEVLHLQQHQKAAHSGVCYDCTFCGKGFTRKAELNIHIKAVHLKHQLEQRFVCQYCNKDFPFMKYLKRHLRVHSNDVQVPHPYKCTACNAAFNTKSALNVHRKTCPNLELLNRDLLPNQTGTDDEKKLEQKEMAKKPTVTEPAGEEAFTCRICQAVFDKYVRLCGHLRTVHNEKPEKSNLCFVCAKVFATRATLTLHIKQMHGGGQTDYVREKEVCEICSARVVNLAEHKLCHEPPRFTCEYCVKPFRRTQELRNHVKAVHLTETPEERPRCEVCGKTFGLKEYLRRHMRTHRVERKYKCVCGDGFNFNVSLKVHMAKCAFYLKSLEKEGESDHGGYETSSLCYHCGYYSKNRSTLKNHVRVEHGENQAKRKEKKICDICSAEVVHLAIHKKHSHSGQYHVCPHCGKKFTRKAELQLHIKGIHLKHQLEKTYICEYCHKEFTFYNYLRRHMRVHTNEKPYKCKDCGAAFNHNVSLKNHKNSSCPKRDMTATPPAPRRTESNTRHSHLSSNSTSPSHNGPVDLGHNPAMHSAPTLATSSNVRIPKFDRRQHQRSMMEMIQNSSNIATNVPFPAVFDAAHMYYYG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIELAYSVREEAFTCRICQAVFDKYVRLCGHLRTVHNEKPEKSNLCFVCAKVFATRATLTLHIKQMHGGGQTDYVREKEVCEICSARVVNLAEHKLCHEPPRFTCEYCVKPFRRTQELRNHVKAVHLTETPEERPRCEVCGKTFGLKEYLRRHMRTHRVERKYNGFESAALCFICGFYHKHKKMIYRHIKEHIEPKKQEKKVCDICSAEVIHLGTHQKVAHSGVTYNCKFCSMKFTRVGQMNIHIKTVHLKHMLEKKFVCQYCNKEFPFQGYLNKHMKTHNHHGNGPGGGGHVTYTCKQCNLTFTNKHLFRNHKLFEADEFFDGEVPLYESSSDKEDVEEEEEMEEEVWQCRHCPLKHRSHDLLLRHYTKEHGGYDWASVCYYCGYFNGHKKMIYLHIKDHVAPKKREMKICDICCAEVLHLQQHQKAAHSGVCYDCTFCGKGFTRKAELNIHIKAVHLKHQLEQRFVCQYCNKDFPFMKYLKRHLRVHSNDVQVPHPYKCTACNAAFNTKSALNVHRKTCPNLELLNRDLLPNQTGTDDEKKLEQKEMAKKPTVTEPAGEEAFTCRICQAVFDKYVRLCGHLRTVHNEKPEKSNLCFVCAKVFATRATLTLHIKQMHGGGQTDYVREKEVCEICSARVVNLAEHKLCHEPPRFTCEYCVKPFRRTQELRNHVKAVHLTETPEERPRCEVCGKTFGLKEYLRRHMRTHRVERKYKCVCGDGFNFNVSLKVHMAKCAFYLKSLEKEGESDHGGYETSSLCYHCGYYSKNRSTLKNHVRVEHGENQAKRKEKKICDICSAEVVHLAIHKKHSHSGQYHVCPHCGKKFTRKAELQLHIKGIHLKHQLEKTYICEYCHKEFTFYNYLRRHMRVHTNEKPYKCKDCGAAFNHNVSLKNHKNSSCPKRDMTATPPAPRRTESNTRHSHLSSNSTSPSHNGPVDLGHNPAMHSAPTLATSSNVRIPKFDRRQHQRSMMEMIQNSSNIATNVPFPAVFDAAHMYYYG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1000 2.2.26 [Sep-21-2011]
O433451167 Zinc finger protein 208 O yes N/A 0.792 0.678 0.282 8e-58
Q054811191 Zinc finger protein 91 OS yes N/A 0.788 0.661 0.289 2e-57
A8MQ141090 Zinc finger protein 850 O no N/A 0.798 0.732 0.270 6e-54
A6NN141173 Zinc finger protein 729 O no N/A 0.809 0.689 0.285 2e-52
Q96IR2970 Zinc finger protein 845 O no N/A 0.71 0.731 0.264 3e-52
P10076861 Zinc finger protein 26 OS no N/A 0.66 0.766 0.270 4e-49
Q8C827914 Zinc finger protein 62 OS no N/A 0.717 0.784 0.265 7e-46
A8MXY41036 Zinc finger protein 99 OS no N/A 0.708 0.683 0.263 1e-45
P08045 1350 Zinc finger protein Xfin N/A N/A 0.704 0.521 0.257 3e-44
Q8TF20911 Zinc finger protein 721 O no N/A 0.756 0.829 0.264 8e-44
>sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=1 Back     alignment and function desciption
 Score =  226 bits (575), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 257/911 (28%), Positives = 362/911 (39%), Gaps = 119/911 (13%)

Query: 6    AYSVREEAFTCRICQAVFDKYVRLCGHLRTVHNEKPEKSNLCFVCAKVFATRATLTLHIK 65
            A    E+ + C+ C   F K+  L  H      EKP K   C  C K +   +TL+ H K
Sbjct: 333  AIHAGEKPYKCKECGKAFSKFSILTKHKVIHTGEKPYK---CEECGKAYKWPSTLSYH-K 388

Query: 66   QMHGGGQTDYVREKEVCEICSARVVNLAEHKLCHEPPR-FTCEYCVKPFRRTQELRNHVK 124
            ++H G +     E   C    +    L +H++ H   + + CE C K F  +  L  H K
Sbjct: 389  KIHTGEKPYKCEE---CGKGFSMFSILTKHEVIHTGEKPYKCEECGKAFNWSSNLMEH-K 444

Query: 125  AVHLTETPEERPRCEVCGKTFGLKEYLRRHMRTHRVERKYNGFESAALCFICGFYHKHKK 184
             +H  ETP    +CE CGK F     L  H + H VE+ Y        C  CG       
Sbjct: 445  KIHTGETPY---KCEECGKGFSWSSTLSYHKKIHTVEKPYK-------CEECGKAFNQSA 494

Query: 185  MIYRHIKEHIEPKKQEKKVCDICSAEVIHLGTHQKVAHSGVTYNCKFCSMKFTRVGQMNI 244
            ++ +H + H   K  + + C    ++V  L TH+ +      Y CK C   F +V  +  
Sbjct: 495  ILIKHKRIHTGEKPYKCEECGKTFSKVSTLTTHKAIHAGEKPYKCKECGKTFIKVSTLTT 554

Query: 245  HIKTVHLKHMLEKKFVCQYCNKEFPFQGYLNKHMKTHNHHGNGPGGGGHVTYTCKQCNLT 304
            H K +H     EK + C+ C K F     L KH   H          G   Y C++C   
Sbjct: 555  H-KAIHAG---EKPYKCKECGKAFSKFSILTKHKVIHT---------GEKPYKCEECGKA 601

Query: 305  FTNKHLFRNHKLFEADEFFDGEVPLYESSSDKEDVEEEEEMEEEVWQCRHCPLKHRSHDL 364
            F       +  L E      GE P                     ++C  C     +  +
Sbjct: 602  FN-----WSSNLMEHKRIHTGEKP---------------------YKCEECGKSFSTFSV 635

Query: 365  LLRHYTKEHGGYDWASVCYYCGYFNGHKKMIYLHIKDHVAPKKREMKICDICCAEVLHLQ 424
            L +H     G   +   C  CG        +  H K H   K  + + C         L 
Sbjct: 636  LTKHKVIHTGEKPYK--CEECGKAYKWSSTLSYHKKIHTVEKPYKCEECGKAFNRSAILI 693

Query: 425  QHQKAAHSGVCYDCTFCGKGFTRKAELNIHIKAVHLKHQLEQRFVCQYCNKDFPFMKYLK 484
            +H++       Y C  CGK F++ + L  H KA+H     E+ + C+ C K F     L 
Sbjct: 694  KHKRIHTDEKPYKCEECGKTFSKVSTLTTH-KAIHAG---EKPYKCKECGKAFSKFSILT 749

Query: 485  RHLRVHSNDVQVPHPYKCTACNAAFNTKSALNVHRKTCPNLELLNRDLLPNQTGTDDEKK 544
            +H  +H+ +     PYKC  C  A+   S L+ H+K    +    +     + G    K 
Sbjct: 750  KHKVIHTGE----KPYKCEECGKAYKWPSTLSYHKK----IHTGEKPYKCEECG----KG 797

Query: 545  LEQKEMAKKPTVTEPAGEEAFTCRICQAVFDKYVRLCGHLRTVHNEKPEKSNLCFVCAKV 604
                 +  K  V    GE+ + C  C   F        H +T   EK  K   C  C K 
Sbjct: 798  FSMFSILTKHEVIH-TGEKPYKCEECGKAFSWLSVFSKHKKTHAGEKFYK---CEACGKA 853

Query: 605  FATRATLTLHIKQMHGGGQTDYVREKEVCEICSARVVNLAEHKLCH--EPPRFTCEYCVK 662
            + T + LT H K +H G +     E   C        NL EHK  H  E P + CE C K
Sbjct: 854  YNTFSILTKH-KVIHTGEKPYKCEE---CGKAFNWSSNLMEHKKIHTGETP-YKCEECDK 908

Query: 663  PFRRTQELRNHVKAVHLTETPEERPRCEVCGKTFGLKEYLRRHMRTHRVERKYKCV-CGD 721
             F     L  H KA H  E P    +CE CGK F     L  H  TH  E  YKC  CG 
Sbjct: 909  AFSWPSSLTEH-KATHAGEKPY---KCEECGKAFSWPSRLTEHKATHAGEEPYKCEECGK 964

Query: 722  GFNFNVSL----KVHMA----KC-----AFYLKSLEKEGESDHGGYETSSLCYHCGYYSK 768
             FN++ +L    ++H      KC     +F   S+  + +  H G E    C  CG   K
Sbjct: 965  AFNWSSNLMEHKRIHTGEKPYKCEECGKSFSTFSILTKHKVIHTG-EKPYKCEECGKAYK 1023

Query: 769  NRSTLKNHVRVEHGENQAKRKEKKICDICSAEVVHLAIHKKHS--HSGQ-YHVCPHCGKK 825
              STL  H ++   E   K      C+ C    V  +I  KH   H+G+  + C  CGK 
Sbjct: 1024 WSSTLSYHKKIHTVEKPYK------CEECGKGFVMFSILAKHKVIHTGEKLYKCEECGKA 1077

Query: 826  FTRKAELQLHIKGIHLKHQLEKTYICEYCHKEFTFYNYLRRHMRVHTNEKPYKCKDCGAA 885
            +   + L+ H K     H  EK Y CE C K F+ ++ L +H  +HT EKPYKC++CG A
Sbjct: 1078 YKWPSTLRYHKK----IHTGEKPYKCEECGKAFSTFSILTKHKVIHTGEKPYKCEECGKA 1133

Query: 886  FNHNVSLKNHK 896
            F+       HK
Sbjct: 1134 FSWLSVFSKHK 1144
May be involved in transcriptional regulation.
Homo sapiens (taxid: 9606)
>sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 Back     alignment and function description
>sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 Back     alignment and function description
>sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=3 Back     alignment and function description
>sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 Back     alignment and function description
>sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 Back     alignment and function description
>sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=2 SV=1 Back     alignment and function description
>sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=2 Back     alignment and function description
>sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 Back     alignment and function description
>sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1000
326680667 1782 PREDICTED: zinc finger protein 729-like 0.778 0.436 0.269 5e-65
390479138 1568 PREDICTED: zinc finger protein 729 [Call 0.79 0.503 0.294 5e-65
326666983853 PREDICTED: zinc finger protein 91-like [ 0.801 0.939 0.265 3e-64
301788646 1782 PREDICTED: zinc finger protein 208-like 0.791 0.443 0.295 1e-63
326667110 1395 PREDICTED: zinc finger protein 729-like, 0.816 0.584 0.273 1e-63
326680774 1307 PREDICTED: zinc finger protein 729-like 0.787 0.602 0.263 2e-63
326667106941 PREDICTED: zinc finger protein 729-like 0.74 0.786 0.265 3e-63
326665700 1573 PREDICTED: zinc finger protein 91-like [ 0.81 0.514 0.271 4e-63
326667187 1365 PREDICTED: zinc finger protein 729-like 0.821 0.601 0.271 4e-63
390478794 1513 PREDICTED: zinc finger protein 729-like 0.781 0.516 0.292 9e-63
>gi|326680667|ref|XP_003201586.1| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
 Score =  256 bits (654), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 246/913 (26%), Positives = 362/913 (39%), Gaps = 135/913 (14%)

Query: 11   EEAFTCRICQAVFDKYVRLCGHLRTVHNEKPEKSNLCFVCAKVFATRATLTLHIKQMHGG 70
            E+ F C  C   F++   L  H+R    EKP     C  C K F+  A L  H++ +H G
Sbjct: 760  EKPFACTQCGKNFNQSSHLNQHMRIHTGEKPF---TCTQCGKSFSYSANLNQHMR-IHTG 815

Query: 71   GQTDYVREKEVCEICSARVVNLAEHKLCH--EPPRFTCEYCVKPFRRTQELRNHVKAVHL 128
             +     +   C    +   NL +H   H  E P FTC  C K F ++  L  H++ +H 
Sbjct: 816  EKPFTCTQ---CGKSFSNSANLNQHMRIHTGEKP-FTCTQCGKSFSQSSYLNQHMR-IHT 870

Query: 129  TETPEERPRCEVCGKTFGLKEYLRRHMRTHRVERKYNGFESAALCFICGFYHKHKKMIYR 188
             E P     C  CGK+F    YL +HMR H  E+ +        C  CG        +Y 
Sbjct: 871  GEKPFT---CSQCGKSFSQSPYLNQHMRIHTGEKPFT-------CSQCGKSFSQSSSLYL 920

Query: 189  HIKEHIEPKKQEKKVCDICSAEVIHLGTHQKVAHSGVTYNCKFCSMKFTRVGQMNIHIKT 248
            H++ H   K      C    ++  +L  H +       + C  C   F++   +N+H++ 
Sbjct: 921  HMRIHTGEKPFTCTQCGKSFSKSSNLNIHMRNHTGEKPFTCLQCGKSFSQSTSLNLHMRI 980

Query: 249  VHLKHMLEKKFVCQYCNKEFPFQGYLNKHMKTHNHHGNGPGGGGHVTYTCKQCNLTFTNK 308
                H  EK F C  C K F      N HM+  NH G  P       +TC QC  +F+  
Sbjct: 981  ----HTGEKPFTCTQCGKSFSQSSNPNIHMR--NHIGEKP-------FTCTQCGKSFSKS 1027

Query: 309  HLFRNHKLFEADEFFDGEVPLYESSSDKEDVEE--EEEMEEEVWQCRHCPLKHRSHDLLL 366
                 H    A E         +S S    + +       E+ + C  C           
Sbjct: 1028 SSLNQHMRIHAGEKPSACSQCGKSFSCSSHLNKHMRNHTREKPFSCTQCGKSFSYPSAFN 1087

Query: 367  RHYTKEHGGYDWASVCYYCGYFNGHKKMIYLHIKDHVAPKKREMKICDICCAEVLHLQQH 426
            +H     G   ++  C  CG    +   +  H+  H   K      C    +   HL +H
Sbjct: 1088 KHMMIHTGEKPFS--CTQCGKSFSYSSSLNYHMMIHAGEKPSACSQCGKSFSCSSHLNKH 1145

Query: 427  QKAAHSGVCYDCTFCGKGFTRKAELNIHIKAVHLKHQLEQRFVCQYCNKDFPFMKYLKRH 486
             +       + CT CGK F + ++LN+H++     H  E+ F C  C K F    +L  H
Sbjct: 1146 IRIHTGEKPFTCTQCGKSFIQSSQLNLHMRI----HTGEKPFTCTQCGKSFSRSSHLNYH 1201

Query: 487  LRVHSNDVQVPHPYKCTACNAAFNTKSALNVHRKTCPNLELLNRDLLPNQTGTDDEKKLE 546
            +R+H+ +     P+ CT C  +    S+L  H +                          
Sbjct: 1202 MRIHTGEK----PFSCTQCGKSLRRSSSLKQHMRI------------------------- 1232

Query: 547  QKEMAKKPTVTEPAGEEAFTCRICQAVFDKYVRLCGHLRTVHNEKPEKSNLCFVCAKVFA 606
                          GE+ FTC  C   F +   L  H+R    EKP     C  C K F+
Sbjct: 1233 ------------HTGEKPFTCTQCGKSFRRSSHLNQHMRIHTGEKPFS---CTQCGKSFS 1277

Query: 607  TRATLTLHIKQMHGGGQTDYVREKEVCEICSARVVNLAEHKLCH------EPPRFTCEYC 660
              ++L LH+  M   G+  +      C  C  +  N + H   H      E P FTC  C
Sbjct: 1278 QSSSLNLHM--MSHTGEKPFT-----CTQC-GKTFNCSSHLNQHMRIHTGEKP-FTCTQC 1328

Query: 661  VKPFRRTQELRNHVKAVHLTETPEERPRCEVCGKTFGLKEYLRRHMRTHRVERKYKCV-C 719
             K F ++  L  H++ +H  E P +   C  CGK+F     L +HMR H  E+ + C  C
Sbjct: 1329 GKSFSQSSNLNLHMR-IHTREKPFQ---CTQCGKSFSHSSSLNQHMRIHTGEKPFTCSQC 1384

Query: 720  GDGFN----FNVSLKVHMAK----CAFYLKSLEKEGESD-----HGGYETSSLCYHCGYY 766
            G  FN     N  +K+H  +    C    KS  +    +     H G E    C  CG  
Sbjct: 1385 GKSFNCLSLLNKHMKIHTGEKPFTCTQCGKSFSQSTSLNQHMRIHTG-EKPFTCTQCGKS 1443

Query: 767  SKNRSTLKNHVRVEHGENQAKRKEKKICDICSAEV---VHLAIHKKHSHSGQY-HVCPHC 822
                S+L  H+++  GE      +   C  C        HL  H +  HSG+    C  C
Sbjct: 1444 FSQSSSLNQHMKIHTGE------KPFTCTQCGKSFNCKPHLNQHTR-IHSGEKPFTCTQC 1496

Query: 823  GKKFTRKAELQLHIKGIHLKHQLEKTYICEYCHKEFTFYNYLRRHMRVHTNEKPYKCKDC 882
            GK F++ + L LH+    + H  EK + C  C K F F ++L  HMR+HT EKP+ C  C
Sbjct: 1497 GKSFSQSSNLNLHM----INHTGEKPFTCTQCGKSFNFLSHLNLHMRIHTGEKPFTCTQC 1552

Query: 883  GAAFNHNVSLKNH 895
            G +F+H+ SL  H
Sbjct: 1553 GRSFSHSSSLNRH 1565

Source: Danio rerio

Species: Danio rerio

Genus: Danio

Family: Cyprinidae

Order: Cypriniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota
>gi|390479138|ref|XP_003735658.1| PREDICTED: zinc finger protein 729 [Callithrix jacchus] Back     alignment and taxonomy information
>gi|326666983|ref|XP_003198441.1| PREDICTED: zinc finger protein 91-like [Danio rerio] Back     alignment and taxonomy information
>gi|301788646|ref|XP_002929740.1| PREDICTED: zinc finger protein 208-like [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|326667110|ref|XP_003198489.1| PREDICTED: zinc finger protein 729-like, partial [Danio rerio] Back     alignment and taxonomy information
>gi|326680774|ref|XP_002661688.2| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
>gi|326667106|ref|XP_003198487.1| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
>gi|326665700|ref|XP_003198088.1| PREDICTED: zinc finger protein 91-like [Danio rerio] Back     alignment and taxonomy information
>gi|326667187|ref|XP_001920997.3| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
>gi|390478794|ref|XP_003735581.1| PREDICTED: zinc finger protein 729-like [Callithrix jacchus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1000
ZFIN|ZDB-GENE-071004-1051014 zgc:173573 "zgc:173573" [Danio 0.842 0.830 0.261 5.1e-74
ZFIN|ZDB-GENE-110914-25983 si:dkey-196n19.7 "si:dkey-196n 0.831 0.845 0.267 1.7e-73
UNIPROTKB|A6NN141173 ZNF729 "Zinc finger protein 72 0.824 0.702 0.282 2.5e-73
ZFIN|ZDB-GENE-110914-1601003 si:dkey-240n22.7 "si:dkey-240n 0.838 0.835 0.266 2.8e-73
ZFIN|ZDB-GENE-110913-38987 si:ch211-208f21.5 "si:ch211-20 0.826 0.836 0.271 4.6e-73
UNIPROTKB|G3X8F81183 ZNF582 "Uncharacterized protei 0.835 0.705 0.274 3.2e-72
UNIPROTKB|F1MJE71173 F1MJE7 "Uncharacterized protei 0.821 0.699 0.286 6.5e-72
ZFIN|ZDB-GENE-080213-7 1017 zgc:174234 "zgc:174234" [Danio 0.729 0.716 0.277 8.6e-72
UNIPROTKB|O433451167 ZNF208 "Zinc finger protein 20 0.821 0.703 0.281 6.1e-71
UNIPROTKB|Q054811191 ZNF91 "Zinc finger protein 91" 0.822 0.690 0.290 2.4e-70
ZFIN|ZDB-GENE-071004-105 zgc:173573 "zgc:173573" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 747 (268.0 bits), Expect = 5.1e-74, P = 5.1e-74
 Identities = 252/964 (26%), Positives = 379/964 (39%)

Query:    11 EEAFTCRICQAVFDKYVRLCGHLRTVHNEKPEKSNLCFVCAKVFATRATLTLHIKQMHGG 70
             E+ F C  C   F     L  H+R+   EKP     C  C K F+  +   LH+  M+  
Sbjct:    30 EKPFACTQCGKSFSHSSHLIQHMRSHTGEKPYT---CTQCGKSFSQSSNFNLHM--MNHT 84

Query:    71 GQTDYVREKEVCEICSARVVNLAEHKLCH--EPPRFTCEYCVKPFRRTQELRNHVKAVHL 128
             G+  Y   +  C    ++  +L  H   H  E P FTC  C K F ++  L  H+K +H 
Sbjct:    85 GEKPYTCTQ--CGKSFSQSSHLNIHMRIHTGEKP-FTCTQCGKSFSQSSNLNYHMK-IHT 140

Query:   129 TETPEERPRCEVCGKTFGLKEYLRRHMRTHRVERKY------------NGF--------- 167
              E P     C  CGK+F    +L  HMR H  E+ +            + F         
Sbjct:   141 GEKPFA---CTQCGKSFIRSRHLNLHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMMSHTG 197

Query:   168 ESAALCFICGFYHKHKKMIYRHIKEHIEPKKQEKKVCDICSAEVIHLGTHQKVAHSGVT- 226
             E    C  CG           H++ H   K      C    +++ +L  H ++ H+G   
Sbjct:   198 EKPFTCTHCGKSFGQSSQFNNHMRIHTGEKPFTCTQCGKSFSQLSNLNNHMRI-HTGEKP 256

Query:   227 YNCKFCSMKFTRVGQMNIHIKTVHLKHMLEKKFVCQYCNKEFPFQGYLNKHMKTXXXXXX 286
             Y C  C   F+++  +  H+K     H  EK F C  C K F +   LN+HM+       
Sbjct:   257 YTCTQCGKSFSQLSNLKNHMKI----HTGEKPFTCTQCGKTFNYSSTLNQHMRIHTGEK- 311

Query:   287 XXXXXXXVTYTCKQC-NLTFTNKHLFRNHKLFEADE--FFDGEVPLYXXXXXXXXXXXXX 343
                      +TC QC   +F        H      E  +   +                 
Sbjct:   312 --------PFTCTQCCGKSFKQSSNLNLHMRIHTGEKPYTCTQCGKSFSQAPTLYTHMRI 363

Query:   344 XXXXXXWQCRHCPLKHRSHDLLLRHYTKEHGGYDWASVCYYCGYFNGHKKMIYLHIKDHV 403
                   + C  C         L +H     G   +   C  CG        +Y H++ H 
Sbjct:   364 HTGEKPFTCTQCGRSFSQSQNLQKHMVIHTGERPYT--CIQCGKSFSQPPSLYTHMRIHT 421

Query:   404 APKKREMKICDICCAEVLHLQQHQKAAHSGVC-YDCTFCGKGFTRKAELNIHIKAVHLKH 462
               K      C    ++  HL +H +  H+G   + CT CGK F++   L  H++     H
Sbjct:   422 GEKPYTCTQCGKSFSQTSHLIKHMRI-HTGEKPFPCTQCGKSFSQSPSLYAHMRI----H 476

Query:   463 QLEQRFVCQYCNKDFPFMKYLKRHLRVHSNDVQVPHPYKCTACNAAFNTKSALNVHRKT- 521
               E+ F C  C K F    +L +H+R+H+ +     P+ CT C  +F+  S LN H K  
Sbjct:   477 TGEKPFTCTQCGKRFSQSSHLIKHMRIHTGE----KPFPCTRCGKSFSRSSHLNDHMKIH 532

Query:   522 ----------CPNLELLNRDLLPNQTGTDDEKKLEQKEMAKK----PTVTEP----AGEE 563
                       C    +   +L  +Q     EK  E     K+     T+ +      GE+
Sbjct:   533 TGVKEYMCFECDKTFIKAGELKQHQRVHTGEKPYECSHCNKRFGGLGTLKKHERIHTGEK 592

Query:   564 AFTCRICQAVFDKYVRLCGHLRTVHNEKPEKSNLCFVCAKVFATRATLTLHIKQMHGGGQ 623
              + C +C   F+    L  H+RT   EKP +   C  C K F+   TLT H  ++H G +
Sbjct:   593 PYECSLCNKRFNCTGTLKKHVRTHTGEKPYE---CSHCNKRFSCSGTLTKHHMRIHTG-E 648

Query:   624 TDYVREKEVCEICSARVVNLAEHKLCH--EPPRFTCEYCVKPFRRTQELRNHVKAVHLTE 681
               Y+  +  C    ++  ++ +H   H  E P FTC  C K F     L  H+K +H  E
Sbjct:   649 KPYMCTQ--CGKSFSQSSDVNKHMRIHTGEKP-FTCTQCGKSFSHASTLNQHMK-IHTGE 704

Query:   682 TPEERPRCEVCGKTFGLKEYLRRHMRTHRVERKYKCV-CGDGFNFNVSLKVHMAK----- 735
              P     C  CGK F     + +HMR+H  E+ + C  CG  F+ + +L  HM       
Sbjct:   705 KPY---MCTQCGKGFNQSSDVIKHMRSHTGEKPFTCTQCGKSFSQSSNLNKHMWSHTGER 761

Query:   736 ---CAFYLKSLEKEGES-----DHGGYETSSLCYHCGYYSKNRSTLKNHVRVEHGENQAK 787
                C    KS  +  +       H G E    C  CG    + S L  H  +  GE    
Sbjct:   762 PYTCTQCGKSFSQSSDVTKHMWSHTG-EKPFTCTQCGKSFSHSSNLNKHTMIHTGEKPFT 820

Query:   788 RKEKKICDICSAEVVHLAIHKK-H-SHSGQY-HVCPHCGKKFTRKAELQLHIKGIHLKHQ 844
               +   C        HL  H K H +H+G+  + C  CGK F++ + L LH++     H 
Sbjct:   821 CTQ---CGKSFRRSSHLNKHMKIHMTHTGERPYTCTQCGKSFSQSSHLSLHMQ----MHS 873

Query:   845 LEKTYICEYCHKEFTFYNYLRRHMRVHTNEKPYKCKDCGAAFNHNVSLKNHKNSSCPKRD 904
              EK + C  C K F+  ++L  HM++HT EKP+ C  CG  F  + SL  H+     ++ 
Sbjct:   874 GEKPFRCIQCGKSFSQSSHLNEHMKIHTGEKPFTCTQCGKNFRQSSSLNLHRKIHTGEKP 933

Query:   905 MTAT 908
              + T
Sbjct:   934 FSCT 937
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0008150 "biological_process" evidence=ND
ZFIN|ZDB-GENE-110914-25 si:dkey-196n19.7 "si:dkey-196n19.7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A6NN14 ZNF729 "Zinc finger protein 729" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110914-160 si:dkey-240n22.7 "si:dkey-240n22.7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-38 si:ch211-208f21.5 "si:ch211-208f21.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G3X8F8 ZNF582 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MJE7 F1MJE7 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080213-7 zgc:174234 "zgc:174234" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|O43345 ZNF208 "Zinc finger protein 208" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q05481 ZNF91 "Zinc finger protein 91" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1000
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 2e-04
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information 
 Score = 38.9 bits (91), Expect = 2e-04
 Identities = 17/26 (65%), Positives = 19/26 (73%)

Query: 863 YLRRHMRVHTNEKPYKCKDCGAAFNH 888
            LRRHMR HT EKPYKC  CG +F+ 
Sbjct: 1   NLRRHMRTHTGEKPYKCPVCGKSFSS 26

Length = 26

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1000
KOG1074|consensus958 99.95
KOG2462|consensus279 99.94
KOG1074|consensus958 99.94
KOG3623|consensus1007 99.91
KOG2462|consensus279 99.91
KOG3608|consensus467 99.91
KOG3608|consensus467 99.9
KOG3623|consensus1007 99.82
KOG3576|consensus267 99.61
KOG3576|consensus267 99.6
KOG1146|consensus1406 99.23
KOG1146|consensus1406 99.08
PHA0276855 hypothetical protein; Provisional 99.06
PHA00733128 hypothetical protein 99.05
PLN03086567 PRLI-interacting factor K; Provisional 99.04
PLN03086567 PRLI-interacting factor K; Provisional 98.92
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.83
PHA00733128 hypothetical protein 98.72
PHA0276855 hypothetical protein; Provisional 98.69
KOG3993|consensus500 98.68
KOG3993|consensus500 98.5
PHA0061644 hypothetical protein 98.48
PHA0073279 hypothetical protein 98.3
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.17
PHA0061644 hypothetical protein 98.14
PHA0073279 hypothetical protein 98.08
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.92
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.84
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.7
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.55
COG5189423 SFP1 Putative transcriptional repressor regulating 97.41
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.26
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.22
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.19
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.17
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.15
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.07
KOG2231|consensus669 96.84
COG5189423 SFP1 Putative transcriptional repressor regulating 96.71
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.7
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.67
PRK04860160 hypothetical protein; Provisional 96.58
COG5236493 Uncharacterized conserved protein, contains RING Z 96.58
smart0035526 ZnF_C2H2 zinc finger. 96.53
KOG2231|consensus 669 96.47
smart0035526 ZnF_C2H2 zinc finger. 96.12
KOG2785|consensus390 95.99
COG5236493 Uncharacterized conserved protein, contains RING Z 95.92
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.7
KOG2482|consensus423 95.67
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.64
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.57
KOG2785|consensus390 95.55
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.5
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.2
KOG2482|consensus423 95.15
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.92
KOG4173|consensus253 94.4
PRK04860160 hypothetical protein; Provisional 92.86
KOG4173|consensus253 92.67
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 91.59
COG5048467 FOG: Zn-finger [General function prediction only] 91.32
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 90.12
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 89.88
COG5048467 FOG: Zn-finger [General function prediction only] 89.67
KOG2893|consensus341 89.08
KOG2893|consensus341 89.07
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 89.0
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 88.35
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 87.67
COG404965 Uncharacterized protein containing archaeal-type C 86.55
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 86.25
>KOG1074|consensus Back     alignment and domain information 
Probab=99.95  E-value=1.3e-29  Score=270.75  Aligned_cols=209  Identities=23%  Similarity=0.400  Sum_probs=158.9

Q ss_pred             cccccccccccccHHHHHHHHhHhcCccceee-ccCCCccchhhHHHHHHHhhhhhhhhhhcCCCCCCCCCCCcCCc---
Q psy15135        686 RPRCEVCGKTFGLKEYLRRHMRTHRVERKYKC-VCGDGFNFNVSLKVHMAKCAFYLKSLEKEGESDHGGYETSSLCY---  761 (1000)
Q Consensus       686 ~~~C~~C~k~f~~~~~L~~H~~~H~~~k~~~C-~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~C~---  761 (1000)
                      +-+|-+|-++.+.++.|+.|.|+|+||+||+| +||++|.++.+|+.||..|-.            -......+.|+   
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka------------~p~~R~q~ScP~~~  672 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKA------------KPPARVQFSCPSTF  672 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhccccccc------------CccccccccCCchh
Confidence            56899999999999999999999999999999 899999999999999987421            01113568899   


Q ss_pred             ccCcccCChhHHHhHHHHhhCCcch-------hccccccccchhhhhhh---HHhhhccc----------------CCCC
Q psy15135        762 HCGYYSKNRSTLKNHVRVEHGENQA-------KRKEKKICDICSAEVVH---LAIHKKHS----------------HSGQ  815 (1000)
Q Consensus       762 ~C~~~f~~~~~l~~H~~~h~~~~~~-------~~~~~~~C~~c~~~~~~---l~~h~~~~----------------~~~~  815 (1000)
                      +|-+.|...-.|..|+++|.+....       .......|..|.+.+++   +..++..+                ..+.
T Consensus       673 ic~~kftn~V~lpQhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~  752 (958)
T KOG1074|consen  673 ICQKKFTNAVTLPQHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEEL  752 (958)
T ss_pred             hhcccccccccccceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCccccccccccccc
Confidence            9999999999999999999854221       22344567888775533   22222211                1111


Q ss_pred             ----cccCCCCCccccchhhHHHHhhcc--c-----------------cccCC---------------------------
Q psy15135        816 ----YHVCPHCGKKFTRKAELQLHIKGI--H-----------------LKHQL---------------------------  845 (1000)
Q Consensus       816 ----~~~C~~C~~~f~~~~~L~~H~~~~--h-----------------~~h~~---------------------------  845 (1000)
                          +..+..|+..+.....+..+--..  +                 ...+.                           
T Consensus       753 ~~tp~~~e~~~~~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~  832 (958)
T KOG1074|consen  753 DVTPPPPENSCGRELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQ  832 (958)
T ss_pred             ccCCCccccccccccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhcc
Confidence                467888998888777765543111  0                 00000                           


Q ss_pred             ------------------------------------------C--CccccCccccccCChHHHHhhhhhccCCCcccCCc
Q psy15135        846 ------------------------------------------E--KTYICEYCHKEFTFYNYLRRHMRVHTNEKPYKCKD  881 (1000)
Q Consensus       846 ------------------------------------------~--k~~~C~~C~k~f~~~~~L~~H~~~H~~~~p~~C~~  881 (1000)
                                                                .  -...|.+||+.|...++|..|||+|+|+|||.|.+
T Consensus       833 ~~~~l~eg~~t~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~f  912 (958)
T KOG1074|consen  833 ETSMLNEGLATKTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHF  912 (958)
T ss_pred             cccccccccccccccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchh
Confidence                                                      0  11679999999999999999999999999999999


Q ss_pred             CcccccCchhhhhccccCCCCCCCC
Q psy15135        882 CGAAFNHNVSLKNHKNSSCPKRDMT  906 (1000)
Q Consensus       882 C~~~f~~~~~L~~H~~~~~~~~~~~  906 (1000)
                      |+++|..+.+|+.||.+|....+..
T Consensus       913 C~~aFttrgnLKvHMgtH~w~q~~s  937 (958)
T KOG1074|consen  913 CEEAFTTRGNLKVHMGTHMWVQPPS  937 (958)
T ss_pred             hhhhhhhhhhhhhhhccccccCCCc
Confidence            9999999999999999997655444

>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1000
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 3e-17
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 4e-11
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 2e-09
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 1e-08
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 2e-08
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 3e-08
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 2e-07
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-07
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 6e-07
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 7e-07
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 7e-07
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 1e-06
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 4e-06
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 4e-06
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 5e-06
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 6e-06
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 7e-06
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 8e-06
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 2e-05
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-05
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 4e-05
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 3e-04
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 4e-05
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 5e-05
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 6e-05
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 1e-04
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 3e-04
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 4e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure 
Iteration: 1

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 67/218 (30%), Positives = 90/218 (41%), Gaps = 53/218 (24%)
Query: 683 PEERP-RCEVCGKTFGLKEYLRRHMRTHRVERKYKCV-CGDGFNFNVSLKVHMAKCAFYL 740
           P E+P  C  CGK+F   ++L  H RTH  E+ YKC  CG  F+    L  H        
Sbjct: 17  PGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRH-------- 68
Query: 741 KSLEKEGESDHGGYETSSLCYHCGYYSKNRSTLKNHVRVEHGENQAKRKEKKICDICSAE 800
                  +  H G E    C  CG     R+ L+ H R   GE                 
Sbjct: 69  -------QRTHTG-EKPYKCPECGKSFSQRANLRAHQRTHTGE----------------- 103
Query: 801 VVHLAIHKKHSHSGQYHVCPHCGKKFTRKAELQLHIKGIHLKHQLEKTYICEYCHKEFTF 860
                         + + CP CGK F++ A L+ H +     H  EK Y C  C K F+ 
Sbjct: 104 --------------KPYACPECGKSFSQLAHLRAHQR----THTGEKPYKCPECGKSFSR 145
Query: 861 YNYLRRHMRVHTNEKPYKCKDCGAAFNHNVSLKNHKNS 898
            + L  H R HT EKPYKC +CG +F+   +L  H+ +
Sbjct: 146 EDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRT 183
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1000
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-25
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-10
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-10
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-10
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-09
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-09
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-09
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-09
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-08
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-07
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 7e-07
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-05
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-19
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-11
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 6e-10
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-07
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-06
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 9e-06
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-04
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-04
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-19
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-13
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-10
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-09
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-09
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-08
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-06
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-06
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-06
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 8e-06
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-04
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-04
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-18
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-14
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-12
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-08
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 9e-08
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 8e-06
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-05
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-04
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 7e-18
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-12
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-09
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 6e-09
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-06
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 6e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-17
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 9e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 8e-08
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 9e-08
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-06
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 7e-17
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-09
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 7e-09
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-08
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-04
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-16
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-13
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 9e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-08
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-07
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-06
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 8e-05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-16
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-07
1tf6_A190 Protein (transcription factor IIIA); complex (tran 8e-07
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-06
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-06
1tf6_A190 Protein (transcription factor IIIA); complex (tran 9e-06
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-05
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-16
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-14
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-13
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-10
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-08
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-08
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 8e-07
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 8e-07
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-05
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-16
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-13
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-11
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-09
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 9e-09
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-07
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-06
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-05
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-05
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-04
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-04
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-16
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-15
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-08
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-08
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 9e-08
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-07
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 6e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 7e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-05
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-05
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 6e-04
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 7e-04
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-15
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-15
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-12
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-07
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-06
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 8e-06
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-04
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-04
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-15
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-14
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 7e-10
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 7e-07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 6e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-04
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-04
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-15
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-08
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-07
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-07
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 7e-06
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-05
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-04
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-15
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-15
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 8e-10
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-08
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-08
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-06
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-05
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-05
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-05
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-04
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 8e-04
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 8e-15
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-10
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-07
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 5e-14
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-08
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 6e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-05
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-05
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 9e-14
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-08
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 8e-08
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-06
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 8e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-13
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-06
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-09
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 8e-09
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-06
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-13
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-09
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 8e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-13
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-11
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 9e-10
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-07
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-12
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-12
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-07
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-12
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-11
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 9e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-11
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 7e-09
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-06
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 5e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-11
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 6e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-10
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 9e-08
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 9e-08
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 9e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 6e-10
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-09
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-08
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-07
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 8e-08
2epa_A72 Krueppel-like factor 10; transforming growth facto 4e-05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-08
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-08
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-07
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 4e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-07
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 5e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-06
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-04
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-06
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-06
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-07
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-05
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 4e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 6e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 7e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 7e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-07
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-07
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 7e-07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 7e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 4e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 8e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-07
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-06
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-06
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 3e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 9e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 6e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 6e-06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 5e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 3e-04
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 4e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  102 bits (256), Expect = 6e-25
 Identities = 67/238 (28%), Positives = 91/238 (38%), Gaps = 64/238 (26%)

Query: 664 FRRTQELRNHVKAVHLTETPEERPRCEVCGKTFGLKEYLRRHMRTHRVERKYKCV-CGDG 722
              +        A+   E P     C  CGK+F   ++L  H RTH  E+ YKC  CG  
Sbjct: 3   EFGSSSSVAQ-AALEPGEKPYA---CPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKS 58

Query: 723 FNFNVSLKVHMAKCAFYLKSLEKEGESDHGG---YETSSLCYHCGYYSKNRSTLKNHVRV 779
           F+    L  H               +  H G   Y+    C  CG     R+ L+ H R 
Sbjct: 59  FSDKKDLTRH---------------QRTHTGEKPYK----CPECGKSFSQRANLRAHQRT 99

Query: 780 EHGENQAKRKEKKICDICSAEVVHLAIHKKHSHSGQY-HVCPHCGKKFTRKAELQLHIKG 838
                                           H+G+  + CP CGK F++ A L+ H   
Sbjct: 100 --------------------------------HTGEKPYACPECGKSFSQLAHLRAH--- 124

Query: 839 IHLKHQLEKTYICEYCHKEFTFYNYLRRHMRVHTNEKPYKCKDCGAAFNHNVSLKNHK 896
               H  EK Y C  C K F+  + L  H R HT EKPYKC +CG +F+   +L  H+
Sbjct: 125 -QRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQ 181
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1000
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.95
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.95
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.93
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.89
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.87
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.86
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.86
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.85
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.85
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.85
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.84
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.82
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.82
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.82
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.76
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.76
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.75
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.75
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.73
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.73
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.72
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.72
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.7
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.68
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.68
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.68
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.67
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.66
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.66
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.66
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.63
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.63
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.6
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.6
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.59
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.58
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.56
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.56
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.56
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.54
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.54
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.53
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.53
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.53
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.53
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.53
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.53
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.52
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.52
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.51
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.51
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.5
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.5
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.48
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.47
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.46
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.45
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.45
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.44
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.44
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.43
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.42
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.41
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.41
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.39
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.39
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.38
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.37
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.37
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.36
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.33
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.33
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.32
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.3
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.28
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.27
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.25
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.24
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.24
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.24
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.23
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.23
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.22
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.22
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.22
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.22
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.21
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.21
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.21
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.21
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.21
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.21
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.2
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.2
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.19
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.19
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.18
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.18
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.18
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.17
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.16
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.13
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.11
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.1
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.1
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.1
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.08
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.08
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.08
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.07
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.06
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.05
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.05
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.03
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.03
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.02
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.02
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.02
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.02
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.02
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.02
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.02
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.02
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.01
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.0
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.0
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.0
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.99
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.96
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.96
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.95
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.95
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.95
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.94
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.94
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.93
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.89
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.87
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.86
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.85
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.83
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.81
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.78
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.77
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.77
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.77
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.76
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.75
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.73
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.73
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.72
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.72
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.72
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.7
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.7
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.61
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.61
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.6
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.6
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.6
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.59
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.58
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.57
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.56
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.55
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.55
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.54
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.53
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.47
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.46
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.45
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.44
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.44
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.39
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.36
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.36
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.33
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.33
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.32
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.32
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.31
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.29
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.29
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.28
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.27
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.26
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.25
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.25
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.23
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.22
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.52
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.21
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.2
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.5
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.19
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.17
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.17
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.15
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.15
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.1
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.07
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.05
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.02
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.02
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.26
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.99
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.99
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.21
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.2
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.93
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.93
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.92
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.92
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.13
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.87
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.84
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.81
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.77
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.48
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.25
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.05
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.5
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.39
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.32
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.09
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 94.77
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.66
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.0
2e72_A49 POGO transposable element with ZNF domain; zinc fi 93.68
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 91.67
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 91.17
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 88.53
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 85.8
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 81.19
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 80.91
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 80.83
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=4.5e-35  Score=288.47  Aligned_cols=183  Identities=36%  Similarity=0.672  Sum_probs=126.5

Q ss_pred             hHHHHHHHhhccCCCCCCcccccccccccccHHHHHHHHhHhcCccceee-ccCCCccchhhHHHHHHHhhhhhhhhhhc
Q psy15135        668 QELRNHVKAVHLTETPEERPRCEVCGKTFGLKEYLRRHMRTHRVERKYKC-VCGDGFNFNVSLKVHMAKCAFYLKSLEKE  746 (1000)
Q Consensus       668 ~~L~~H~~~~H~~~~~~~~~~C~~C~k~f~~~~~L~~H~~~H~~~k~~~C-~C~~~f~~~~~l~~H~~~~~~~~~~~~~~  746 (1000)
                      ..|..|++ .|   .++++|.|++|++.|.+...|..|+++|+++++|.| .|++.|.+...|..|++.+          
T Consensus         7 ~~l~~h~~-~~---~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h----------   72 (190)
T 2i13_A            7 SSSVAQAA-LE---PGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTH----------   72 (190)
T ss_dssp             ----------------------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHH----------
T ss_pred             ccchhhhh-hc---CCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhc----------
Confidence            34555544 33   555666666666666666666666666666666666 5666666666666666653          


Q ss_pred             CCCCCCCCCCCcCCcccCcccCChhHHHhHHHHhhCCcchhccccccccchhhhhhhHHhhhcccCCCCcccCCCCCccc
Q psy15135        747 GESDHGGYETSSLCYHCGYYSKNRSTLKNHVRVEHGENQAKRKEKKICDICSAEVVHLAIHKKHSHSGQYHVCPHCGKKF  826 (1000)
Q Consensus       747 ~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~C~~c~~~~~~l~~h~~~~~~~~~~~C~~C~~~f  826 (1000)
                           .+ +++|.|+.|++.|.+...|..|+++|+++++                               |.|++|++.|
T Consensus        73 -----~~-~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~-------------------------------~~C~~C~~~f  115 (190)
T 2i13_A           73 -----TG-EKPYKCPECGKSFSQRANLRAHQRTHTGEKP-------------------------------YACPECGKSF  115 (190)
T ss_dssp             -----HC-CCCEECTTTCCEESCHHHHHHHHHHHHTCCC-------------------------------EECTTTCCEE
T ss_pred             -----CC-CCCccCcccCCccCCHHHHHHHHHhcCCCCC-------------------------------CcCCCCCCcc
Confidence                 22 4567788899999999999999999888765                               8999999999


Q ss_pred             cchhhHHHHhhccccccCCCCccccCccccccCChHHHHhhhhhccCCCcccCCcCcccccCchhhhhccccCCCCCCC
Q psy15135        827 TRKAELQLHIKGIHLKHQLEKTYICEYCHKEFTFYNYLRRHMRVHTNEKPYKCKDCGAAFNHNVSLKNHKNSSCPKRDM  905 (1000)
Q Consensus       827 ~~~~~L~~H~~~~h~~h~~~k~~~C~~C~k~f~~~~~L~~H~~~H~~~~p~~C~~C~~~f~~~~~L~~H~~~~~~~~~~  905 (1000)
                      .+...|..|++    .|++++||+|++|++.|.+++.|..|+++|+|++||+|++|+++|.+..+|..|+++|++++||
T Consensus       116 ~~~~~l~~H~~----~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~k~~  190 (190)
T 2i13_A          116 SQLAHLRAHQR----THTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKKTS  190 (190)
T ss_dssp             SSHHHHHHHHH----HHHCCCCEECTTTCCEESCHHHHHHHHHHHHCCCCEECTTTCCEESSHHHHHHHHTTC------
T ss_pred             CCHHHHHHHHH----HhCCCCCeECCCCCcccCCHHHHHHHHHhcCCCCCeECCCCCCccCCHHHHHHHHHhcCCCCCC
Confidence            99999999994    7889999999999999999999999999999999999999999999999999999999988764
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1000
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 6e-08
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.002
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 1e-06
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 4e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 9e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 6e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 9e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 9e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.004
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.004
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 8e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.002
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.002
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.002
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.002
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 4e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.002
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 6e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.001
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.002
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.002
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: PATZ1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 47.3 bits (113), Expect = 6e-08
 Identities = 16/36 (44%), Positives = 26/36 (72%), Gaps = 1/36 (2%)

Query: 846 EKTYICEYCHKEFTFYNYLRRHMR-VHTNEKPYKCK 880
            K YIC+ C K F+  ++L  H++ VHT+E+P+KC+
Sbjct: 3   GKPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQ 38
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1000
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.69
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.53
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.43
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.36
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.33
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.27
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.26
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.26
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.26
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.2
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.19
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.19
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.17
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.15
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.14
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.14
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.13
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.07
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.04
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.03
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.01
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.97
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.94
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.93
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.93
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.91
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.89
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.86
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.78
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.75
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.68
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.67
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.65
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.63
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.61
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.57
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.53
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.52
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.4
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.38
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.38
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.36
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.31
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.3
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.22
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.14
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.13
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.11
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.03
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.91
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.83
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.82
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.77
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.75
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.73
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.72
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.7
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.62
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.59
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.54
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.47
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.41
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.32
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.31
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.26
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.23
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.22
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.15
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.07
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.98
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.95
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.86
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.82
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.77
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.67
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.61
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.59
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.46
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.44
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.33
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.19
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.13
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.01
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.0
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.83
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.81
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.79
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.77
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.74
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.47
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.44
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.27
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.64
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.44
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.43
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 93.94
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.91
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.74
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 92.87
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 92.63
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.37
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 91.37
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 90.11
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 89.33
d1y0jb136 U-shaped transcription factor, different fingers { 88.92
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 87.92
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 87.46
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 86.52
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 85.5
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 84.87
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 84.55
d1y0jb136 U-shaped transcription factor, different fingers { 84.17
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 83.28
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 83.26
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 83.08
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 83.05
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 82.69
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 81.65
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 80.87
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 80.25
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 80.07
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.69  E-value=4.3e-18  Score=122.00  Aligned_cols=53  Identities=36%  Similarity=0.706  Sum_probs=50.5

Q ss_pred             CCccccCccccccCChHHHHhhhhhccCCCcccCCcCcccccCchhhhhccccC
Q psy15135        846 EKTYICEYCHKEFTFYNYLRRHMRVHTNEKPYKCKDCGAAFNHNVSLKNHKNSS  899 (1000)
Q Consensus       846 ~k~~~C~~C~k~f~~~~~L~~H~~~H~~~~p~~C~~C~~~f~~~~~L~~H~~~~  899 (1000)
                      ||||+|+ ||++|..+..|..|+++|+|++||+|++||++|.+.++|..|+++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            6899995 9999999999999999999999999999999999999999999986
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure