Psyllid ID: psy15163


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------
MFLFIGHPNGAPTSATVRVTNLDDLVDDLSRASVNGGRQNINGSVNGLTHGSGNGVTHGPCGNKLTQPRSGKTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKIITQ
cccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccEEEEccEEccHHHHHHHcccccccccccccccccEEEEccccccccccccccccccccc
cEEEEccccccccccccHHHHHHHHHHHHHHHHccccccEcccccccccccccccccccccccccccccccccHHHccccccccccEEEEcccccccccccccEEEEEcHHHcccEEEEEEcccccccHcHHHHHccccHHHccccEcccccEEEcccccccccEEEHHccccccc
mflfighpngaptsatvRVTNLDDLVDDLsrasvnggrqningsvnglthgsgngvthgpcgnkltqprsgktckqcgqevrsgdlavyteklgdqvlwhpqcfvcstCDELLVDLMYFhykgnvyclrdyatmldiprchacdelifvneytlaenktfhvkhfccyecdkiitq
mflfighpngaptsatVRVTNLDDLVDDLSRASVNGGRQNINGSVNGLTHGSGNGVTHGPCGNKLTQPRSGKTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKIITQ
MFLFIGHPNGAPTSATVRVTNLDDLVDDLSRASVNGGRQNINGSVNGLTHGSGNGVTHGPCGNKLTQPRSGKTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKIITQ
****************VRVTNLDDLV**************************************************CGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKII**
*************************************************************************CKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKIIT*
MFLFIGHPNGAPTSATVRVTNLDDLVDDLSRASVNGGRQNINGSVNGLTHGSGNGVTHGPCGNKLT*************EVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKIITQ
MFLFIGHPNGAPTSATVRVTNLDDLVDDLSRASVNGGRQNINGSVNG*****************LTQPRSGKTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKII**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLFIGHPNGAPTSATVRVTNLDDLVDDLSRASVNGGRQNINGSVNGLTHGSGNGVTHGPCGNKLTQPRSGKTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKIITQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query176 2.2.26 [Sep-21-2011]
Q7Z3G6 844 Prickle-like protein 2 OS yes N/A 0.590 0.123 0.514 4e-31
Q80Y24 845 Prickle-like protein 2 OS yes N/A 0.590 0.123 0.495 5e-31
Q90Z06 835 Prickle-like protein 1-A N/A N/A 0.573 0.120 0.509 2e-30
Q90WV2 832 Prickle-like protein 1-B N/A N/A 0.568 0.120 0.504 5e-30
A0M8U6421 Testin OS=Canis familiari no N/A 0.755 0.315 0.431 8e-30
Q07E27421 Testin OS=Mustela putoriu N/A N/A 0.579 0.242 0.563 9e-30
Q2LAP6419 Testin OS=Rattus norvegic no N/A 0.892 0.374 0.4 1e-29
Q2QLB2421 Testin OS=Equus caballus no N/A 0.772 0.323 0.437 2e-29
Q96MT3 831 Prickle-like protein 1 OS no N/A 0.568 0.120 0.514 2e-29
Q07E51421 Testin OS=Dasypus novemci N/A N/A 0.755 0.315 0.431 2e-29
>sp|Q7Z3G6|PRIC2_HUMAN Prickle-like protein 2 OS=Homo sapiens GN=PRICKLE2 PE=1 SV=2 Back     alignment and function desciption
 Score =  134 bits (336), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 54/105 (51%), Positives = 76/105 (72%), Gaps = 1/105 (0%)

Query: 70  SGKTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLR 129
           +G  C+QCG ++  GD+AV+  + G  V WHP CFVC+ C+ELLVDL+YF+  G +YC R
Sbjct: 126 TGAICEQCGGQINGGDIAVFASRAGHGVCWHPPCFVCTVCNELLVDLIYFYQDGKIYCGR 185

Query: 130 DYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKII 174
            +A  L  PRC ACDE+IF +E T AE + +H+KHFCC+EC+ ++
Sbjct: 186 HHAECLK-PRCAACDEIIFADECTEAEGRHWHMKHFCCFECETVL 229





Homo sapiens (taxid: 9606)
>sp|Q80Y24|PRIC2_MOUSE Prickle-like protein 2 OS=Mus musculus GN=Prickle2 PE=1 SV=3 Back     alignment and function description
>sp|Q90Z06|PRI1A_XENLA Prickle-like protein 1-A OS=Xenopus laevis GN=prickle1-a PE=1 SV=1 Back     alignment and function description
>sp|Q90WV2|PRI1B_XENLA Prickle-like protein 1-B OS=Xenopus laevis GN=prickle1-b PE=2 SV=2 Back     alignment and function description
>sp|A0M8U6|TES_CANFA Testin OS=Canis familiaris GN=TES PE=3 SV=1 Back     alignment and function description
>sp|Q07E27|TES_MUSPF Testin OS=Mustela putorius furo GN=TES PE=3 SV=1 Back     alignment and function description
>sp|Q2LAP6|TES_RAT Testin OS=Rattus norvegicus GN=Tes PE=1 SV=1 Back     alignment and function description
>sp|Q2QLB2|TES_HORSE Testin OS=Equus caballus GN=TES PE=3 SV=1 Back     alignment and function description
>sp|Q96MT3|PRIC1_HUMAN Prickle-like protein 1 OS=Homo sapiens GN=PRICKLE1 PE=1 SV=2 Back     alignment and function description
>sp|Q07E51|TES_DASNO Testin OS=Dasypus novemcinctus GN=TES PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query176
328724369 559 PREDICTED: testin-like [Acyrthosiphon pi 0.579 0.182 0.627 8e-35
383852121 799 PREDICTED: uncharacterized protein LOC10 0.562 0.123 0.63 9e-34
380026603 740 PREDICTED: testin-like [Apis florea] 0.613 0.145 0.577 1e-32
328789425 742 PREDICTED: testin-like [Apis mellifera] 0.613 0.145 0.568 2e-32
194755335 817 GF11783 [Drosophila ananassae] gi|190621 0.602 0.129 0.556 2e-32
195455875 807 GK23303 [Drosophila willistoni] gi|19417 0.636 0.138 0.526 5e-32
195488727 816 GE14189 [Drosophila yakuba] gi|194178537 0.630 0.136 0.530 1e-31
159884211 848 RE57334p [Drosophila melanogaster] 0.630 0.130 0.522 1e-31
170043587 817 testin [Culex quinquefasciatus] gi|16786 0.590 0.127 0.570 1e-31
372810480 851 FI18181p1 [Drosophila melanogaster] 0.630 0.130 0.522 2e-31
>gi|328724369|ref|XP_001949083.2| PREDICTED: testin-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  151 bits (382), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 64/102 (62%), Positives = 81/102 (79%)

Query: 74  CKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYAT 133
           CKQC + V  G +AV  E+ G +V WHP CFVC+TC+ELLVDL+YF+Y  NVYC R YA 
Sbjct: 367 CKQCNKNVIPGQVAVMAERTGKEVFWHPPCFVCATCEELLVDLVYFYYSENVYCGRHYAE 426

Query: 134 MLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKIIT 175
           +L+IPRC+ACDELIF+ EYT+AE  T+HV+HFCC+ECDK + 
Sbjct: 427 ILNIPRCNACDELIFLKEYTIAEEHTYHVRHFCCFECDKPLA 468




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383852121|ref|XP_003701577.1| PREDICTED: uncharacterized protein LOC100875736 [Megachile rotundata] Back     alignment and taxonomy information
>gi|380026603|ref|XP_003697037.1| PREDICTED: testin-like [Apis florea] Back     alignment and taxonomy information
>gi|328789425|ref|XP_003251271.1| PREDICTED: testin-like [Apis mellifera] Back     alignment and taxonomy information
>gi|194755335|ref|XP_001959947.1| GF11783 [Drosophila ananassae] gi|190621245|gb|EDV36769.1| GF11783 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195455875|ref|XP_002074904.1| GK23303 [Drosophila willistoni] gi|194170989|gb|EDW85890.1| GK23303 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195488727|ref|XP_002092436.1| GE14189 [Drosophila yakuba] gi|194178537|gb|EDW92148.1| GE14189 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|159884211|gb|ABX00784.1| RE57334p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|170043587|ref|XP_001849464.1| testin [Culex quinquefasciatus] gi|167866870|gb|EDS30253.1| testin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|372810480|gb|AEX98032.1| FI18181p1 [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query176
UNIPROTKB|Q07E27421 TES "Testin" [Mustela putorius 0.573 0.239 0.568 3.3e-31
UNIPROTKB|Q2QLB2421 TES "Testin" [Equus caballus ( 0.630 0.263 0.530 4.2e-31
FB|FBgn0034223816 Tes "Testin ortholog" [Drosoph 0.630 0.136 0.522 4.8e-31
UNIPROTKB|A0M8U6421 TES "Testin" [Canis lupus fami 0.596 0.249 0.547 6.9e-31
UNIPROTKB|E2RDJ9412 TES "Testin" [Canis lupus fami 0.596 0.254 0.547 6.9e-31
UNIPROTKB|F1PFX9421 TES "Testin" [Canis lupus fami 0.596 0.249 0.547 6.9e-31
RGD|1566346419 Tes "testis derived transcript 0.755 0.317 0.459 6.9e-31
UNIPROTKB|Q2IBC3421 TES "Testin" [Rhinolophus ferr 0.636 0.266 0.513 1.1e-30
UNIPROTKB|Q6DIR5422 tes "Testin" [Xenopus (Siluran 0.772 0.322 0.461 2.3e-30
UNIPROTKB|Q07E40421 TES "Testin" [Neofelis nebulos 0.653 0.273 0.504 3e-30
UNIPROTKB|Q07E27 TES "Testin" [Mustela putorius furo (taxid:9669)] Back     alignment and assigned GO terms
 Score = 343 (125.8 bits), Expect = 3.3e-31, P = 3.3e-31
 Identities = 58/102 (56%), Positives = 73/102 (71%)

Query:    73 TCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYA 132
             +C  C Q ++ GD A+Y E+ G   LWHP CFVCSTC ELLVD++YF  KG +YC R Y 
Sbjct:   235 SCYCCKQSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKKGKLYCGRHYC 294

Query:   133 TMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKII 174
                + PRC  CDELIF NEYT AEN+ +H+KHFCC++CD I+
Sbjct:   295 DS-EKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDNIL 335




GO:0005737 "cytoplasm" evidence=ISS
GO:0008270 "zinc ion binding" evidence=ISS
GO:0008285 "negative regulation of cell proliferation" evidence=ISS
UNIPROTKB|Q2QLB2 TES "Testin" [Equus caballus (taxid:9796)] Back     alignment and assigned GO terms
FB|FBgn0034223 Tes "Testin ortholog" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|A0M8U6 TES "Testin" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RDJ9 TES "Testin" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PFX9 TES "Testin" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1566346 Tes "testis derived transcript" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q2IBC3 TES "Testin" [Rhinolophus ferrumequinum (taxid:59479)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DIR5 tes "Testin" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q07E40 TES "Testin" [Neofelis nebulosa (taxid:61452)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7Z3G6PRIC2_HUMANNo assigned EC number0.51420.59090.1232yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query176
cd0934058 cd09340, LIM1_Testin_like, The first LIM domain of 2e-25
cd0941559 cd09415, LIM1_Prickle, The first LIM domain of Pri 8e-23
cd0941358 cd09413, LIM1_Testin, The first LIM domain of Test 4e-20
cd0984159 cd09841, LIM1_Prickle_3, The first LIM domain of P 5e-20
cd0948459 cd09484, LIM1_Prickle_2, The first LIM domain of P 1e-19
cd0948359 cd09483, LIM1_Prickle_1, The first LIM domain of P 2e-18
cd0934156 cd09341, LIM2_Testin_like, The second LIM domain o 3e-18
cd0941458 cd09414, LIM1_LIMPETin, The first LIM domain of pr 3e-18
cd0941656 cd09416, LIM2_Testin, The second LIM domain of Tes 5e-14
cd0941856 cd09418, LIM2_Prickle, The second LIM domain of Pr 5e-12
cd0941756 cd09417, LIM2_LIMPETin_like, The second LIM domain 1e-08
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 2e-07
pfam0041258 pfam00412, LIM, LIM domain 5e-06
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 8e-06
cd0933159 cd09331, LIM1_PINCH, The first LIM domain of prote 8e-06
cd0932952 cd09329, LIM3_abLIM, The third LIM domain of actin 2e-05
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 3e-05
pfam0041258 pfam00412, LIM, LIM domain 7e-05
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 4e-04
cd0933653 cd09336, LIM1_Paxillin_like, The first LIM domain 4e-04
cd0933853 cd09338, LIM3_Paxillin_like, The third LIM domain 4e-04
cd0936152 cd09361, LIM1_Enigma_like, The first LIM domain of 8e-04
cd0940953 cd09409, LIM3_Paxillin, The third LIM domain of pa 0.001
cd0936354 cd09363, LIM3_Enigma_like, The third LIM domain of 0.001
cd0938755 cd09387, LIM2_LMO4, The second LIM domain of LMO4 0.002
cd0945252 cd09452, LIM1_Enigma, The first LIM domain of Enig 0.002
cd0936453 cd09364, LIM1_LIMK, The first LIM domain of LIMK ( 0.002
cd0940554 cd09405, LIM1_Paxillin, The first LIM domain of pa 0.002
cd0942159 cd09421, LIM3_LIMPETin, The third LIM domain of pr 0.002
cd0946353 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 0.004
cd0941053 cd09410, LIM3_Leupaxin, The third LIM domain of Le 0.004
cd0940655 cd09406, LIM1_Leupaxin, The first LIM domain of Le 0.004
>gnl|CDD|188726 cd09340, LIM1_Testin_like, The first LIM domain of Testin-like family Back     alignment and domain information
 Score = 92.3 bits (230), Expect = 2e-25
 Identities = 29/58 (50%), Positives = 43/58 (74%)

Query: 74  CKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDY 131
           C++C + +  G++AV+ E+ G+   WHP CFVC TC+ELLVDL+YF++ G +YC R Y
Sbjct: 1   CEKCKEPINPGEVAVFAERAGEDACWHPGCFVCETCNELLVDLIYFYHDGKIYCGRHY 58


The first LIM domain of Testin_like family: This family includes testin, prickle, dyxin and LIMPETin. Structurally, testin and prickle proteins contain three LIM domains at C-terminal; LIMPETin has six LIM domains; and dyxin presents only two LIM domains. However, all members of the family contain a PET protein-protein interaction domain. Testin is a cytoskeleton associated focal adhesion protein that localizes along actin stress fibers, at cell-cell-contact areas, and at focal adhesion plaques. Testin interacts with a variety of cytoskeletal proteins, including zyxin, mena, VASP, talin, and actin and it is involved in cell motility and adhesion events. Prickles have been implicated in roles of regulating tissue polarity or planar cell polarity (PCP). Dyxin involves in lung and heart development by interaction with GATA6 and blocking GATA6 activated target genes. LIMPETin might be the recombinant product of genes coding testin and four and half LIM proteins and its function is not well understood. As in other LIM domains, this domain family is 50-60 amino acids in size and shares two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein complexes. Length = 58

>gnl|CDD|188799 cd09415, LIM1_Prickle, The first LIM domain of Prickle Back     alignment and domain information
>gnl|CDD|188797 cd09413, LIM1_Testin, The first LIM domain of Testin Back     alignment and domain information
>gnl|CDD|188872 cd09841, LIM1_Prickle_3, The first LIM domain of Prickle 3 Back     alignment and domain information
>gnl|CDD|188868 cd09484, LIM1_Prickle_2, The first LIM domain of Prickle 2 Back     alignment and domain information
>gnl|CDD|188867 cd09483, LIM1_Prickle_1, The first LIM domain of Prickle 1 Back     alignment and domain information
>gnl|CDD|188727 cd09341, LIM2_Testin_like, The second LIM domain of Testin-like family Back     alignment and domain information
>gnl|CDD|188798 cd09414, LIM1_LIMPETin, The first LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188800 cd09416, LIM2_Testin, The second LIM domain of Testin Back     alignment and domain information
>gnl|CDD|188802 cd09418, LIM2_Prickle, The second LIM domain of Prickle Back     alignment and domain information
>gnl|CDD|188801 cd09417, LIM2_LIMPETin_like, The second LIM domain of protein LIMPETin and related proteins Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188717 cd09331, LIM1_PINCH, The first LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188715 cd09329, LIM3_abLIM, The third LIM domain of actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188747 cd09361, LIM1_Enigma_like, The first LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188793 cd09409, LIM3_Paxillin, The third LIM domain of paxillin Back     alignment and domain information
>gnl|CDD|188749 cd09363, LIM3_Enigma_like, The third LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188773 cd09387, LIM2_LMO4, The second LIM domain of LMO4 (LIM domain only protein 4) Back     alignment and domain information
>gnl|CDD|188836 cd09452, LIM1_Enigma, The first LIM domain of Enigma Back     alignment and domain information
>gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) Back     alignment and domain information
>gnl|CDD|188789 cd09405, LIM1_Paxillin, The first LIM domain of paxillin Back     alignment and domain information
>gnl|CDD|188805 cd09421, LIM3_LIMPETin, The third LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188847 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 (LIM domain Kinase 2) Back     alignment and domain information
>gnl|CDD|188794 cd09410, LIM3_Leupaxin, The third LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188790 cd09406, LIM1_Leupaxin, The first LIM domain of Leupaxin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 176
KOG1701|consensus468 99.86
KOG1701|consensus468 99.85
KOG2272|consensus332 99.84
KOG2272|consensus 332 99.81
KOG4577|consensus 383 99.76
KOG1044|consensus 670 99.76
KOG1703|consensus479 99.69
KOG1703|consensus479 99.58
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 99.56
KOG1044|consensus 670 99.23
KOG1700|consensus200 99.21
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 98.97
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 98.92
KOG4577|consensus 383 98.68
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 98.66
KOG1700|consensus200 97.98
KOG1702|consensus 264 97.58
KOG0490|consensus 235 97.49
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 91.34
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 90.93
PF0839437 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: 89.03
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 85.59
PF09943101 DUF2175: Uncharacterized protein conserved in arch 85.54
PF09943101 DUF2175: Uncharacterized protein conserved in arch 85.23
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 80.09
>KOG1701|consensus Back     alignment and domain information
Probab=99.86  E-value=1.8e-23  Score=167.31  Aligned_cols=112  Identities=25%  Similarity=0.643  Sum_probs=94.8

Q ss_pred             CCCCcccCCCCCCccCCCCCcccccccccccCCCeEEEEeccCCCcccCccCcccccCccccCCCceee-eCCcccCHhH
Q psy15163         52 SGNGVTHGPCGNKLTQPRSGKTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFH-YKGNVYCLRD  130 (176)
Q Consensus        52 ~~~~~~~~~~~~~~~~~~~~~~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~-~~g~~yC~~~  130 (176)
                      .+..+||+.||..     +..+|..|++.|.  ++|+.|.    |+.||+.||+|..|++.|.+..|.+ .++++||-.|
T Consensus       320 v~~k~~CE~cyq~-----tlekC~~Cg~~I~--d~iLrA~----GkayHp~CF~Cv~C~r~ldgipFtvd~~n~v~Cv~d  388 (468)
T KOG1701|consen  320 VDGKPYCEGCYQD-----TLEKCNKCGEPIM--DRILRAL----GKAYHPGCFTCVVCARCLDGIPFTVDSQNNVYCVPD  388 (468)
T ss_pred             cCCcccchHHHHH-----HHHHHhhhhhHHH--HHHHHhc----ccccCCCceEEEEeccccCCccccccCCCceeeehh
Confidence            3444666666553     2348999999997  4566775    8899999999999999999988876 7889999999


Q ss_pred             HhhCCCcccccccccccccCc------eEEeCCCccccCCeecccCCcccC
Q psy15163        131 YATMLDIPRCHACDELIFVNE------YTLAENKTFHVKHFCCYECDKIIT  175 (176)
Q Consensus       131 y~~~~~~~~C~~C~~~I~~~~------~~~a~~~~~H~~CF~C~~C~~~l~  175 (176)
                      |+++|+ |+|+.|+++|+..+      .|.++++.||.+||+|..|+..|+
T Consensus       389 fh~kfA-PrCs~C~~PI~P~~G~~etvRvvamdr~fHv~CY~CEDCg~~LS  438 (468)
T KOG1701|consen  389 FHKKFA-PRCSVCGNPILPRDGKDETVRVVAMDRDFHVNCYKCEDCGLLLS  438 (468)
T ss_pred             hhhhcC-cchhhccCCccCCCCCcceEEEEEccccccccceehhhcCcccc
Confidence            999999 99999999998642      256999999999999999999987



>KOG1701|consensus Back     alignment and domain information
>KOG2272|consensus Back     alignment and domain information
>KOG2272|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF08394 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF09943 DUF2175: Uncharacterized protein conserved in archaea (DUF2175); InterPro: IPR018686 This family of various hypothetical archaeal proteins has no known function Back     alignment and domain information
>PF09943 DUF2175: Uncharacterized protein conserved in archaea (DUF2175); InterPro: IPR018686 This family of various hypothetical archaeal proteins has no known function Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query176
2xqn_T126 Complex Of The 2nd And 3rd Lim Domains Of Tes With 2e-10
1rut_X188 Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 L 8e-05
2dfy_X195 Crystal Structure Of A Cyclized Protein Fusion Of L 8e-05
>pdb|2XQN|T Chain T, Complex Of The 2nd And 3rd Lim Domains Of Tes With The Evh1 Domain Of Mena And The N-Terminal Domain Of Actin-Like Protein Arp7a Length = 126 Back     alignment and structure

Iteration: 1

Score = 62.0 bits (149), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 25/38 (65%), Positives = 31/38 (81%) Query: 138 PRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKIIT 175 PRC CDELIF NEYT AEN+ +H+KHFCC++CD I+ Sbjct: 4 PRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILA 41
>pdb|1RUT|X Chain X, Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 Lid Domain Length = 188 Back     alignment and structure
>pdb|2DFY|X Chain X, Crystal Structure Of A Cyclized Protein Fusion Of Lmo4 Lim Domains 1 And 2 With The Lim Interacting Domain Of Ldb1 Length = 195 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query176
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 2e-21
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 3e-05
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 5e-18
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 2e-06
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 3e-06
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 5e-18
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 1e-10
2rgt_A 169 Fusion of LIM/homeobox protein LHX3, linker, INSU 1e-05
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 7e-16
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 2e-06
1rut_X 188 Flinc4, fusion protein of LMO4 protein and LIM dom 7e-05
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 7e-16
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 2e-05
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 8e-04
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 2e-15
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 4e-12
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 2e-06
2cuq_A80 Four and A half LIM domains 3; structural genomics 1e-12
2cuq_A80 Four and A half LIM domains 3; structural genomics 9e-08
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 3e-11
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 1e-05
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 8e-11
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 1e-04
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 1e-10
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 3e-08
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 2e-10
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 1e-09
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 2e-10
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 2e-04
3f6q_B72 LIM and senescent cell antigen-like-containing dom 5e-10
3f6q_B72 LIM and senescent cell antigen-like-containing dom 6e-05
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 1e-09
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 5e-05
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 3e-09
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 1e-07
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 5e-09
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 1e-07
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 9e-09
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 3e-07
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 3e-06
1b8t_A 192 Protein (CRP1); LIM domain, muscle differentiation 3e-05
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 1e-08
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 1e-05
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 1e-08
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 1e-08
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 1e-08
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 5e-06
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 1e-08
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 4e-08
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 2e-08
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 2e-08
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 2e-05
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 3e-08
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 2e-07
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 7e-08
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 1e-04
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 7e-08
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 2e-05
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 9e-08
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 1e-07
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 1e-07
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 1e-07
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 7e-06
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 1e-07
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 3e-06
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 1e-07
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 1e-07
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 8e-04
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 2e-07
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 3e-05
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 2e-07
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 4e-06
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 7e-07
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 4e-04
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 3e-06
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 3e-05
2co8_A82 NEDD9 interacting protein with calponin homology a 4e-06
2cor_A79 Pinch protein; LIM domain, particularly interestin 5e-06
2cor_A79 Pinch protein; LIM domain, particularly interestin 3e-04
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 1e-05
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 6e-05
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 2e-05
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
 Score = 82.5 bits (204), Expect = 2e-21
 Identities = 19/101 (18%), Positives = 35/101 (34%), Gaps = 6/101 (5%)

Query: 71  GKTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRD 130
              C +C + + +    V+ +       WH  CF C+ C   L +  +      + C + 
Sbjct: 5   SSGCVECRKPIGADSKEVHYKNR----FWHDTCFRCAKCLHPLANETFVAKDNKILCNKC 60

Query: 131 YATMLDIPRCHACDELIFVNE-YTLAENKTFHVKHFCCYEC 170
             T  D P+C  C + I   +     +   +H   F     
Sbjct: 61  T-TREDSPKCKGCFKAIVAGDQNVEYKGTVWHKDCFSGPSS 100


>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query176
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.95
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.94
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.93
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.92
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.92
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.92
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.91
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.76
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.75
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.74
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 99.74
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.73
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 99.72
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 99.72
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.71
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.69
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.69
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.68
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.68
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.67
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.67
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.67
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.66
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.66
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.65
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.65
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 99.64
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.64
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.64
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 99.62
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.62
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.61
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.6
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 99.59
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.58
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.57
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 99.57
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.57
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.56
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.56
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.54
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.53
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.53
2co8_A82 NEDD9 interacting protein with calponin homology a 99.53
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.52
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.52
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 99.51
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.51
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.5
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.5
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.49
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.48
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.42
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.41
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.38
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.25
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.14
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.14
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.11
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.1
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.08
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.08
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.08
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 99.05
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.05
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.05
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.04
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.04
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.04
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.02
2co8_A82 NEDD9 interacting protein with calponin homology a 99.02
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.01
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.01
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.0
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 98.99
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 98.96
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 98.96
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 98.96
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 98.94
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 98.93
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 98.9
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 98.89
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 98.87
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 98.84
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 98.04
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 97.97
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 83.89
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 82.47
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 82.28
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 81.69
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
Probab=99.95  E-value=7.5e-28  Score=161.91  Aligned_cols=95  Identities=18%  Similarity=0.461  Sum_probs=85.9

Q ss_pred             cccccccccccCCCeEEEEeccCCCcccCccCcccccCccccCCCceeeeCCcccCHhHHhhCCCcccccccccccccC-
Q psy15163         72 KTCKQCGQEVRSGDLAVYTEKLGDQVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVN-  150 (176)
Q Consensus        72 ~~C~~C~~~i~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~y~~~~~~~~C~~C~~~I~~~-  150 (176)
                      .+|.+|+++|..++.++.+.    ++.||++||+|..|+++|.+..|+.+++++||+.||.++|+ ++|..|+++|.++ 
T Consensus         6 ~~C~~C~~~I~~~~~~~~a~----~~~~H~~CF~C~~C~~~L~~~~~~~~~g~~yC~~cy~~~~~-~~C~~C~~~I~~~~   80 (101)
T 2cup_A            6 SGCVECRKPIGADSKEVHYK----NRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDS-PKCKGCFKAIVAGD   80 (101)
T ss_dssp             CBCSSSCCBCCSSSCEEEET----TEEEETTTCCCSSSCCCTTSSCCEEETTEEECHHHHTTCCC-CBCSSSCCBCCSSS
T ss_pred             CcCcccCCcccCCceEEEEC----ccChhhcCCcccccCCCCCcCeeECcCCEEEChhHhhhhcC-CccccCCCccccCC
Confidence            48999999998544555665    88999999999999999988889999999999999999999 9999999999854 


Q ss_pred             ceEEeCCCccccCCeecccCC
Q psy15163        151 EYTLAENKTFHVKHFCCYECD  171 (176)
Q Consensus       151 ~~~~a~~~~~H~~CF~C~~C~  171 (176)
                      .++.|+++.||++||+|..|+
T Consensus        81 ~~~~a~~~~~H~~CF~C~~C~  101 (101)
T 2cup_A           81 QNVEYKGTVWHKDCFSGPSSG  101 (101)
T ss_dssp             CEEESSSCEEETTTCCCTTCC
T ss_pred             eEEEeCCcchHHhCCCCCCCC
Confidence            467899999999999999996



>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 176
d1g47a235 g.39.1.3 (A:36-70) Pinch (particularly interesting 0.001
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure

class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: LIM domain
domain: Pinch (particularly interesting new Cys-His) protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 32.8 bits (75), Expect = 0.001
 Identities = 8/31 (25%), Positives = 18/31 (58%)

Query: 104 FVCSTCDELLVDLMYFHYKGNVYCLRDYATM 134
           FVC+ C +   + +++ ++G  YC  D+  +
Sbjct: 1   FVCAQCFQQFPEGLFYEFEGRKYCEHDFQML 31


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query176
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 99.4
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 99.0
d1g47a235 Pinch (particularly interesting new Cys-His) prote 98.99
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 98.91
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.86
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 98.83
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 98.81
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 98.7
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 98.68
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.61
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.54
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 98.52
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.52
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 98.47
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 98.37
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 98.34
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 98.32
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.32
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.3
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 98.3
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.3
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 98.25
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 98.24
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.23
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 98.23
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 98.22
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 98.21
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 98.19
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.19
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 98.17
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 98.15
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 98.13
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.12
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 98.06
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.06
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 98.04
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 98.03
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.02
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.01
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 97.94
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 97.93
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.92
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.92
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 97.91
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.9
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 97.89
d2co8a236 Nedd9 interacting protein with calponin homology, 97.86
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.85
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 97.85
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 97.78
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 97.78
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.76
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 97.72
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 97.71
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 97.71
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.67
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 97.65
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 97.63
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 97.63
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 97.6
d2co8a236 Nedd9 interacting protein with calponin homology, 97.6
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 97.57
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.55
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 97.54
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.46
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.42
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 97.37
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 97.36
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 97.34
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 97.33
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.13
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 97.11
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.1
d1x61a127 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.06
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.03
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 96.99
d1x62a131 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 96.95
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 96.9
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 96.9
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 96.87
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 96.86
d1g47a135 Pinch (particularly interesting new Cys-His) prote 96.79
d1rutx234 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 96.78
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 96.66
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 96.57
d1rutx433 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 96.07
d2cora235 Pinch (particularly interesting new Cys-His) prote 95.98
d1g47a135 Pinch (particularly interesting new Cys-His) prote 95.14
d2cupa231 Four and a half LIM domains protein 1, FHL-1 {Huma 94.66
d1wiga241 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 94.54
d1wiga241 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 94.43
d2cora131 Pinch (particularly interesting new Cys-His) prote 94.24
d1x61a127 Thyroid receptor interacting protein 6, TRIP6 {Hum 94.18
d2d8xa132 Pinch (particularly interesting new Cys-His) prote 93.51
d1x6aa234 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 92.66
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 92.03
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 91.6
d1j2oa233 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 90.51
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 88.78
d1x68a234 Four and a half LIM domains protein 5, FHL-5 {Huma 87.43
d2co8a133 Nedd9 interacting protein with calponin homology, 86.38
d1x4la230 Four and a half LIM domains protein 2, FHL2 {Human 83.73
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 83.59
d1v6ga240 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 82.36
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 82.31
d2c2la280 STIP1 homology and U box-containing protein 1, STU 80.26
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: LIM domain
domain: Leupaxin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.40  E-value=1.8e-14  Score=75.62  Aligned_cols=35  Identities=26%  Similarity=0.736  Sum_probs=31.6

Q ss_pred             hHHhhCCCcccccccccccccCceEEeCCCccccCCe
Q psy15163        129 RDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHF  165 (176)
Q Consensus       129 ~~y~~~~~~~~C~~C~~~I~~~~~~~a~~~~~H~~CF  165 (176)
                      +||.++|+ |+|..|+++|.+ .+|.|+++.|||+||
T Consensus         1 ~DY~~~fa-pkC~~C~~~I~g-~~v~Al~~~wHpeCF   35 (35)
T d1x3ha1           1 KDFLAMFS-PKCGGCNRPVLE-NYLSAMDTVWHPECF   35 (35)
T ss_dssp             CCCCCCCS-CBCTTTCCBCCS-SCEEETTEEECTTTC
T ss_pred             CcHHHHhC-hhhhhcCCcccc-hheeecCCccCcccC
Confidence            36889999 999999999975 577899999999998



>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j2oa2 g.39.1.3 (A:31-63) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a1 g.39.1.3 (A:44-76) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4la2 g.39.1.3 (A:37-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure