Psyllid ID: psy15191


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310--
MKSEPGDVVNGEGGKVLYTLTNHKSKVMAVKWNGEGGKVLYTLTNHKSKVMAVKWVLNTSLDPEHKDLVSCSLDKTAILWKYVSEGNYLPYHMRDDSKQLHLLSCSMDKSIIVWAPDPTTGLWLETARVGEVGGNTLGFYGCKFGPRGDYIIAHGFQGSLHLDVTTWKQIQTLPCHQLTITQLAFSPDDTHLVSVSRDRRWGLYKRQSSGRLSLVACSDKTNGVHKRIIWGVAWSHDSRYFLTISRDGVCVVWGLGEPPTEEDLVQNTLWPEVQKLYGHGYEIYSLAASHDGTLLASACKATKPEHAAIIIW
cccccEEEEEcccccEEEEEEcccccEEEEEEEccccEEEEEEccccccEEEEEccccEEEcccccEEEEEEccccEEEEEcccccEEEccccccccccEEEEEEcccccEEEEEccccEEEEcccccEEEcccccccEEEEEEcccccEEEEEEcccEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEccccccccccccccEEEEEEcccccEEEEEEccccEEEcccccccccccccccccccEEEEEccccccEEEEEEcccccEEEEEEccccccccEEEEc
ccccEEEEEEcccccEEEEEcccccEEEEEEEEcccccEEEEEEcccccEEEEEEEEEEEEcccccEEEEEccccEEEEEEcccccccEEEEEEcccccEEEEEEcccccEEEEccccEEEEEEccccEEEEccccccEEEEEEcccccEEEEEccccEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEcccccccccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEccccccccEEEEEccccccEEEEEEcccccEEEEEcccccccccEEEEc
mksepgdvvngeggKVLYTLTNHKSKVMAVKWNGEGGKVLYTLTNHKSKVMAVKWVLntsldpehkdlvscsldKTAILWKYVsegnylpyhmrddskqlHLLSCSMdksiivwapdpttglwletarvgevggntlgfygckfgprgdyiiahgfqgslhldVTTWkqiqtlpchqltitqlafspddthlvsvsrdrrwglykrqssgrlslvacsdktngvHKRIIWGVAWSHDSRYFLTISRDGVCVvwglgeppteedlvqntlwpEVQKLYGHGYEIYSLAASHDGTLLASAckatkpehaaiiiw
mksepgdvvngegGKVLYTLTNHKSKVMAVKWNGEGGKVLYTLTNHKSKVMAVKWVLNTSLDPEHKDLVSCSLDKTAILWKYVSEGNYLPYHMRDDSKQLHLLSCSMDKSIIVWAPDPTTGLWLETARVGEVGGNTLGFYGCKFGPRGDYIIAHGFQGSLHLDVTTWKQIQTLPCHQLTITqlafspddthlvsvsrdrrwglykrqssgrlslvacsdktngvHKRIIWGVAWSHDSRYFLTISRDGVCVVWGLGEppteedlvqnTLWPEVQKLYGHGYEIYSLAASHDGTLLASACkatkpehaaiiiw
MKSEPGDVVNGEGGKVLYTLTNHKSKVMAVKWNGEGGKVLYTLTNHKSKVMAVKWVLNTSLDPEHKDLVSCSLDKTAILWKYVSEGNYLPYHMRDDSKQLHLLSCSMDKSIIVWAPDPTTGLWLETARVGEVGGNTLGFYGCKFGPRGDYIIAHGFQGSLHLDVTTWKQIQTLPCHQLTITQLAFSPDDTHLVSVSRDRRWGLYKRQSSGRLSLVACSDKTNGVHKRIIWGVAWSHDSRYFLTISRDGVCVVWGLGEPPTEEDLVQNTLWPEVQKLYGHGYEIYSLAASHDGTLLASACKATKPEHAAIIIW
************GGKVLYTLTNHKSKVMAVKWNGEGGKVLYTLTNHKSKVMAVKWVLNTSLDPEHKDLVSCSLDKTAILWKYVSEGNYLPYHMRDDSKQLHLLSCSMDKSIIVWAPDPTTGLWLETARVGEVGGNTLGFYGCKFGPRGDYIIAHGFQGSLHLDVTTWKQIQTLPCHQLTITQLAFSPDDTHLVSVSRDRRWGLYKRQSSGRLSLVACSDKTNGVHKRIIWGVAWSHDSRYFLTISRDGVCVVWGLGEPPTEEDLVQNTLWPEVQKLYGHGYEIYSLAASHDGTLLASACKATKPEHAAIII*
*KSEPGDVVNGEGGKVLYTLTNHKSKVMAVKWNGEGGKVLYTLTNHKSKVMAVKWVLNTSLDPEHKDLVSCSLDKTAILWKYVSEGNYLPYHMRDDSKQLHLLSCSMDKSIIVWAPDPTTGLWLETARVGEVGGNTLGFYGCKFGPRGDYIIAHGFQGSLHLDVTTWKQIQTLPCHQLTITQLAFSPDDTHLVSVSRDRRWGLYKRQSSGRLSLVACSDKTNGVHKRIIWGVAWSHDSRYFLTISRDGVCVVWGLGEPPTEEDLVQNTLWPEVQKLYGHGYEIYSLAASHDGTLLASACKATKPEHAAIIIW
********VNGEGGKVLYTLTNHKSKVMAVKWNGEGGKVLYTLTNHKSKVMAVKWVLNTSLDPEHKDLVSCSLDKTAILWKYVSEGNYLPYHMRDDSKQLHLLSCSMDKSIIVWAPDPTTGLWLETARVGEVGGNTLGFYGCKFGPRGDYIIAHGFQGSLHLDVTTWKQIQTLPCHQLTITQLAFSPDDTHLVSVSRDRRWGLYKRQSSGRLSLVACSDKTNGVHKRIIWGVAWSHDSRYFLTISRDGVCVVWGLGEPPTEEDLVQNTLWPEVQKLYGHGYEIYSLAASHDGTLLASACKATKPEHAAIIIW
*KSEPGDVVNGEGGKVLYTLTNHKSKVMAVKWNGEGGKVLYTLTNHKSKVMAVKWVLNTSLDPEHKDLVSCSLDKTAILWKYVSEGNYLPYHMRDDSKQLHLLSCSMDKSIIVWAPDPTTGLWLETARVGEVGGNTLGFYGCKFGPRGDYIIAHGFQGSLHLDVTTWKQIQTLPCHQLTITQLAFSPDDTHLVSVSRDRRWGLYKRQSSGRLSLVACSDKTNGVHKRIIWGVAWSHDSRYFLTISRDGVCVVWGLGEPPTEEDLVQNTLWPEVQKLYGHGYEIYSLAASHDGTLLASACKATKPEHAAIIIW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSEPGDVVNGEGGKVLYTLTNHKSKVMAVKWNGEGGKVLYTLTNHKSKVMAVKWVLNTSLDPEHKDLVSCSLDKTAILWKYVSEGNYLPYHMRDDSKQLHLLSCSMDKSIIVWAPDPTTGLWLETARVGEVGGNTLGFYGCKFGPRGDYIIAHGFQGSLHLDVTTWKQIQTLPCHQLTITQLAFSPDDTHLVSVSRDRRWGLYKRQSSGRLSLVACSDKTNGVHKRIIWGVAWSHDSRYFLTISRDGVCVVWGLGEPPTEEDLVQNTLWPEVQKLYGHGYEIYSLAASHDGTLLASACKATKPEHAAIIIW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query312 2.2.26 [Sep-21-2011]
Q7K4B3794 Probable elongator comple yes N/A 0.320 0.125 0.603 5e-27
Q05AM5 821 Elongator complex protein yes N/A 0.625 0.237 0.296 7e-23
Q5EBD9824 Elongator complex protein yes N/A 0.625 0.236 0.323 2e-22
Q496Z0821 Elongator complex protein yes N/A 0.288 0.109 0.541 7e-22
O94533 760 Elongator complex protein yes N/A 0.676 0.277 0.274 2e-21
Q6IA86826 Elongator complex protein no N/A 0.342 0.129 0.452 3e-21
Q91WG4 831 Elongator complex protein yes N/A 0.522 0.196 0.334 5e-21
Q86H45 901 Probable elongator comple yes N/A 0.342 0.118 0.385 8e-18
F4I1S7 838 Elongator complex protein yes N/A 0.333 0.124 0.357 2e-12
Q555631693 Uncharacterized WD repeat N/A N/A 0.746 0.137 0.279 3e-10
>sp|Q7K4B3|ELP2_DROME Probable elongator complex protein 2 OS=Drosophila melanogaster GN=Elp2 PE=1 SV=1 Back     alignment and function desciption
 Score =  122 bits (305), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 72/101 (71%), Gaps = 1/101 (0%)

Query: 165 TTWKQIQTLPCHQLTITQLAFSPDDTHLVSVSRDRRWGLYKRQ-SSGRLSLVACSDKTNG 223
           + WKQIQ L  HQLT+TQL+FSPD  +L+SVSRDRRW LY+RQ SS    LVA +DK+NG
Sbjct: 594 SNWKQIQKLSGHQLTVTQLSFSPDSRYLLSVSRDRRWCLYERQDSSVSYQLVASTDKSNG 653

Query: 224 VHKRIIWGVAWSHDSRYFLTISRDGVCVVWGLGEPPTEEDL 264
           VH RIIW   WSHD ++F+T SRDG  VVW   E   E  L
Sbjct: 654 VHTRIIWSCDWSHDGQFFVTSSRDGKVVVWKKEEDCKESSL 694




Acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation (By similarity). Involved in the regulation of the STAT pathway.
Drosophila melanogaster (taxid: 7227)
>sp|Q05AM5|ELP2_DANRE Elongator complex protein 2 OS=Danio rerio GN=elp2 PE=2 SV=1 Back     alignment and function description
>sp|Q5EBD9|ELP2_XENTR Elongator complex protein 2 OS=Xenopus tropicalis GN=elp2 PE=2 SV=1 Back     alignment and function description
>sp|Q496Z0|ELP2_RAT Elongator complex protein 2 OS=Rattus norvegicus GN=Elp2 PE=2 SV=1 Back     alignment and function description
>sp|O94533|ELP2_SCHPO Elongator complex protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=elp2 PE=3 SV=1 Back     alignment and function description
>sp|Q6IA86|ELP2_HUMAN Elongator complex protein 2 OS=Homo sapiens GN=ELP2 PE=1 SV=2 Back     alignment and function description
>sp|Q91WG4|ELP2_MOUSE Elongator complex protein 2 OS=Mus musculus GN=Elp2 PE=1 SV=1 Back     alignment and function description
>sp|Q86H45|ELP2_DICDI Probable elongator complex protein 2 OS=Dictyostelium discoideum GN=elp2 PE=3 SV=1 Back     alignment and function description
>sp|F4I1S7|ELP2_ARATH Elongator complex protein 2 OS=Arabidopsis thaliana GN=ELP2 PE=1 SV=1 Back     alignment and function description
>sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query312
270013922 748 hypothetical protein TcasGA2_TC012601 [T 0.689 0.287 0.389 2e-36
91090664 762 PREDICTED: similar to GA11261-PA [Tribol 0.689 0.282 0.389 2e-36
383862461 776 PREDICTED: probable elongator complex pr 0.711 0.286 0.357 5e-36
328766918 830 hypothetical protein BATDEDRAFT_36146 [B 0.689 0.259 0.363 1e-34
440791514 840 WD domain, G-beta repeat-containing prot 0.689 0.255 0.321 3e-31
170057336 785 elongator complex protein 2 [Culex quinq 0.730 0.290 0.325 1e-28
195153495 793 GL17299 [Drosophila persimilis] gi|19411 0.320 0.126 0.633 2e-27
125811095 793 GA11261 [Drosophila pseudoobscura pseudo 0.320 0.126 0.613 1e-26
194884205 793 GG20140 [Drosophila erecta] gi|190659373 0.320 0.126 0.603 8e-26
307203230 778 Probable elongator complex protein 2 [Ha 0.756 0.303 0.295 1e-25
>gi|270013922|gb|EFA10370.1| hypothetical protein TcasGA2_TC012601 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  159 bits (402), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 106/272 (38%), Positives = 134/272 (49%), Gaps = 57/272 (20%)

Query: 98  KQLHLLSCSMDKSIIVWAPDPTTGLWLETARVGEVGGNTLGFYGCKFGPRGDYIIAHGFQ 157
           K   LLS S+DKS+I+W  D +T LW E  RVGEVGGNTLGFYG  F P G  I+AHG+ 
Sbjct: 266 KSPQLLSSSLDKSMIIWEFDSSTNLWTEKVRVGEVGGNTLGFYGGVFSPDGHNILAHGYN 325

Query: 158 GSLHL---DVTTWKQIQTLPCHQLTITQ----------LAFSPDDTHLV----SVSRDRR 200
           G+ HL     + WK   T+  H   +T           L  S D T  +    S  +D  
Sbjct: 326 GAFHLWENASSGWKPCVTIGGHFAEVTDLAWDPQGEFLLTVSADQTTRIHAPWSDDKDAT 385

Query: 201 W-------------------GLYKRQSSGRLSLVACSDKTNGVHKR---------IIWGV 232
           W                     Y+  SS    ++   +      +          ++ G 
Sbjct: 386 WHEIARPQVHGYDLSSVAVLSRYRFASSAEEKVIRTFEAPRNFVENFARICKINDVVEGS 445

Query: 233 AWSHDSRYFLTISRDGVCVVWGLGE------------PPTEEDLVQNTLWPEVQKLYGHG 280
           A    +   L +S   V +  G G+            PPTEE L+QNTLWPEVQKLYGHG
Sbjct: 446 APKGAAVPSLGLSNKAVFLSEGGGDEESHFTEVVLTAPPTEETLLQNTLWPEVQKLYGHG 505

Query: 281 YEIYSLAASHDGTLLASACKATKPEHAAIIIW 312
           YE+YSLA+S DG  LASACKAT PEHAAI++W
Sbjct: 506 YEVYSLASSPDGRFLASACKATTPEHAAILLW 537




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91090664|ref|XP_974342.1| PREDICTED: similar to GA11261-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383862461|ref|XP_003706702.1| PREDICTED: probable elongator complex protein 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328766918|gb|EGF76970.1| hypothetical protein BATDEDRAFT_36146 [Batrachochytrium dendrobatidis JAM81] Back     alignment and taxonomy information
>gi|440791514|gb|ELR12752.1| WD domain, G-beta repeat-containing protein [Acanthamoeba castellanii str. Neff] Back     alignment and taxonomy information
>gi|170057336|ref|XP_001864439.1| elongator complex protein 2 [Culex quinquefasciatus] gi|167876761|gb|EDS40144.1| elongator complex protein 2 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195153495|ref|XP_002017661.1| GL17299 [Drosophila persimilis] gi|194113457|gb|EDW35500.1| GL17299 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|125811095|ref|XP_001361747.1| GA11261 [Drosophila pseudoobscura pseudoobscura] gi|54636923|gb|EAL26326.1| GA11261 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|194884205|ref|XP_001976186.1| GG20140 [Drosophila erecta] gi|190659373|gb|EDV56586.1| GG20140 [Drosophila erecta] Back     alignment and taxonomy information
>gi|307203230|gb|EFN82385.1| Probable elongator complex protein 2 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query312
UNIPROTKB|Q5EBD9824 elp2 "Elongator complex protei 0.400 0.151 0.419 7e-27
UNIPROTKB|E1BEP7827 ELP2 "Uncharacterized protein" 0.342 0.129 0.478 3.7e-26
UNIPROTKB|I3L616826 ELP2 "Uncharacterized protein" 0.342 0.129 0.469 4.7e-26
RGD|1306419821 Elp2 "elongator acetyltransfer 0.288 0.109 0.552 5.1e-25
MGI|MGI:1889642831 Elp2 "elongator acetyltransfer 0.285 0.107 0.515 6.4e-24
ZFIN|ZDB-GENE-060503-525 821 elp2 "elongation protein 2 hom 0.378 0.143 0.395 4.8e-45
UNIPROTKB|F1NMC6822 ELP2 "Uncharacterized protein" 0.342 0.130 0.464 2.8e-26
UNIPROTKB|Q6IA86826 ELP2 "Elongator complex protei 0.342 0.129 0.452 4.2e-25
FB|FBgn0033540794 Elp2 "Elongator complex protei 0.320 0.125 0.603 2.9e-33
DICTYBASE|DDB_G0275651 901 elp2 "elongation protein 2" [D 0.330 0.114 0.4 1.4e-37
UNIPROTKB|Q5EBD9 elp2 "Elongator complex protein 2" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
 Score = 258 (95.9 bits), Expect = 7.0e-27, Sum P(2) = 7.0e-27
 Identities = 55/131 (41%), Positives = 77/131 (58%)

Query:   165 TTWKQIQTLPCHQLTITQLAFSPDDTHLVSVSRDRRWGLYKRQ------SSGRLSLVACS 218
             T+WKQ+Q+L  H LT+TQ+AFSPDD  L+ VSRDR W L+K+Q      +    +L A +
Sbjct:   599 TSWKQLQSLSYHNLTVTQMAFSPDDEFLLVVSRDRNWSLWKKQEGIPEQTEPTFTLYAST 658

Query:   219 DKTNGVHKRIIWGVAWSHDSRYFLTISRDGVCVVWGLGEPPTEEDLVQNTLWPEVQKLYG 278
             DK + VH RIIW   W+ DS+YF+T SRD   +VWG    P+  +   + L      L  
Sbjct:   659 DKNSCVHSRIIWACDWTPDSKYFVTGSRDKKVIVWGDCSLPSMNEEKSSALIRPCSSLLD 718

Query:   279 HGYEIYSLAAS 289
              G  I +++ S
Sbjct:   719 TGDSITAVSVS 729


GO:0000502 "proteasome complex" evidence=ISS
GO:0006368 "transcription elongation from RNA polymerase II promoter" evidence=ISS
GO:0010950 "positive regulation of endopeptidase activity" evidence=ISS
GO:0043248 "proteasome assembly" evidence=ISS
GO:0061133 "endopeptidase activator activity" evidence=ISS
UNIPROTKB|E1BEP7 ELP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3L616 ELP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1306419 Elp2 "elongator acetyltransferase complex subunit 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1889642 Elp2 "elongator acetyltransferase complex subunit 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-525 elp2 "elongation protein 2 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMC6 ELP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q6IA86 ELP2 "Elongator complex protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0033540 Elp2 "Elongator complex protein 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0275651 elp2 "elongation protein 2" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-24
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-20
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 9e-20
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-13
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 8e-13
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 8e-11
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-10
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-05
smart0032040 smart00320, WD40, WD40 repeats 6e-05
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 9e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 5e-04
smart0032040 smart00320, WD40, WD40 repeats 8e-04
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 0.001
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 0.002
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 0.002
smart0032040 smart00320, WD40, WD40 repeats 0.003
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score = 99.7 bits (249), Expect = 2e-24
 Identities = 86/313 (27%), Positives = 115/313 (36%), Gaps = 70/313 (22%)

Query: 19  TLTNHKSKVMAVK-------------------WNGEGGKVLYTLTNHKSKVMAVKWVLNT 59
           TL  H   V  V                    W+ E G++L TL  H   V  V    + 
Sbjct: 4   TLKGHTGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADG 63

Query: 60  SLDPEHKDLVSCSLDKTAILWKYVSEGNYLPYHMRDDSKQLH----------LLSCSMDK 109
           +       L S S DKT  LW    E       +   +  +           L S S DK
Sbjct: 64  TY------LASGSSDKTIRLWDL--ETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDK 115

Query: 110 SIIVWAPDPTTGLWLETARVGEVGGNTLGFYGCKFGPRGDYIIAHGFQGSLHL-DVTTWK 168
           +I VW  D  TG       +  + G+T       F P G ++ +    G++ L D+ T K
Sbjct: 116 TIKVW--DVETGK-----CLTTLRGHTDWVNSVAFSPDGTFVASSSQDGTIKLWDLRTGK 168

Query: 169 QIQTLPCHQLTITQLAFSPDDTHLVSVSRD---RRWGLYKRQSSGRLSLVACSDKTNGVH 225
            + TL  H   +  +AFSPD   L+S S D   + W L   +  G L            H
Sbjct: 169 CVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTLR----------GH 218

Query: 226 KRIIWGVAWSHDSRYFLTISRDGVCVVWGLGEPPTEEDLVQNTLWPEVQKLYGHGYEIYS 285
           +  +  VA+S D     + S DG   VW         DL        VQ L GH   + S
Sbjct: 219 ENGVNSVAFSPDGYLLASGSEDGTIRVW---------DLRTGEC---VQTLSGHTNSVTS 266

Query: 286 LAASHDGTLLASA 298
           LA S DG  LAS 
Sbjct: 267 LAWSPDGKRLASG 279


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 312
KOG0271|consensus480 100.0
KOG0272|consensus459 100.0
KOG0271|consensus480 100.0
KOG0286|consensus343 100.0
KOG0279|consensus315 100.0
KOG0272|consensus459 100.0
KOG0263|consensus707 100.0
KOG0284|consensus464 100.0
KOG0286|consensus343 100.0
KOG0315|consensus311 100.0
KOG0295|consensus406 100.0
KOG0279|consensus315 100.0
KOG0315|consensus311 100.0
KOG0265|consensus338 100.0
KOG0273|consensus524 100.0
KOG0645|consensus312 100.0
KOG0296|consensus399 100.0
KOG0273|consensus524 100.0
KOG0263|consensus707 100.0
KOG0318|consensus603 100.0
KOG0285|consensus460 100.0
KOG0319|consensus 775 100.0
KOG0282|consensus503 100.0
KOG0291|consensus 893 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0295|consensus406 100.0
KOG0643|consensus327 100.0
KOG0318|consensus603 100.0
KOG0276|consensus 794 100.0
KOG0293|consensus519 100.0
KOG0319|consensus 775 100.0
KOG0278|consensus334 100.0
KOG0645|consensus312 100.0
KOG0285|consensus460 100.0
KOG0291|consensus 893 100.0
KOG0266|consensus456 100.0
KOG0281|consensus499 100.0
KOG0284|consensus 464 100.0
KOG0306|consensus 888 100.0
KOG0265|consensus338 100.0
KOG1407|consensus313 100.0
KOG0266|consensus456 100.0
KOG0275|consensus508 100.0
KOG0316|consensus307 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG1407|consensus313 100.0
KOG0306|consensus 888 100.0
KOG0289|consensus506 100.0
KOG0305|consensus484 100.0
KOG0283|consensus 712 99.98
KOG0313|consensus423 99.98
PLN00181793 protein SPA1-RELATED; Provisional 99.98
KOG0276|consensus 794 99.98
KOG0278|consensus334 99.97
KOG0277|consensus311 99.97
KOG0292|consensus 1202 99.97
KOG0316|consensus307 99.97
KOG0292|consensus 1202 99.97
KOG0281|consensus499 99.97
KOG0282|consensus503 99.97
KOG0268|consensus433 99.97
KOG0264|consensus422 99.97
KOG0288|consensus459 99.97
KOG2445|consensus361 99.97
PTZ00421 493 coronin; Provisional 99.97
KOG0274|consensus537 99.97
KOG0640|consensus430 99.97
KOG0277|consensus311 99.97
KOG0772|consensus 641 99.97
KOG0296|consensus399 99.97
KOG1539|consensus 910 99.97
KOG0313|consensus423 99.97
KOG1446|consensus311 99.97
KOG1446|consensus311 99.97
PTZ00420 568 coronin; Provisional 99.97
KOG2096|consensus420 99.97
KOG0293|consensus519 99.96
PTZ00421 493 coronin; Provisional 99.96
KOG1408|consensus 1080 99.96
KOG0643|consensus327 99.96
KOG0300|consensus481 99.96
KOG1332|consensus299 99.96
KOG0641|consensus350 99.96
KOG0294|consensus362 99.96
KOG0310|consensus 487 99.96
KOG0310|consensus 487 99.96
KOG1063|consensus 764 99.96
KOG1274|consensus 933 99.96
KOG0299|consensus479 99.96
KOG0641|consensus350 99.96
KOG4283|consensus397 99.96
KOG0973|consensus 942 99.96
KOG0973|consensus 942 99.95
KOG0640|consensus430 99.95
KOG0639|consensus705 99.95
KOG0288|consensus459 99.95
KOG0308|consensus 735 99.95
PTZ00420 568 coronin; Provisional 99.95
KOG0646|consensus 476 99.95
KOG0289|consensus506 99.95
KOG0299|consensus479 99.95
KOG1332|consensus299 99.95
KOG0308|consensus 735 99.95
KOG0301|consensus 745 99.95
KOG0283|consensus712 99.95
KOG0268|consensus 433 99.95
KOG0274|consensus537 99.94
KOG0269|consensus 839 99.94
KOG2055|consensus514 99.94
KOG2106|consensus626 99.94
KOG0301|consensus 745 99.94
KOG1036|consensus323 99.94
KOG0647|consensus347 99.94
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.94
KOG0639|consensus705 99.93
KOG2106|consensus 626 99.93
KOG0305|consensus484 99.93
KOG0294|consensus362 99.93
KOG0772|consensus 641 99.93
KOG0300|consensus481 99.92
KOG1036|consensus323 99.92
KOG0264|consensus422 99.92
KOG0302|consensus440 99.92
KOG0650|consensus733 99.92
KOG2048|consensus 691 99.92
KOG0269|consensus 839 99.92
KOG0646|consensus 476 99.92
KOG0267|consensus 825 99.91
KOG0275|consensus508 99.91
KOG2055|consensus514 99.91
KOG2445|consensus361 99.91
KOG0267|consensus 825 99.91
KOG1274|consensus 933 99.91
KOG0321|consensus 720 99.9
KOG1273|consensus405 99.9
KOG1063|consensus 764 99.9
KOG1408|consensus 1080 99.9
KOG4328|consensus498 99.9
KOG0647|consensus347 99.89
KOG1539|consensus 910 99.89
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.89
KOG2919|consensus406 99.89
KOG1007|consensus370 99.89
KOG4328|consensus498 99.88
KOG0270|consensus463 99.88
KOG0322|consensus323 99.88
KOG4378|consensus 673 99.88
KOG2096|consensus 420 99.88
KOG4283|consensus 397 99.88
KOG1273|consensus 405 99.88
KOG2919|consensus406 99.88
KOG1538|consensus 1081 99.87
KOG4378|consensus 673 99.87
KOG2048|consensus 691 99.87
KOG1188|consensus376 99.87
KOG0302|consensus440 99.87
KOG1587|consensus555 99.86
KOG1034|consensus385 99.86
KOG0321|consensus 720 99.86
KOG4227|consensus 609 99.86
KOG1009|consensus 434 99.84
KOG1445|consensus 1012 99.84
KOG0322|consensus323 99.84
KOG0642|consensus577 99.84
PRK11028330 6-phosphogluconolactonase; Provisional 99.83
KOG1517|consensus1387 99.83
KOG0270|consensus463 99.83
KOG0290|consensus364 99.83
KOG2110|consensus 391 99.82
KOG0307|consensus 1049 99.82
KOG1007|consensus370 99.81
KOG0307|consensus 1049 99.81
KOG1524|consensus 737 99.8
KOG0290|consensus364 99.8
KOG1963|consensus 792 99.8
KOG1538|consensus 1081 99.8
KOG0303|consensus 472 99.79
COG2319 466 FOG: WD40 repeat [General function prediction only 99.79
KOG1009|consensus 434 99.78
KOG0650|consensus733 99.78
KOG0771|consensus398 99.78
KOG0642|consensus577 99.78
KOG1523|consensus 361 99.78
KOG0649|consensus325 99.77
KOG1524|consensus 737 99.77
KOG1034|consensus 385 99.76
KOG1963|consensus 792 99.76
PRK01742429 tolB translocation protein TolB; Provisional 99.76
KOG1310|consensus 758 99.76
KOG1240|consensus1431 99.75
KOG2110|consensus391 99.75
KOG2394|consensus 636 99.74
KOG0303|consensus 472 99.74
PRK11028330 6-phosphogluconolactonase; Provisional 99.73
KOG1272|consensus 545 99.73
KOG1334|consensus 559 99.73
KOG1523|consensus361 99.73
COG2319466 FOG: WD40 repeat [General function prediction only 99.73
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.72
KOG1445|consensus 1012 99.72
KOG1517|consensus1387 99.72
KOG0771|consensus398 99.71
PRK01742429 tolB translocation protein TolB; Provisional 99.71
KOG2394|consensus 636 99.71
KOG0644|consensus 1113 99.7
KOG1188|consensus 376 99.7
KOG2111|consensus346 99.69
KOG1240|consensus1431 99.68
KOG1310|consensus 758 99.68
KOG1334|consensus559 99.67
PRK03629429 tolB translocation protein TolB; Provisional 99.67
KOG0649|consensus325 99.67
KOG4497|consensus447 99.67
KOG1587|consensus555 99.65
PRK04922433 tolB translocation protein TolB; Provisional 99.64
PRK02889427 tolB translocation protein TolB; Provisional 99.64
KOG2111|consensus346 99.64
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.63
KOG2321|consensus 703 99.63
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.61
KOG4497|consensus447 99.61
PRK03629429 tolB translocation protein TolB; Provisional 99.61
KOG2139|consensus445 99.61
KOG1272|consensus 545 99.61
KOG3881|consensus412 99.61
KOG2139|consensus 445 99.61
KOG0644|consensus 1113 99.61
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.6
KOG3881|consensus412 99.6
PRK05137435 tolB translocation protein TolB; Provisional 99.6
PRK02889427 tolB translocation protein TolB; Provisional 99.59
PRK04922433 tolB translocation protein TolB; Provisional 99.58
PRK05137435 tolB translocation protein TolB; Provisional 99.56
KOG4227|consensus 609 99.56
KOG1354|consensus433 99.52
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.51
KOG1409|consensus 404 99.5
KOG4547|consensus 541 99.5
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.49
KOG0974|consensus 967 99.48
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.48
PRK00178430 tolB translocation protein TolB; Provisional 99.48
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.47
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.45
KOG0974|consensus 967 99.45
PRK01029428 tolB translocation protein TolB; Provisional 99.45
KOG0280|consensus339 99.44
PRK04792448 tolB translocation protein TolB; Provisional 99.44
KOG2321|consensus 703 99.41
PRK01029428 tolB translocation protein TolB; Provisional 99.4
KOG4547|consensus 541 99.39
KOG2041|consensus 1189 99.39
PRK04792448 tolB translocation protein TolB; Provisional 99.39
PRK00178430 tolB translocation protein TolB; Provisional 99.38
KOG2315|consensus 566 99.35
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.33
KOG2315|consensus 566 99.33
KOG0280|consensus339 99.32
KOG4532|consensus344 99.31
KOG2314|consensus 698 99.31
KOG1354|consensus433 99.3
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.29
KOG1409|consensus404 99.29
KOG4190|consensus1034 99.26
KOG1064|consensus2439 99.22
COG4946 668 Uncharacterized protein related to the periplasmic 99.22
KOG1064|consensus2439 99.21
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.2
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.2
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.18
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 99.16
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.14
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.13
KOG3914|consensus 390 99.13
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.12
KOG3914|consensus390 99.11
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.1
KOG2066|consensus 846 99.1
PRK04043419 tolB translocation protein TolB; Provisional 99.1
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.09
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.08
KOG1275|consensus 1118 99.06
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.05
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 99.05
KOG2314|consensus 698 99.04
COG4946 668 Uncharacterized protein related to the periplasmic 99.03
PRK04043419 tolB translocation protein TolB; Provisional 99.03
KOG4190|consensus1034 99.01
KOG0882|consensus 558 99.01
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.99
KOG4532|consensus344 98.99
KOG4714|consensus319 98.93
KOG4714|consensus319 98.9
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.88
KOG2695|consensus425 98.87
KOG0309|consensus 1081 98.85
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.85
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.82
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.81
KOG2041|consensus 1189 98.81
KOG1912|consensus 1062 98.8
KOG1920|consensus 1265 98.8
KOG0309|consensus 1081 98.79
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.78
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.74
KOG2114|consensus 933 98.7
KOG1912|consensus 1062 98.67
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.66
KOG2695|consensus425 98.64
KOG2066|consensus 846 98.6
KOG0882|consensus 558 98.53
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.53
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.47
KOG1832|consensus 1516 98.47
PRK02888 635 nitrous-oxide reductase; Validated 98.42
PRK02888 635 nitrous-oxide reductase; Validated 98.42
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.41
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 98.31
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.3
KOG1008|consensus 783 98.28
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.26
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.24
KOG3617|consensus 1416 98.24
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.24
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.2
KOG1275|consensus 1118 98.19
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.16
KOG1920|consensus 1265 98.12
smart0032040 WD40 WD40 repeats. Note that these repeats are per 98.12
KOG4640|consensus 665 98.1
KOG1645|consensus463 98.07
KOG4640|consensus 665 98.06
KOG3621|consensus 726 98.04
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.03
KOG1645|consensus 463 98.01
KOG3621|consensus 726 98.01
KOG1008|consensus 783 98.01
KOG4649|consensus 354 98.0
KOG3617|consensus 1416 98.0
KOG2114|consensus 933 97.92
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.91
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.84
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.83
KOG1832|consensus 1516 97.79
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.79
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.68
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.68
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.64
COG3391381 Uncharacterized conserved protein [Function unknow 97.64
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.6
KOG4649|consensus 354 97.6
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.57
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.51
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.5
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.49
KOG4441|consensus571 97.48
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 97.45
KOG2395|consensus 644 97.39
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 97.37
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 97.36
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.33
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.33
PRK13616591 lipoprotein LpqB; Provisional 97.32
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.22
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.16
KOG2079|consensus 1206 97.15
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.15
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.13
PRK13616 591 lipoprotein LpqB; Provisional 97.12
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.1
PF02897 414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.09
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.07
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.02
KOG4499|consensus310 96.98
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 96.97
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.96
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 96.9
COG3490 366 Uncharacterized protein conserved in bacteria [Fun 96.9
COG3391381 Uncharacterized conserved protein [Function unknow 96.85
KOG2444|consensus238 96.82
KOG2395|consensus644 96.76
KOG4441|consensus571 96.74
PHA02713557 hypothetical protein; Provisional 96.7
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.69
PHA02713557 hypothetical protein; Provisional 96.67
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 96.65
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.62
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 96.62
PF14583 386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 96.6
KOG2079|consensus 1206 96.59
PF00780 275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.57
COG3490366 Uncharacterized protein conserved in bacteria [Fun 96.51
PF10647 253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.51
KOG2444|consensus238 96.45
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 96.43
KOG2377|consensus 657 96.31
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 96.23
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.21
PRK13684334 Ycf48-like protein; Provisional 96.2
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 96.17
PF05694 461 SBP56: 56kDa selenium binding protein (SBP56); Int 96.15
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 96.1
KOG3630|consensus 1405 96.07
COG3386307 Gluconolactonase [Carbohydrate transport and metab 95.84
KOG1916|consensus 1283 95.84
PLN00033398 photosystem II stability/assembly factor; Provisio 95.75
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 95.72
KOG1897|consensus 1096 95.56
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 95.54
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 95.52
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 95.5
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 95.41
PHA03098534 kelch-like protein; Provisional 95.33
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 95.27
PHA03098534 kelch-like protein; Provisional 95.24
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 95.08
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 95.05
KOG3630|consensus 1405 94.81
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 94.64
PF13449326 Phytase-like: Esterase-like activity of phytase 94.58
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 94.51
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 94.42
KOG4460|consensus 741 94.35
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 94.28
COG5167776 VID27 Protein involved in vacuole import and degra 94.16
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 93.86
PHA02790480 Kelch-like protein; Provisional 93.51
COG5167 776 VID27 Protein involved in vacuole import and degra 93.45
PF14727 418 PHTB1_N: PTHB1 N-terminus 93.4
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 93.36
KOG1900|consensus 1311 93.35
PF14655 415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 93.12
KOG4499|consensus310 93.01
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 92.83
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 92.8
COG3823262 Glutamine cyclotransferase [Posttranslational modi 92.76
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 92.49
KOG1916|consensus 1283 92.42
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 92.36
PRK10115 686 protease 2; Provisional 92.17
COG4590 733 ABC-type uncharacterized transport system, permeas 92.01
COG3823262 Glutamine cyclotransferase [Posttranslational modi 91.96
KOG2377|consensus 657 91.95
KOG2280|consensus 829 91.56
PRK13684334 Ycf48-like protein; Provisional 91.16
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 91.11
PF14727 418 PHTB1_N: PTHB1 N-terminus 90.83
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 90.74
PF13449 326 Phytase-like: Esterase-like activity of phytase 90.6
PHA02790480 Kelch-like protein; Provisional 90.51
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 90.47
PLN00033398 photosystem II stability/assembly factor; Provisio 90.01
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 89.92
KOG2247|consensus 615 89.35
KOG3616|consensus 1636 89.2
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 88.98
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 88.9
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 88.72
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 88.52
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 88.05
KOG4659|consensus 1899 87.98
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 87.98
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 87.46
PF14761 215 HPS3_N: Hermansky-Pudlak syndrome 3 87.35
COG5308 1263 NUP170 Nuclear pore complex subunit [Intracellular 87.28
TIGR02171 912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 86.4
COG4590 733 ABC-type uncharacterized transport system, permeas 85.92
PLN02153341 epithiospecifier protein 85.69
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 85.4
KOG1900|consensus 1311 85.23
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 84.96
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 83.66
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 83.52
TIGR03118 336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 82.52
KOG1520|consensus 376 82.2
PRK13615557 lipoprotein LpqB; Provisional 82.04
PLN02193470 nitrile-specifier protein 81.88
KOG3616|consensus 1636 81.57
KOG1520|consensus376 81.34
COG5276370 Uncharacterized conserved protein [Function unknow 81.16
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 80.56
PF11635 753 Med16: Mediator complex subunit 16; InterPro: IPR0 80.36
>KOG0271|consensus Back     alignment and domain information
Probab=100.00  E-value=1.1e-46  Score=285.47  Aligned_cols=270  Identities=25%  Similarity=0.387  Sum_probs=229.8

Q ss_pred             CceEeCCCCeEEEEeccCCCceEEEEEeCCC--------------------CceEEEEccccCcEEEEEEecCcCcCCCC
Q psy15191          6 GDVVNGEGGKVLYTLTNHKSKVMAVKWNGEG--------------------GKVLYTLTNHKSKVMAVKWVLNTSLDPEH   65 (312)
Q Consensus         6 ~~v~~~~~~~~~~~~~~h~~~v~~~~w~~~~--------------------~~~~~~~~~h~~~v~~~~~~~~~~~~~~~   65 (312)
                      -++|+..+-.+++++++|+.-|.|++|+|++                    .+..+.|.+|...|++++|.|- -+.+..
T Consensus       139 vR~WD~~TeTp~~t~KgH~~WVlcvawsPDgk~iASG~~dg~I~lwdpktg~~~g~~l~gH~K~It~Lawep~-hl~p~~  217 (480)
T KOG0271|consen  139 VRLWDLDTETPLFTCKGHKNWVLCVAWSPDGKKIASGSKDGSIRLWDPKTGQQIGRALRGHKKWITALAWEPL-HLVPPC  217 (480)
T ss_pred             EEeeccCCCCcceeecCCccEEEEEEECCCcchhhccccCCeEEEecCCCCCcccccccCcccceeEEeeccc-ccCCCc
Confidence            4789999999999999999999999988765                    2345678999999999999884 455667


Q ss_pred             ceEEEecCCCcEEEeeecCCccc--------ccccccCCCCCceEEEEeCCCcEEEEcCCCCcceeeeeeeecccCCCcc
Q psy15191         66 KDLVSCSLDKTAILWKYVSEGNY--------LPYHMRDDSKQLHLLSCSMDKSIIVWAPDPTTGLWLETARVGEVGGNTL  137 (312)
Q Consensus        66 ~~l~s~~~dg~i~vw~~~~~~~~--------~~~~~~~~~~~~~l~~~~~d~~i~i~d~~~~~~~~~~~~~~~~~~~~~~  137 (312)
                      ++||+++.||.|+|||+..+.+.        .+.+..+..++ ++++++.|++|++|+...  +.+...     +.+|..
T Consensus       218 r~las~skDg~vrIWd~~~~~~~~~lsgHT~~VTCvrwGG~g-liySgS~DrtIkvw~a~d--G~~~r~-----lkGHah  289 (480)
T KOG0271|consen  218 RRLASSSKDGSVRIWDTKLGTCVRTLSGHTASVTCVRWGGEG-LIYSGSQDRTIKVWRALD--GKLCRE-----LKGHAH  289 (480)
T ss_pred             cceecccCCCCEEEEEccCceEEEEeccCccceEEEEEcCCc-eEEecCCCceEEEEEccc--hhHHHh-----hcccch
Confidence            89999999999999999887663        44555555443 899999999999999887  333333     347877


Q ss_pred             ceeEEEEC-----------CCCC-------------------------eEEEeecCCeEEEecccCceee------eecc
Q psy15191        138 GFYGCKFG-----------PRGD-------------------------YIIAHGFQGSLHLDVTTWKQIQ------TLPC  175 (312)
Q Consensus       138 ~v~~~~~~-----------~~~~-------------------------~l~~~~~~~~i~~d~~~~~~~~------~~~~  175 (312)
                      .|+.++.+           |.++                         .|++|++|..+.+    |+...      ...+
T Consensus       290 wvN~lalsTdy~LRtgaf~~t~~~~~~~se~~~~Al~rY~~~~~~~~erlVSgsDd~tlfl----W~p~~~kkpi~rmtg  365 (480)
T KOG0271|consen  290 WVNHLALSTDYVLRTGAFDHTGRKPKSFSEEQKKALERYEAVLKDSGERLVSGSDDFTLFL----WNPFKSKKPITRMTG  365 (480)
T ss_pred             heeeeeccchhhhhccccccccccCCChHHHHHHHHHHHHHhhccCcceeEEecCCceEEE----ecccccccchhhhhc
Confidence            78777766           3333                         4999999999999    65544      4559


Q ss_pred             cCCceeEEEECCCCCEEEEEecCCeEEEEEccCCCeEEEEeccCCCCcccceeeEEEEEcCCCceEEEeccCCeEEEEec
Q psy15191        176 HQLTITQLAFSPDDTHLVSVSRDRRWGLYKRQSSGRLSLVACSDKTNGVHKRIIWGVAWSHDSRYFLTISRDGVCVVWGL  255 (312)
Q Consensus       176 ~~~~v~~~~~~~~~~~l~~~~~d~~i~~wd~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~dg~i~iwd~  255 (312)
                      |..-|+.+.|+||++++++++.|..|++||.++++.+..+++       |-..|+.++|+.|.++|++|+.|.++++||+
T Consensus       366 Hq~lVn~V~fSPd~r~IASaSFDkSVkLW~g~tGk~lasfRG-------Hv~~VYqvawsaDsRLlVS~SkDsTLKvw~V  438 (480)
T KOG0271|consen  366 HQALVNHVSFSPDGRYIASASFDKSVKLWDGRTGKFLASFRG-------HVAAVYQVAWSADSRLLVSGSKDSTLKVWDV  438 (480)
T ss_pred             hhhheeeEEECCCccEEEEeecccceeeeeCCCcchhhhhhh-------ccceeEEEEeccCccEEEEcCCCceEEEEEe
Confidence            999999999999999999999999999999999999999888       9999999999999999999999999999999


Q ss_pred             CCCCCCcccccccccceeEEeeccCcceeEEEeccCCCeEEEEecCCCcccceEEeC
Q psy15191        256 GEPPTEEDLVQNTLWPEVQKLYGHGYEIYSLAASHDGTLLASACKATKPEHAAIIIW  312 (312)
Q Consensus       256 ~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~s~~~~~l~s~s~d~~~~dg~i~iW  312 (312)
                      ++.+            ....+.||...|.++.|+|||..+++|+.     |..+++|
T Consensus       439 ~tkK------------l~~DLpGh~DEVf~vDwspDG~rV~sggk-----dkv~~lw  478 (480)
T KOG0271|consen  439 RTKK------------LKQDLPGHADEVFAVDWSPDGQRVASGGK-----DKVLRLW  478 (480)
T ss_pred             eeee------------ecccCCCCCceEEEEEecCCCceeecCCC-----ceEEEee
Confidence            8874            67788999999999999999999999954     5559999



>KOG0272|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>COG5308 NUP170 Nuclear pore complex subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>PRK13615 lipoprotein LpqB; Provisional Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF11635 Med16: Mediator complex subunit 16; InterPro: IPR021665 Mediator is a large complex of up to 33 proteins that is conserved from plants through fungi to humans - the number and representation of individual subunits varying with species [],[] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
2ymu_A 577 Structure Of A Highly Repetitive Propeller Structur 2e-15
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 8e-07
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 8e-07
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 8e-07
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 8e-07
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 8e-07
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 1e-06
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 2e-06
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 1e-05
2gnq_A336 Structure Of Wdr5 Length = 336 1e-05
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 1e-05
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 1e-05
2g99_A308 Structural Basis For The Specific Recognition Of Me 2e-05
2h9l_A329 Wdr5delta23 Length = 329 2e-05
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 2e-05
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 2e-05
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 2e-05
2g9a_A311 Structural Basis For The Specific Recognition Of Me 2e-05
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 2e-05
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 2e-05
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 2e-05
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 2e-05
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 2e-05
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 4e-05
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 8e-04
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 7e-05
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure

Iteration: 1

Score = 79.7 bits (195), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 85/339 (25%), Positives = 130/339 (38%), Gaps = 75/339 (22%) Query: 14 GKVLYTLTNHKSKVMAVKWNGEG------------------GKVLYTLTNHKSKVMAVKW 55 G++L TLT H S V V ++ +G G++L TLT H S V V Sbjct: 47 GQLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGV-- 104 Query: 56 VLNTSLDPEHKDLVSCSLDKTAILWKYVSEGNYLPYHMRDDSKQLHLLSCSMDKSIIVWA 115 + P+ + + S S DKT LW + L + S + ++ S D I A Sbjct: 105 ----AFSPDGQTIASASDDKTVKLWNRNGQ---LLQTLTGHSSSVWGVAFSPDGQTIASA 157 Query: 116 PD-PTTGLWLETARVGE-VGGNTLGFYGCKFGPRGDYIIAHGFQGSLHLDVTTWKQIQTL 173 D T LW ++ + + G++ +G F P G I + ++ L + +QTL Sbjct: 158 SDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTL 217 Query: 174 PCHQLTITQLAFSPDDTHLVSVSRDRRWGLYKRQSSGRLSLVACSDKTNGV--------- 224 H ++ +AFSPD + S S D+ L+ R +L S NGV Sbjct: 218 TGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVNGVAFRPDGQTI 277 Query: 225 ------------------------HKRIIWGVAWSHDSRYFLTISRDGVCVVWGLGEPPT 260 H +WGVA+S D + + S D +W Sbjct: 278 ASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLW------- 330 Query: 261 EEDLVQNTLWPEVQKLYGHGYEIYSLAASHDGTLLASAC 299 N +Q L GH ++ +A S DG +ASA Sbjct: 331 ------NRNGQHLQTLTGHSSSVWGVAFSPDGQTIASAS 363
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query312
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 100.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.98
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.98
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.97
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.97
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.97
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.97
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.96
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.96
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.96
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.96
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.96
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.95
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.95
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.95
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.94
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.94
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.93
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.93
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.92
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.92
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.91
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.91
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.91
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.91
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.91
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.91
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.91
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.9
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.9
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.9
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.89
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.89
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.89
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.89
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.89
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.88
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.88
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.87
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.87
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.86
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.86
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.85
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.85
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.85
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.83
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.83
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.82
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.82
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.81
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.81
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.8
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.8
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.77
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.76
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.75
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.75
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.73
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.73
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.73
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.72
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.72
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.71
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.71
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.68
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.67
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.66
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.66
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.63
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.63
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.62
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.62
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.61
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.6
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.6
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.6
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.59
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.58
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.57
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.57
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.54
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.53
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.51
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.51
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.5
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.49
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.49
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.49
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.49
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.48
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.47
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.42
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.42
2qe8_A343 Uncharacterized protein; structural genomics, join 99.41
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.41
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.4
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.4
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.39
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.37
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.35
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.31
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.3
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.3
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.21
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.2
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 99.2
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.18
2ece_A462 462AA long hypothetical selenium-binding protein; 99.15
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.15
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 99.08
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 99.07
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.07
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.07
2ece_A 462 462AA long hypothetical selenium-binding protein; 99.05
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.04
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 99.03
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.02
2qe8_A343 Uncharacterized protein; structural genomics, join 99.01
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 99.0
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 99.0
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.93
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.93
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.88
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.87
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.86
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.85
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.84
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.83
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.82
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.81
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.78
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.77
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.74
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.73
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.72
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.64
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.62
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.6
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.56
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.56
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.52
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.5
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.48
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.47
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.46
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.43
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.39
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.36
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.28
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 98.23
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.19
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.18
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.13
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.12
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.09
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.03
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.95
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.92
3v65_B386 Low-density lipoprotein receptor-related protein; 97.91
3v9f_A 781 Two-component system sensor histidine kinase/RESP 97.89
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.89
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.87
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 97.86
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.84
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.83
3v65_B386 Low-density lipoprotein receptor-related protein; 97.82
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 97.77
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.77
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.74
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.64
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.63
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.6
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.56
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.55
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.54
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.54
3kya_A 496 Putative phosphatase; structural genomics, joint c 97.53
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.48
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 97.48
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.43
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.42
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 97.42
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.38
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.37
3kya_A496 Putative phosphatase; structural genomics, joint c 97.36
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.35
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.33
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 97.32
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.26
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.25
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.19
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.18
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 97.16
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 97.16
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.15
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.13
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.11
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.08
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 96.98
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 96.9
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 96.87
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 96.83
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.6
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 96.45
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 96.45
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 96.42
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 96.37
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 96.06
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 96.04
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 96.0
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 95.81
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 95.46
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 95.38
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 95.13
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 95.07
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 94.95
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 94.87
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 94.87
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 94.56
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 94.44
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 94.09
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 93.88
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 93.57
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 93.24
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 91.63
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 91.62
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 91.24
3ott_A 758 Two-component system sensor histidine kinase; beta 90.67
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 90.64
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 89.61
3b7f_A 394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 89.38
3b7f_A 394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 87.7
2be1_A 339 Serine/threonine-protein kinase/endoribonuclease; 87.21
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 85.89
1sqj_A 789 OXG-RCBH, oligoxyloglucan reducing-END-specific ce 84.49
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 83.62
3ott_A 758 Two-component system sensor histidine kinase; beta 83.08
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 83.0
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 82.11
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 82.05
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 80.95
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=4e-45  Score=295.28  Aligned_cols=263  Identities=20%  Similarity=0.334  Sum_probs=227.0

Q ss_pred             CCeEEEEeccCCCceEEEEEeCCC-----------------------C--ceEEEEccccCcEEEEEEecCcCcCCCCce
Q psy15191         13 GGKVLYTLTNHKSKVMAVKWNGEG-----------------------G--KVLYTLTNHKSKVMAVKWVLNTSLDPEHKD   67 (312)
Q Consensus        13 ~~~~~~~~~~h~~~v~~~~w~~~~-----------------------~--~~~~~~~~h~~~v~~~~~~~~~~~~~~~~~   67 (312)
                      .|..+..+.+|.+.|++++|+++.                       +  .....+.+|...|.+++|+++      +.+
T Consensus        21 ~g~~~~~~~~H~~~V~~v~~~~~~~~~~~~l~tgs~D~~v~vW~~~~~~~~~~~~l~gh~~~v~~~~~~~~------~~~   94 (321)
T 3ow8_A           21 YGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSVDISHT------LPI   94 (321)
T ss_dssp             CEEEEEETTSSSSCEEEEEEC-------CEEEEEETTSCEEEEEEETTEEEEEEEECCCSSCEEEEEECSS------SSE
T ss_pred             hhheeeecccCCCcEEEEEEecCCCCCCCEEEEEcCCCCEEEEECCCCCeeeeeeeccCCCCEEEEEECCC------CCE
Confidence            456667788999999999987631                       1  123467899999999999999      899


Q ss_pred             EEEecCCCcEEEeeecCCccc--------ccccccCCCCCceEEEEeCCCcEEEEcCCCCcceeeeeeeecccCCCccce
Q psy15191         68 LVSCSLDKTAILWKYVSEGNY--------LPYHMRDDSKQLHLLSCSMDKSIIVWAPDPTTGLWLETARVGEVGGNTLGF  139 (312)
Q Consensus        68 l~s~~~dg~i~vw~~~~~~~~--------~~~~~~~~~~~~~l~~~~~d~~i~i~d~~~~~~~~~~~~~~~~~~~~~~~v  139 (312)
                      +++++.|++|++||+.+++..        .+....+++++.+|++++.|+.|++|++++.+..  ...     ..+...+
T Consensus        95 l~s~s~D~~i~lWd~~~~~~~~~~~~~~~~~~~~~~spdg~~l~~g~~dg~v~i~~~~~~~~~--~~~-----~~~~~~v  167 (321)
T 3ow8_A           95 AASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKE--YSL-----DTRGKFI  167 (321)
T ss_dssp             EEEEETTSEEEEEETTTTEEEEEEECCTTCCCCEEECTTSSEEEEECTTSEEEEEETTTCSEE--EEE-----ECSSSCE
T ss_pred             EEEEeCCCcEEEEECCCCCEEEEEeCCCccEEEEEECCCCCEEEEEcCCCcEEEEEcCCCcee--EEe-----cCCCceE
Confidence            999999999999999887652        3344566888999999999999999999885432  222     2566789


Q ss_pred             eEEEECCCCCeEEEeecCCeEEE-ecccCceeeeecccCCceeEEEECCCCCEEEEEecCCeEEEEEccCCCeEEEEecc
Q psy15191        140 YGCKFGPRGDYIIAHGFQGSLHL-DVTTWKQIQTLPCHQLTITQLAFSPDDTHLVSVSRDRRWGLYKRQSSGRLSLVACS  218 (312)
Q Consensus       140 ~~~~~~~~~~~l~~~~~~~~i~~-d~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~d~~i~~wd~~~~~~~~~~~~~  218 (312)
                      .+++|+|++++|++++.|+.|++ |+++.+....+.+|...|.+++|+|++++|++++.|+.|++||+++.+....+.. 
T Consensus       168 ~~~~~spdg~~lasg~~dg~i~iwd~~~~~~~~~~~~h~~~v~~l~~spd~~~l~s~s~dg~i~iwd~~~~~~~~~~~~-  246 (321)
T 3ow8_A          168 LSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSG-  246 (321)
T ss_dssp             EEEEECTTSSEEEEEETTSCEEEEETTTTEEEEEECCCSSCCCEEEECTTSCEEEEECTTSCEEEEETTTCCEEEEECC-
T ss_pred             EEEEECCCCCEEEEEcCCCeEEEEECCCCcEEEEEcccCCceeEEEEcCCCCEEEEEcCCCeEEEEECCCcceeEEEcC-
Confidence            99999999999999999999999 8888888888999999999999999999999999999999999998887776665 


Q ss_pred             CCCCcccceeeEEEEEcCCCceEEEeccCCeEEEEecCCCCCCcccccccccceeEEeeccCcceeEEEeccCCCeEEEE
Q psy15191        219 DKTNGVHKRIIWGVAWSHDSRYFLTISRDGVCVVWGLGEPPTEEDLVQNTLWPEVQKLYGHGYEIYSLAASHDGTLLASA  298 (312)
Q Consensus       219 ~~~~~~~~~~v~~~~~~~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~s~~~~~l~s~  298 (312)
                            |...|.+++|+|++++|++++.|+.|++||+.++.            ++..+.+|...|.+++|+|++++|+++
T Consensus       247 ------h~~~v~~~~~sp~~~~l~s~s~D~~v~iwd~~~~~------------~~~~~~~h~~~v~~v~~s~~g~~l~s~  308 (321)
T 3ow8_A          247 ------HASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRT------------CVHTFFDHQDQVWGVKYNGNGSKIVSV  308 (321)
T ss_dssp             ------CSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTE------------EEEEECCCSSCEEEEEECTTSSEEEEE
T ss_pred             ------CCCceEEEEECCCCCEEEEEeCCCcEEEEeCCCCE------------EEEEEcCCCCcEEEEEECCCCCEEEEE
Confidence                  88889999999999999999999999999998763            778889999999999999999999999


Q ss_pred             ecCCCcccceEEeC
Q psy15191        299 CKATKPEHAAIIIW  312 (312)
Q Consensus       299 s~d~~~~dg~i~iW  312 (312)
                      +.|+.     |+||
T Consensus       309 ~~d~~-----i~vw  317 (321)
T 3ow8_A          309 GDDQE-----IHIY  317 (321)
T ss_dssp             ETTCC-----EEEE
T ss_pred             eCCCe-----EEEE
Confidence            65555     9998



>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1sqj_A OXG-RCBH, oligoxyloglucan reducing-END-specific cellobiohydrolase; beta-propeller; 2.20A {Geotrichum SP} SCOP: b.69.13.1 b.69.13.1 PDB: 2ebs_A* Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 312
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 5e-17
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 5e-11
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-10
d1tbga_ 340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 7e-05
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 5e-15
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 5e-13
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-12
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-11
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 0.003
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-10
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-09
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-06
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 4e-06
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-09
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-07
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-05
d1gxra_ 337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 6e-04
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 3e-08
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 9e-06
d1hzua2 426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 9e-08
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 2e-07
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 6e-07
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-07
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 7e-06
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 5e-05
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-06
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-06
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-05
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-05
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-04
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-05
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 3e-05
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 4e-05
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 1e-04
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-04
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 5e-04
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.003
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 5e-04
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 0.003
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.004
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 78.2 bits (191), Expect = 5e-17
 Identities = 43/305 (14%), Positives = 77/305 (25%), Gaps = 39/305 (12%)

Query: 15  KVLYTLTNHKSKVMAVKWNGEG-------------------GKVLYTLTNHKSKVMAVKW 55
           +   TL  H +K+ A+ W  +                       ++ +    S VM   +
Sbjct: 46  RTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAY 105

Query: 56  VLNTSLDPEHKDLVSCSLDKTAILWKYVSEGNYLPYHMRDDSKQLHLLSCSMDKSIIVWA 115
             + +          CS     +  +  +                               
Sbjct: 106 APSGNYVACGGLDNICS--IYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGD 163

Query: 116 PDPTTGLWLETARVGEVGGNTLGFYGCKFGPRGDYIIAHGFQGSLHL-DVTTWKQIQTLP 174
                       +     G+T         P     ++     S  L DV      QT  
Sbjct: 164 TTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFT 223

Query: 175 CHQLTITQLAFSPDDTHLVSVSRDRRWGLYKRQSSGRLSLVACSDKTNGVHKRIIWGVAW 234
            H+  I  + F P+     + S D    L+  ++            ++      I  V++
Sbjct: 224 GHESDINAICFFPNGNAFATGSDDATCRLFDLRADQE-----LMTYSHDNIICGITSVSF 278

Query: 235 SHDSRYFLTISRDGVCVVWGLGEPPTEEDLVQNTLWPEVQKLYGHGYEIYSLAASHDGTL 294
           S   R  L    D  C VW   +                  L GH   +  L  + DG  
Sbjct: 279 SKSGRLLLAGYDDFNCNVWDALK------------ADRAGVLAGHDNRVSCLGVTDDGMA 326

Query: 295 LASAC 299
           +A+  
Sbjct: 327 VATGS 331


>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query312
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.97
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.97
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.97
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.96
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.95
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.94
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.94
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.93
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.91
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.9
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.89
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.86
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.86
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.86
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.84
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.84
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.83
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.78
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.77
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.73
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.71
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.7
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.67
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.61
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.57
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.54
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.44
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.43
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.34
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.31
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.3
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.27
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.26
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.25
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.16
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.08
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.05
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.03
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.94
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.94
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.91
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.85
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.82
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.76
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.61
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.54
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.35
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 97.92
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.89
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.82
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.78
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.65
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.0
d1qfma1 430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 96.56
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 96.31
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 96.19
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 96.15
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 96.08
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 95.65
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 95.59
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 95.55
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 95.53
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 95.33
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 95.29
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 95.2
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 94.63
d1qfma1 430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 94.56
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 94.32
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.06
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 93.69
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 92.78
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 92.55
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 92.39
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 92.35
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 92.04
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 91.84
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 91.33
d1wp5a_323 Topoisomerase IV subunit A, ParC, C-terminal domai 88.47
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 87.68
d1tl2a_235 Tachylectin-2 {Japanese horseshoe crab (Tachypleus 87.64
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 87.44
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 85.79
d1w6sa_ 596 Methanol dehydrogenase, heavy chain {Methylobacter 85.18
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 83.56
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 82.91
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Actin interacting protein 1
species: Nematode (Caenorhabditis elegans) [TaxId: 6239]
Probab=100.00  E-value=2.2e-40  Score=264.50  Aligned_cols=271  Identities=15%  Similarity=0.160  Sum_probs=219.9

Q ss_pred             eEeCCCCeEEEEeccCCCceEEEEEeCCCCceEEEEccccCcEEEEEEecCcCcCCCCceEEEecCCCcEEEeeecCCcc
Q psy15191          8 VVNGEGGKVLYTLTNHKSKVMAVKWNGEGGKVLYTLTNHKSKVMAVKWVLNTSLDPEHKDLVSCSLDKTAILWKYVSEGN   87 (312)
Q Consensus         8 v~~~~~~~~~~~~~~h~~~v~~~~w~~~~~~~~~~~~~h~~~v~~~~~~~~~~~~~~~~~l~s~~~dg~i~vw~~~~~~~   87 (312)
                      +.....|+.+....++.  |  +.|+.++++....+.+|...|++++|+|+      |++||+|+.||+|+|||+.....
T Consensus        23 ~a~~~~g~~l~~~~~~~--v--~i~~~~~~~~~~~~~~H~~~v~~~~~sp~------g~~latg~~dg~i~iwd~~~~~~   92 (311)
T d1nr0a1          23 LGNTPAGDKIQYCNGTS--V--YTVPVGSLTDTEIYTEHSHQTTVAKTSPS------GYYCASGDVHGNVRIWDTTQTTH   92 (311)
T ss_dssp             CEECTTSSEEEEEETTE--E--EEEETTCSSCCEEECCCSSCEEEEEECTT------SSEEEEEETTSEEEEEESSSTTC
T ss_pred             EEEcCCCCEEEEEeCCE--E--EEEECCCCceeEEEcCCCCCEEEEEEeCC------CCeEeccccCceEeeeeeecccc
Confidence            34445666666555443  2  34999999999999999999999999999      99999999999999999988754


Q ss_pred             c----------ccccccCCCCCceEEEEeC--CCcEEEEcCCCCcceeeeeeeecccCCCccceeEEEECCCCCe-EEEe
Q psy15191         88 Y----------LPYHMRDDSKQLHLLSCSM--DKSIIVWAPDPTTGLWLETARVGEVGGNTLGFYGCKFGPRGDY-IIAH  154 (312)
Q Consensus        88 ~----------~~~~~~~~~~~~~l~~~~~--d~~i~i~d~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~-l~~~  154 (312)
                      .          .+..+.+++++.++++++.  +..+++|++++.+..       ..+.+|...|.+++|+|++++ +++|
T Consensus        93 ~~~~~~~~~~~~v~~v~~s~d~~~l~~~~~~~~~~~~v~~~~~~~~~-------~~l~~h~~~v~~v~~~~~~~~~l~sg  165 (311)
T d1nr0a1          93 ILKTTIPVFSGPVKDISWDSESKRIAAVGEGRERFGHVFLFDTGTSN-------GNLTGQARAMNSVDFKPSRPFRIISG  165 (311)
T ss_dssp             CEEEEEECSSSCEEEEEECTTSCEEEEEECCSSCSEEEEETTTCCBC-------BCCCCCSSCEEEEEECSSSSCEEEEE
T ss_pred             ccccccccccCcccccccccccccccccccccccccccccccccccc-------ccccccccccccccccccceeeeccc
Confidence            1          3344556788888988876  456999999874422       233578889999999999886 7789


Q ss_pred             ecCCeEEE-ecccCceeeeecccCCceeEEEECCCCCEEEEEecCCeEEEEEccCCCeEEEEeccCCCCcccceeeEEEE
Q psy15191        155 GFQGSLHL-DVTTWKQIQTLPCHQLTITQLAFSPDDTHLVSVSRDRRWGLYKRQSSGRLSLVACSDKTNGVHKRIIWGVA  233 (312)
Q Consensus       155 ~~~~~i~~-d~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~d~~i~~wd~~~~~~~~~~~~~~~~~~~~~~~v~~~~  233 (312)
                      +.|+.|++ |.++.+.......|...|.++.|+|++++|++++.|+.|++||+.+......+.........|...|++++
T Consensus       166 s~d~~i~i~d~~~~~~~~~~~~~~~~i~~v~~~p~~~~l~~~~~d~~v~~~d~~~~~~~~~~~~~~~~~~~h~~~V~~~~  245 (311)
T d1nr0a1         166 SDDNTVAIFEGPPFKFKSTFGEHTKFVHSVRYNPDGSLFASTGGDGTIVLYNGVDGTKTGVFEDDSLKNVAHSGSVFGLT  245 (311)
T ss_dssp             ETTSCEEEEETTTBEEEEEECCCSSCEEEEEECTTSSEEEEEETTSCEEEEETTTCCEEEECBCTTSSSCSSSSCEEEEE
T ss_pred             ccccccccccccccccccccccccccccccccCccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            99999999 88888888888899999999999999999999999999999999998888777665555555889999999


Q ss_pred             EcCCCceEEEeccCCeEEEEecCCCCCCcccccccccceeEEeeccCc-ceeEEEeccCCCeEEEEecCCCcccceEEeC
Q psy15191        234 WSHDSRYFLTISRDGVCVVWGLGEPPTEEDLVQNTLWPEVQKLYGHGY-EIYSLAASHDGTLLASACKATKPEHAAIIIW  312 (312)
Q Consensus       234 ~~~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~-~v~~~~~s~~~~~l~s~s~d~~~~dg~i~iW  312 (312)
                      |+|++++|++|+.||.|+|||++++.            ++..+..|.. ....+.+.+++++|++++.||.     |++|
T Consensus       246 ~s~~~~~l~tgs~Dg~v~iwd~~t~~------------~~~~l~~~~~~~~~~~~~~~~~~~l~s~s~dG~-----i~~w  308 (311)
T d1nr0a1         246 WSPDGTKIASASADKTIKIWNVATLK------------VEKTIPVGTRIEDQQLGIIWTKQALVSISANGF-----INFV  308 (311)
T ss_dssp             ECTTSSEEEEEETTSEEEEEETTTTE------------EEEEEECCSSGGGCEEEEEECSSCEEEEETTCC-----EEEE
T ss_pred             cCCCCCEEEEEeCCCeEEEEECCCCc------------EEEEEECCCCccceEEEEEecCCEEEEEECCCE-----EEEE
Confidence            99999999999999999999998763            5666765543 2333445556678999965555     9998



>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1wp5a_ b.68.10.1 (A:) Topoisomerase IV subunit A, ParC, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1tl2a_ b.67.1.1 (A:) Tachylectin-2 {Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure