Psyllid ID: psy15216


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------1610------1620------1630------1640------1650------1660------1670------1680------1690------1700------1710------1720------1730------1740------1750------1760------1770------1780------1790------1800------1810------1820------1830------1840------1850------1860------1870------1880------1890------1900------1910------1920------1930------1940------1950------1960------1970------1980------1990------2000------2010------2020------2030------2040------2050------2060------2070------2080------2090------2100------2110------2120------2130------2140------2150------2160------2170------2180------2190------2200------2210------2220------2230------2240------2250------2260------2270------2280------2290------2300------2310------2320------2330------2340------2350------2360------2370------2380------2390------2400------2410------2420------2430------2440------2450------2460------2470------2480------2490------2500------2510------2520------2530------2540------2550------2560------2570------2580------2590------2600--
MDYSATTPIDPRVVDKMIPYLRVQFGNPASRNHIYGWTAEKAIEKARNEVAQLIYADPREIIWTSGATESNNLAIKGAAHFYKKRGKHIITVQTEHKSVLDSIRKLENDGFRVTYLKPKNNGLITLSQLEEKICSDTILVSVMLVNNEIGVIQPILEIGELCRSKGVIFHCDAAQAVGKIDINIQNYKVDLMSFSAHKIYGPKGIGALYIRRNPRTRIEAQIHGGGHEYGLRSGTLATHQIVGMGEAFRLARIEMKEELKRILFLQKRLYNGLMESIEEIYINGDMNNRIPHNLNISFNFIEGESLLMAIKDIAVSSGSACTSASLEPSYVLRALGCNDELAHSSIRFTIGRFTTEKEIDFTIKLLKMKEFFMSYSEKVLDHYENPRNVGVFEKNDNTVGTGMVGAPACGDVMKLQIKVNKNGVITDAKFKTYGCGSAIASSSLVTEWVKGKTLDEAMSIKNTDIAEELVTKKAAKYINKYIQKRGKGIGLRLGVYNRGCSGLSYKLEYVDEKRKEDQVFKLNGVQIFINEKDLLYFNDNFIQKSKIDQDASVKLSTYLNKAYSILKDPFLRSIYLCKLNGIDLNTKLNLNFSHDFLEQQMKWRETLSIIKNKKDKVKFMALLQISEPDDISVKNKCVSIGIDFGTTNSLVAIVRNNIPEVLKDKYGYFLIPSIVRYLPDGKIYVGKKAKITQNIDPKNTISSIKRFIARDLKNINTNSFPYDFQNKFGMLHIKTISGIKSPIEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKNAAKLAGLNVLRLLNEPTSAAIAYKLDKNIFEGIFAVYDLGGGTFDISILKFKNGVFKVLSVGGDSNLGGDDFDYCLFSWIVKNAFLKKLSYKDVNILMIKSREIKELLSYQSSVKLNVKLSDKKIVNITIDMKQFFTITQHLVNRTILLSSKALMDANLTIKDINNVILVGGSTRMKHIHEGVSNFFKTTLLTSIDPDKAVVFGAAIQANFLSGNRGIDDNFLLLDVIPLSLGIETIGGLVEKIIFRNTTIPCSYSGEFTTFKDNQTAIAIKVVQGEDELVKNCQVLANFELRDIPPMPAGRARIKVTYQVDADGLLSIFAYEKISGKKKFITIKPFYNMNLDEIKNGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEENSRLSFDAKRGKICTRIMRELRVAINFGNNPDTNIKLRLAIEKALDANIPKNNIFRAIQKNNSNIKNENINYIEVRYEGYSVNGAAIIVDCITNNRMRTVSNIRNIFNKNGGNLSKEGSVLFMFKHCGQLLFLPNTKKNTLLDLALEKGAEDFLIDKDNKITIITSPSKFIEIKNSLEMTGFKAESSGIVMRPYTNIVFKDATTPIDPRVVDKMIPYLRVQFGNPASRNHIYGWTAEKAIEKARNEVAQLIYADPREIIWTSGATESNNLAIKGAAHFYKKRGKHIITVQTEHKSVLDSIRKLENDGFRVTYLKPKNNGLITLSQLEEKICSDTILVSVMLVNNEIGVIQPILEIGELCRSKGVIFHCDAAQAVGKIDINIQNYKVDLMSFSAHKIYGPKGIGALYIRRNPRTRIEAQIHGGGHEYGLRSGTLATHQIVGMGEAFRLARIEMKEELKRILFLQKRLYNGLMESIEEIYINGDMNNRIPHNLNISFNFIEGESLLMAIKDIAVSSGSACTSASLEPSYVLRALGCNDELAHSSIRFTIGRFTTEKEIDFTIKLLKMKEFFMSYSEKVLDHYENPRNVGVFEKNDNTVGTGMVGAPACGDVMKLQIKVNKNGVITDAKFKTYGCGSAIASSSLVTEWVKGKTLDEAMSIKNTDIAEELVTKKAAKYINKYIQKRGKGIGLRLGVYNRGCSGLSYKLEYVDEKRKEDQVFKLNGVQIFINEKDLLYFNDNFIQKSKIDQDASVKLSTYLNKAYSILKDPFLRSIYLCKLNGIDLNTKLNLNFSHDFLEQQMKWRETLSIIKNKKDKVKFMALLQISEPDDISVKNKCVSIGIDFGTTNSLVAIVRNNIPEVLKDKYGYFLIPSIVRYLPDGKIYVGKKAKITQNIDPKNTISSIKRFIARDLKNINTNSFPYDFQNKFGMLHIKTISGIKSPIEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKNAAKLAGLNVLRLLNEPTSAAIAYKLDKNIFEGIFAVYDLGGGTFDISILKFKNGVFKVLSVGGDSNLGGDDFDYCLFSWIVKNAFLKKLSYKDVNILMIKSREIKELLSYQSSVKLNVKLSDKKIVNITIDMKQFFTITQHLVNRTILLSSKALMDANLTIKDINNVILVGGSTRMKHIHEGVSNFFKTTLLTSIDPDKAVVFGAAIQANFLSGNRGIDDNFLLLDVIPLSLGIETIGGLVEKIIFRNTTIPCSYSGEFTTFKDNQTAIAIKVVQGEDELVKNCQVLANFELRDIPPMPAGRARIKVTYQVDADGLLSIFAYEKISGKKKFITIKPFYNMNLDEIKNGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEENSRLSCQ
ccccccccccHHHHHcccccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEcccccccccccccHHHHHHHccccEEEEEccccHHHHHHHHccccccEEEEEEcccccccccHHHHHHHHccccEEEEEEEEEcccccccHHHHHHHHHccccEEEEEcHHHHcccccccccccEEEEEEEEccEEEcccccEEEEEEcccccEEEEEEEccccccccccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccccccccccEEEEEEEEccHHHHHHHHHHHcccccccccccccHHHHHHHccccccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEcccccccccccccccccccEEEEEEEcccccccccccccccccccccccccHHHHcccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccccccccccEEcccccccccEEEEccEEEEEEccccEEccccccccccccccccccHHHHHHHHHHccccccccEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccccccccEEEEEEcccccEEEEEEEccccEEEcccccccccccEEEEcccccEEEcHHHHHHHcccccccEEHHHHcccccccccccccccEEEEEccccEEEEEccccccHHHcHHHHHHHHHHHHHHHHcccccccEEEccccccccccHHHHHHHHHcccEEEEEccHHHHHHHHHcccccccccEEEEEEccccccEEEEEEEcccEEEEEEccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHcccccccccccccEEEEEccccccccccccccEEEccccccccccccccccccccccccEEEEEEEccccccHHcccccccEEEcccccccccccEEEEEEEEccccEEEEEEccccccccEEEEEEccccccHHHHccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccEEEEEcccccccccEEEEEEccccccccccHHHHHcccccccccccccEEEEEEcccEEEEEccccccHHHHHHHHHccccccccccccEEEEcccccEEEEcccccccccccccEEEEEcccccEEEEcccccccHHHHHcccccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEcccccccccccccHHHHHHHccccEEEEEccccHHHHHHHHccccccEEEEEEcccccccccHHHHHHHHccccEEEEEEEEEcccccccHHHHHHHHHccccEEEEEcHHHHcccccccccccEEEEEEEEccEEEcccccEEEEEEcccccEEEEEEEccccccccccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccccccccccEEEEEEEEccHHHHHHHHHHHcccccccccccccHHHHHHHccccccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEcccccccccccccccccccEEEEEEEcccccccccccccccccccccccccHHHHcccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccccccccccEEcccccccccEEEEccEEEEEEccccEEccccccccccccccccccHHHHHHHHHHccccccccEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccccccccEEEEEEcccccEEEEEEEccccEEEcccccccccccEEEEcccccEEEcHHHHHHHcccccccEEHHHHcccccccccccccccEEEEEccccEEEEEccccccHHHcHHHHHHHHHHHHHHHHcccccccEEEccccccccccHHHHHHHHHcccEEEEEccHHHHHHHHHcccccccccEEEEEEccccccEEEEEEEcccEEEEEEccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHcccccccccccccEEEEEccccccccccccccEEEccccccccccccccccccccccccEEEEEEEccccccHHcccccccEEEcccccccccccEEEEEEEEccccEEEEEEccccccccEEEEEEccccccHHHHccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccccccccc
cccccccccccHHHHccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHccccEEEEEcccccccEcHHHHHHHccccEEEEEEEcEccccccEccHHHHHHHHHHcccEEEEEcccccccccccHHHHcccEEEEEHHHcccccccEEEEEccccccEEEEEEccccccccccccccHcHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEccccccccccccEEEEEcccHHHHHHHHHHHHcccccccccccccHHHHHHHcccccHHccccEEEEEcccccHHHHHHHHHHHHHHHHHHHccHHHHHccccccccEEEEEcccccccccccccccccEEEEEEEEccccEEEcccEEccccccHHHccccHHHHHccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccccccEEEEEEEcccccHccEEEEccEEEEEEccHHHHHcccHHEcccccccccHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccHHHcHcccccEEEEEccccEEEEEEEEcccEEEEEccccccccccEEEEcccHHHHHHHHHHHHHcccccccEEEHHHHHcccccccccccccEEEEccccccEEcccEEEccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEHHHHHHHHcccccccccEEEEEEEEccccEEEEEEEEEccEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccEEEEEEccccccEEcHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccHHcccEEEEEccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccccccEEccccEccccEEEEEcccEEEEEEccccEccEEEEEEEEEccccccEEEEEEEEccccEHHHcEEEEEEEEEcccccccccccEEEEEEEcccccEEEEEEEcccccEEEEEEcccccccHHHHHccEEEEcccccEHHHHHHHccccccccccccccccccEEEEEEcHHHcccccHHHHHHHcccccccccEEEccccEHHHHHHHHHHHHHHHHcccccHHHcHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccccEEEEEEEEEcccEEEEEEEEEccHHHHHHHHHHHHHHcccEEccccccHHHEEEEEEEEEcccccHHHHHHHHHHccccHHEEcccccEEEEEcccHEEEEEcccHHcccEEccccEEEcccccEEEEcccccccHHHHHccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHccccEEEEEcccccccEcHHHHHHHccccEEEEEEEcEccccccEccHHHHHHHHHHcccEEEEEcccccccccccHHHHcccEEEEEHHHcccccccEEEEEccccccEEEEEEccccccccccccccHcHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEccccccccccccEEEEEcccHHHHHHHHHHHHcccccccccccccHHHHHHHcccccHHccccEEEEEcccccHHHHHHHHHHHHHHHHHHHccHHHHHccccccccEEEEEcccccccccccccccccEEEEEEEEccccEEEcccEEccccccHHHccccHHHHHccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccccccEEEEEEEcccccHccEEEEccEEEEEEccHHHHHcccHHEcccccccccHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccHHHcHcccccEEEEEccccEEEEEEEEcccEEEEEccccccccccEEEEcccHHHHHHHHHHHHHcccccccEEEHHHHHcccccccccccccEEEEccccccEEcccEEEccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEHHHHHHHHcccccccccEEEEEEEEccccEEEEEEEEEccEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccEEEEEEccccccEEcHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccHHcccEEEEEccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccccccccEEccccEccccEEEEEcccEEEEEEccccEccEEEEEEEEEccccccEEEEEEEEccccEHHHcEEEEEEEEEcccccccccccEEEEEEEcccccEEEEEEEcccccEEEEEEcccccccHHHHHccEEEEcccccEHHHHHHHccccccccccccccccccEEEEEEcHHHcccccHHHHHHHcccccccccEEEccc
mdysattpidprvvdkmipylrvqfgnpasrnhiygWTAEKAIEKARNEVAQLIyadpreiiwtsgatesnnLAIKGAAHFYKKRGKHIITVQTEHKSVLDSIRKLENDGfrvtylkpknnglitLSQLEEKICSDTILVSVMLVNNEIGVIQPILEIGelcrskgvifhcdaaqavgkidiniqNYKVDLMSfsahkiygpkgigalyirrnprtrieaqihgggheyglrsgtlathQIVGMGEAFRLARIEMKEELKRILFLQKRLYNGLMESIEEIYingdmnnriphnlnisfnfieGESLLMAIKDIAVssgsactsaslepsYVLRALgcndelahssirftigrfttEKEIDFTIKLLKMKEFFMSYSEKVLdhyenprnvgvfekndntvgtgmvgapacgdvMKLQIKVnkngvitdakfktygcgsaiaSSSLVTEWVKGKTLDEAMSIKNTDIAEELVTKKAAKYINKYIQKRGkgiglrlgvynrgcsglsykleyvdekrkEDQVFKLNGVQifinekdllyfndnfiqkskidqdaSVKLSTYLNKAYSILKDPFLRSIYLCKLNgidlntklnlnFSHDFLEQQMKWRETLSIIKNKKDKVKFMALLqisepddisvknKCVSIGIDFGTTNSLVAIVRNNipevlkdkygyflipsivrylpdgkiyvgkkakitqnidpkntiSSIKRFIARDLknintnsfpydfqnkfgMLHIKTisgikspiEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKNAAKLAGLNVLRLLNEPTSAAIAYKLDKNIFEGIFAVYdlgggtfdISILKFKNGVFKVLSvggdsnlggddfdycLFSWIVKNAFLKKLSYKDVNILMIKSREIKELLSYQSSVKLNVKLSDKKIVNITIDMKQFFTITQHLVNRTILLSSKALMDAnltikdinNVILVGGSTRMKHIHEGVSNFFKTTlltsidpdkaVVFGAAIQANflsgnrgiddnfllldviplslgieTIGGLVEKIIFrnttipcsysgefttfkdNQTAIAIKVVQGEDELVKNCQVLanfelrdippmpagraRIKVTYQVDADGLLSIFAYEKIsgkkkfitikpfynmnldeikngaifnensGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAwgleensrlsfdAKRGKICTRIMRELRVAInfgnnpdtNIKLRLAIEKALdanipknnIFRAIQKNnsniknenINYIEVRYegysvngaAIIVDcitnnrmrtVSNIRNIFNknggnlskeGSVLFMFKhcgqllflpntkkntLLDLALEKGAEdflidkdnkitiitspsKFIEIKNSlemtgfkaessgivmrpytnivfkdattpidprvvdkmipylrvqfgnpasrnhiygWTAEKAIEKARNEVAQLIyadpreiiwtsgatesnnLAIKGAAHFYKKRGKHIITVQTEHKSVLDSIRKLENDGfrvtylkpknnglitLSQLEEKICSDTILVSVMLVNNEIGVIQPILEIGelcrskgvifhcdaaqavgkidiniqNYKVDLMSfsahkiygpkgigalyirrnprtrieaqihgggheyglrsgtlathQIVGMGEAFRLARIEMKEELKRILFLQKRLYNGLMESIEEIYingdmnnriphnlnisfnfieGESLLMAIKDIAVssgsactsaslepsYVLRALgcndelahssirftigrfttEKEIDFTIKLLKMKEFFMSYSEKVLdhyenprnvgvfekndntvgtgmvgapacgdvMKLQIKVnkngvitdakfktygcgsaiaSSSLVTEWVKGKTLDEAMSIKNTDIAEELVTKKAAKYINKYIQKRGkgiglrlgvynrgcsglsykleyvdekrkEDQVFKLNGVQifinekdllyfndnfiqkskidqdaSVKLSTYLNKAYSILKDPFLRSIYLCKLNgidlntklnlnFSHDFLEQQMKWRETLSIIKNKKDKVKFMALLqisepddisvknKCVSIGIDFGTTNSLVAIVRNNipevlkdkygyflipsivrylpdgkiyvgkkakitqnidpkntiSSIKRFIARDLknintnsfpydfqnkfgMLHIKTisgikspiEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKNAAKLAGLNVLRLLNEPTSAAIAYKLDKNIFEGIFAVYdlgggtfdISILKFKNGVFKVLSvggdsnlggddfdycLFSWIVKNAFLKKLSYKDVNILMIKSREIKELLSYQSSVKLNVKLSDKKIVNITIDMKQFFTITQHLVNRTILLSSKALMDAnltikdinNVILVGGSTRMKHIHEGVSNFFKTTlltsidpdkaVVFGAAIQANflsgnrgiddnfllldviplslgieTIGGLVEKIIFrnttipcsysgefttfkdNQTAIAIKVVQGEDELVKNCQVLanfelrdippmpagraRIKVTYQVDADGLLSIFAYEKIsgkkkfitikpfynmnldeikngaifnensGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAwgleensrlscq
mdysattpidprvvdKMIPYLRVQFGNPASRNHIYGWTAEKAIEKARNEVAQLIYADPREIIWtsgatesnnLAIKGAAHFYKKRGKHIITVQTEHKSVLDSIRKLENDGFRVTYLKPKNNGLITLSQLEEKICSDTILVSVMLVNNEIGVIQPILEIGELCRSKGVIFHCDAAQAVGKIDINIQNYKVDLMSFSAHKIYGPKGIGALYIRRNPRTRIEAQIHGGGHEYGLRSGTLATHQIVGMGEAFRLARIEMKEELKRILFLQKRLYNGLMESIEEIYINGDMNNRIPHNLNISFNFIEGESLLMAIKDIAVSSGSACTSASLEPSYVLRALGCNDELAHSSirftigrfttekEIDFTIKLLKMKEFFMSYSEKVLDHYENPRNVGVFEKNDNTVGTGMVGAPACGDVMKLQIKVNKNGVITDAKFKTYGCGSAIASSSLVTEWVKGKTLDEAMSIKNTDIAEELVTKKAAKYINKYiqkrgkgiglrlgVYNRGCSGLSYKLEYVDEKRKEDQVFKLNGVQIFINEKDLLYFNDNFIQKSKIDQDASVKLSTYLNKAYSILKDPFLRSIYLCKLNGIDLNTKLNLNFSHDFLEQQMKWRETLSIIKNKKDKVKFMALLqisepddisvKNKCVSIGIDFGTTNSLVAIVRNNIPEVLKDKYGYFLIPSIVRYLPDGKIYVGkkakitqnidpkntisSIKRFIARDLKNINTNSFPYDFQNKFGMLHIKTISGIKSPIEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKNAAKLAGLNVLRLLNEPTSAAIAYKLDKNIFEGIFAVYDLGGGTFDISILKFKNGVFKVLSVGGDSNLGGDDFDYCLFSWIVKNAFlkklsykdvNILMIKSREIKELLSyqssvklnvklsdKKIVNITIDMKQFFTITQHLVNRTILLSSKALMDANLTIKDINNVILVGGSTRMKHIHEGVSNFFKTTLLTSIDPDKAVVFGAAIQANFLSGNRGIDDNFLLLDVIPLSLGIETIGGLVEKIIFRNTTIPCSYSGEFTTFKDNQTAIAIKVVQGEDELVKNCQVLANfelrdippmpAGRARIKVTYQVDADGLLSIFAYEKISGKKKFITIKPFYNMNLDEIKNGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAwgleensrlsfdakrGKICTRIMRELRVainfgnnpdtNIKLRLAIEKALDANIPKNNIFRaiqknnsniknENINYIEVRYEGYSVNGAAIIVDCITNNRMRTVSNIRNIFNKNGGNLSKEGSVLFMFKHCGQLLFLPNTKKNTLLDLALEKGAedflidkdnkitiitspskfieiKNSLEMTGFKAESSGIVMRPYTNIVfkdattpidprvVDKMIPYLRVQFGNPASRNHIYGWTAEKAIEKARNEVAQLIYADPREIIWtsgatesnnLAIKGAAHFYKKRGKHIITVQTEHKSVLDSIRKLENDGFRVTYLKPKNNGLITLSQLEEKICSDTILVSVMLVNNEIGVIQPILEIGELCRSKGVIFHCDAAQAVGKIDINIQNYKVDLMSFSAHKIYGPKGIGALYIRRNPRTRIEAQIHGGGHEYGLRSGTLATHQIVGMGEAFRLARIEMKEELKRILFLQKRLYNGLMESIEEIYINGDMNNRIPHNLNISFNFIEGESLLMAIKDIAVSSGSACTSASLEPSYVLRALGCNDELAHSSirftigrfttekEIDFTIKLLKMKEFFMSYSEKVLDHYENPRNVGVFEKNDNTVGTGMVGAPACGDVMKLQIKVNKNGVITDAKFKTYGCGSAIASSSLVTEWVKGKTLDEAMSIKNTDIAEELVTKKAAKYINKYiqkrgkgiglrlgVYNRGCSGLSYKLEYVDEKRKEDQVFKLNGVQIFINEKDLLYFNDNFIQKSKIDQDASVKLSTYLNKAYSILKDPFLRSIYLCKLNGIDLNTKLNLNFSHDFLEQQMKWRETLSIIKNKKDKVKFMALLqisepddisvKNKCVSIGIDFGTTNSLVAIVRNNIPEVLKDKYGYFLIPSIVRYLPDGKIYVGkkakitqnidpkntisSIKRFIARDLKNINTNSFPYDFQNKFGMLHIKTISGIKSPIEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKNAAKLAGLNVLRLLNEPTSAAIAYKLDKNIFEGIFAVYDLGGGTFDISILKFKNGVFKVLSVGGDSNLGGDDFDYCLFSWIVKNAFlkklsykdvNILMIKSREIKELLSyqssvklnvklsdKKIVNITIDMKQFFTITQHLVNRTILLSSKALMDANLTIKDINNVILVGGSTRMKHIHEGVSNFFKTTLLTSIDPDKAVVFGAAIQANFLSGNRGIDDNFLLLDVIPLSLGIETIGGLVEKIIFRNTTIPCSYSGEFTTFKDNQTAIAIKVVQGEDELVKNCQVLANfelrdippmpAGRARIKVTYQVDADGLLSIFAYEKISGKKKFITIKPFYNMNLDEIKNGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLnkawgleensrlscq
MDYSATTPIDPRVVDKMIPYLRVQFGNPASRNHIYGWTAEKAIEKARNEVAQLIYADPREIIWTSGATESNNLAIKGAAHFYKKRGKHIITVQTEHKSVLDSIRKLENDGFRVTYLKPKNNGLITLSQLEEKICSDTILVSVMLVNNEIGVIQPILEIGELCRSKGVIFHCDAAQAVGKIDINIQNYKVDLMSFSAHKIYGPKGIGALYIRRNPRTRIEAQIHGGGHEYGLRSGTLATHQIVGMGEAFRLARIEMKEELKRILFLQKRLYNGLMESIEEIYINGDMNNRIPHNLNISFNFIEGESLLMAIKDIAVSSGSACTSASLEPSYVLRALGCNDELAHSSIRFTIGRFTTEKEIDFTIKLLKMKEFFMSYSEKVLDHYENPRNVGVFEKNDNTVGTGMVGAPACGDVMKLQIKVNKNGVITDAKFKTYGCGSAIASSSLVTEWVKGKTLDEAMSIKNTDIAEELVTKKAAKYINKYIQKRGKGIGLRLGVYNRGCSGLSYKLEYVDEKRKEDQVFKLNGVQIFINEKDLLYFNDNFIQKSKIDQDASVKLSTYLNKAYSILKDPFLRSIYLCKLNGIDLNTKLNLNFSHDFLEQQMKWRETLSIIKNKKDKVKFMALLQISEPDDISVKNKCVSIGIDFGTTNSLVAIVRNNIPEVLKDKYGYFLIPSIVRYLPDGKIYVGKKAKITQNIDPKNTISSIKRFIARDLKNINTNSFPYDFQNKFGMLHIKTISGIKSPIEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKNAAKLAGLNVLRLLNEPTSAAIAYKLDKNIFEGIFAVYDLGGGTFDISILKFKNGVFKVLSVGGDSNLGGDDFDYCLFSWIVKNAFLKKLSYKDVNILMIKSREIKELLSYQSSVKLNVKLSDKKIVNITIDMKQFFTITQHLVNRTILLSSKALMDANLTIKDINNVILVGGSTRMKHIHEGVSNFFKTTLLTSIDPDKAVVFGAAIQANFLSGNRGIDDNFLLLDVIPLSLGIETIGGLVEKIIFRNTTIPCSYSGEFTTFKDNQTAIAIKVVQGEDELVKNCQVLANFELRDIPPMPAGRARIKVTYQVDADGLLSIFAYEKISGKKKFITIKPFYNMNLDEIKNGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEENSRLSFDAKRGKICTRIMRELRVAINFGNNPDTNIKLRLAIEKALDANIPKNNIFRAiqknnsnikneninyieVRYEGYSVNGAAIIVDCITNNRMRTVSNIRNIFNKNGGNLSKEGSVLFMFKHCGQLLFLPNTKKNTLLDLALEKGAEDFLIDKDNKITIITSPSKFIEIKNSLEMTGFKAESSGIVMRPYTNIVFKDATTPIDPRVVDKMIPYLRVQFGNPASRNHIYGWTAEKAIEKARNEVAQLIYADPREIIWTSGATESNNLAIKGAAHFYKKRGKHIITVQTEHKSVLDSIRKLENDGFRVTYLKPKNNGLITLSQLEEKICSDTILVSVMLVNNEIGVIQPILEIGELCRSKGVIFHCDAAQAVGKIDINIQNYKVDLMSFSAHKIYGPKGIGALYIRRNPRTRIEAQIHGGGHEYGLRSGTLATHQIVGMGEAFRLARIEMKEELKRILFLQKRLYNGLMESIEEIYINGDMNNRIPHNLNISFNFIEGESLLMAIKDIAVSSGSACTSASLEPSYVLRALGCNDELAHSSIRFTIGRFTTEKEIDFTIKLLKMKEFFMSYSEKVLDHYENPRNVGVFEKNDNTVGTGMVGAPACGDVMKLQIKVNKNGVITDAKFKTYGCGSAIASSSLVTEWVKGKTLDEAMSIKNTDIAEELVTKKAAKYINKYIQKRGKGIGLRLGVYNRGCSGLSYKLEYVDEKRKEDQVFKLNGVQIFINEKDLLYFNDNFIQKSKIDQDASVKLSTYLNKAYSILKDPFLRSIYLCKLNGIDLNTKLNLNFSHDFLEQQMKWRETLSIIKNKKDKVKFMALLQISEPDDISVKNKCVSIGIDFGTTNSLVAIVRNNIPEVLKDKYGYFLIPSIVRYLPDGKIYVGKKAKITQNIDPKNTISSIKRFIARDLKNINTNSFPYDFQNKFGMLHIKTISGIKSPIEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKNAAKLAGLNVLRLLNEPTSAAIAYKLDKNIFEGIFAVYDLGGGTFDISILKFKNGVFKVLSVGGDSNLGGDDFDYCLFSWIVKNAFLKKLSYKDVNILMIKSREIKELLSYQSSVKLNVKLSDKKIVNITIDMKQFFTITQHLVNRTILLSSKALMDANLTIKDINNVILVGGSTRMKHIHEGVSNFFKTTLLTSIDPDKAVVFGAAIQANFLSGNRGIDDNFLLLDVIPLSLGIETIGGLVEKIIFRNTTIPCSYSGEFTTFKDNQTAIAIKVVQGEDELVKNCQVLANFELRDIPPMPAGRARIKVTYQVDADGLLSIFAYEKISGKKKFITIKPFYNMNLDEIKNGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEENSRLSCQ
***********RVVDKMIPYLRVQFGNPASRNHIYGWTAEKAIEKARNEVAQLIYADPREIIWTSGATESNNLAIKGAAHFYKKRGKHIITVQTEHKSVLDSIRKLENDGFRVTYLKPKNNGLITLSQLEEKICSDTILVSVMLVNNEIGVIQPILEIGELCRSKGVIFHCDAAQAVGKIDINIQNYKVDLMSFSAHKIYGPKGIGALYIRRNPRTRIEAQIHGGGHEYGLRSGTLATHQIVGMGEAFRLARIEMKEELKRILFLQKRLYNGLMESIEEIYINGDMNNRIPHNLNISFNFIEGESLLMAIKDIAVSSGSACTSASLEPSYVLRALGCNDELAHSSIRFTIGRFTTEKEIDFTIKLLKMKEFFMSYSEKVLDHYENPRNVGVFEKNDNTVGTGMVGAPACGDVMKLQIKVNKNGVITDAKFKTYGCGSAIASSSLVTEWVKGKTLDEAMSIKNTDIAEELVTKKAAKYINKYIQKRGKGIGLRLGVYNRGCSGLSYKLEYVDEKRKEDQVFKLNGVQIFINEKDLLYFNDNFIQKSKIDQDASVKLSTYLNKAYSILKDPFLRSIYLCKLNGIDLNTKLNLNFSHDFLEQQMKWRETLSIIKNKKDKVKFMALLQISEPDDISVKNKCVSIGIDFGTTNSLVAIVRNNIPEVLKDKYGYFLIPSIVRYLPDGKIYVGKKAKITQNIDPKNTISSIKRFIARDLKNINTNSFPYDFQNKFGMLHIKTISGIKSPIEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKNAAKLAGLNVLRLLNEPTSAAIAYKLDKNIFEGIFAVYDLGGGTFDISILKFKNGVFKVLSVGGDSNLGGDDFDYCLFSWIVKNAFLKKLSYKDVNILMIKSREIKELLSYQSSVKLNVKLSDKKIVNITIDMKQFFTITQHLVNRTILLSSKALMDANLTIKDINNVILVGGSTRMKHIHEGVSNFFKTTLLTSIDPDKAVVFGAAIQANFLSGNRGIDDNFLLLDVIPLSLGIETIGGLVEKIIFRNTTIPCSYSGEFTTFKDNQTAIAIKVVQGEDELVKNCQVLANFEL************IKVTYQVDADGLLSIFAYEKISGKKKFITIKPFYNMNLDEIKNGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEENSRLSFDAKRGKICTRIMRELRVAINFGNNPDTNIKLRLAIEKALDANIPKNNIFRAIQKNNSNIKNENINYIEVRYEGYSVNGAAIIVDCITNNRMRTVSNIRNIFNKNGGNLSKEGSVLFMFKHCGQLLFLPNTKKNTLLDLALEKGAEDFLIDKDNKITIITSPSKFIEIKNSLEMTGFKAESSGIVMRPYTNIVFKDATTPIDPRVVDKMIPYLRVQFGNPASRNHIYGWTAEKAIEKARNEVAQLIYADPREIIWTSGATESNNLAIKGAAHFYKKRGKHIITVQTEHKSVLDSIRKLENDGFRVTYLKPKNNGLITLSQLEEKICSDTILVSVMLVNNEIGVIQPILEIGELCRSKGVIFHCDAAQAVGKIDINIQNYKVDLMSFSAHKIYGPKGIGALYIRRNPRTRIEAQIHGGGHEYGLRSGTLATHQIVGMGEAFRLARIEMKEELKRILFLQKRLYNGLMESIEEIYINGDMNNRIPHNLNISFNFIEGESLLMAIKDIAVSSGSACTSASLEPSYVLRALGCNDELAHSSIRFTIGRFTTEKEIDFTIKLLKMKEFFMSYSEKVLDHYENPRNVGVFEKNDNTVGTGMVGAPACGDVMKLQIKVNKNGVITDAKFKTYGCGSAIASSSLVTEWVKGKTLDEAMSIKNTDIAEELVTKKAAKYINKYIQKRGKGIGLRLGVYNRGCSGLSYKLEYVDEKRKEDQVFKLNGVQIFINEKDLLYFNDNFIQKSKIDQDASVKLSTYLNKAYSILKDPFLRSIYLCKLNGIDLNTKLNLNFSHDFLEQQMKWRETLSIIKNKKDKVKFMALLQISEPDDISVKNKCVSIGIDFGTTNSLVAIVRNNIPEVLKDKYGYFLIPSIVRYLPDGKIYVGKKAKITQNIDPKNTISSIKRFIARDLKNINTNSFPYDFQNKFGMLHIKTISGIKSPIEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKNAAKLAGLNVLRLLNEPTSAAIAYKLDKNIFEGIFAVYDLGGGTFDISILKFKNGVFKVLSVGGDSNLGGDDFDYCLFSWIVKNAFLKKLSYKDVNILMIKSREIKELLSYQSSVKLNVKLSDKKIVNITIDMKQFFTITQHLVNRTILLSSKALMDANLTIKDINNVILVGGSTRMKHIHEGVSNFFKTTLLTSIDPDKAVVFGAAIQANFLSGNRGIDDNFLLLDVIPLSLGIETIGGLVEKIIFRNTTIPCSYSGEFTTFKDNQTAIAIKVVQGEDELVKNCQVLANFEL************IKVTYQVDADGLLSIFAYEKISGKKKFITIKPFYNMNLDEIKNGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEV********************
******T*IDPRVVDKMIPYLRVQFGNPASRNHIYGWTAEKA*****NEVAQLIYADPREIIWTSGATESNNLAIKGAAHFYKKRGKHIITVQTEHKSVLDSIRKLENDGFRVTYLKPKNNGLITLSQLEEKICSDTILVSVMLVNNEIGVIQPILEIGELCRSKGVIFHCDAAQAVGKIDINIQNYKVDLMSFSAHKIYGPKGIGALYIRRNPRTRIEAQIHGGGHEYGLRSGTLATHQIVGMGEAFRLARIEMKEELKRILFLQKRLYNGLMESIEEIYINGDMNNRIPHNLNISFNFIEGESLLMAIKDIAVSSGSACTSASLEPSYVLRALGCNDELAHSSIRFTIGRFTTEKEIDFTIKLLKMKEFFMSYSEKVLDHYENPRNVGVFEKNDNTVGTGMVGAPACGDVMKLQIKVNKNGVITDAKFKTYGCGSAIASSSLVTEWVKGKTLDEAMSIKNTDIAEELVTKKAAKYINKYIQKRGKGIGLRLGVYNRGCSGLSYKLEYVDEKRKEDQVFKLNGVQIFINEKDLLYFNDNFIQKSKIDQDASVKLSTYLNKAYSILKDPFLRSIYLCKLNGIDLNTKLNLNFSHDFLEQQMKWRETLSII*NKKDKVKFMALLQISE******K***VSIGIDFGTTNSLVAIVRNNIPEVLKDKYGYFLIPSIVRYLPDGKIYVGKKAKITQNIDPKNTISSIKRFIARDLKNINTNSFPYDFQNKFGMLHIKTISGIKSPIEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKNAAKLAGLNVLRLLNEPTSAAIAYKLDKNIFEGIFAVYDLGGGTFDISILKFKNGVFKVLSVGGDSNLGGDDFDYCLFSWIVKNAF**********ILMIKSREIKELLSYQSSVKLNVKLSDKKIVNITIDMKQFFTITQHLVNRTILLSSKALMDANLTIKDINNVILVGGSTRMKHIHEGVSNFFKTTLLTSIDPDKAVVFGAAIQANFLSGNRGIDDNFLLLDVIPLSLGIETIGGLVEKIIFRNTTIPCSYSGEFTTFKDNQTAIAIKVVQGEDELVKNCQVLANFELRDIPPMPAGRARIKVTYQVDADGLLSIFAYEKISGKK**ITIKPFYNMNLDEIKNGAIFNEN**************FIEHACEKSCACATC***********************************************************************************************************EGYSVNGAAIIVDCITNNRMRTVSNIRNIFNKNGGNLSKEGSVLFMFKHCGQLLFLPNTKKNTLLDLALEKGAEDFLIDKDNKITIITSPSKFIEIKNSL*****KAESSGIVMRPYTNIVFKDATTPIDPRVVDKMIPYLRVQFGNPASRNHIYGWTAEKA*****NEVAQLIYADPREIIWTSGATESNNLAIKGAAHFYKKRGKHIITVQTEHKSVLDSIRKLENDGFRVTYLKPKNNGLITLSQLEEKICSDTILVSVMLVNNEIGVIQPILEIGELCRSKGVIFHCDAAQAVGKIDINIQNYKVDLMSFSAHKIYGPKGIGALYIRRNPRTRIEAQIHGGGHEYGLRSGTLATHQIVGMGEAFRLARIEMKEELKRILFLQKRLYNGLMESIEEIYINGDMNNRIPHNLNISFNFIEGESLLMAIKDIAVSSGSACTSASLEPSYVLRALGCNDELAHSSIRFTIGRFTTEKEIDFTIKLLKMKEFFMSYSEKVLDHYENPRNVGVFEKNDNTVGTGMVGAPACGDVMKLQIKVNKNGVITDAKFKTYGCGSAIASSSLVTEWVKGKTLDEAMSIKNTDIAEELVTKKAAKYINKYIQKRGKGIGLRLGVYNRGCSGLSYKLEYVDEKRKEDQVFKLNGVQIFINEKDLLYFNDNFIQKSKIDQDASVKLSTYLNKAYSILKDPFLRSIYLCKLNGIDLNTKLNLNFSHDFLEQQMKWRETLSII*NKKDKVKFMALLQISE******K***VSIGIDFGTTNSLVAIVRNNIPEVLKDKYGYFLIPSIVRYLPDGKIYVGKKAKITQNIDPKNTISSIKRFIARDLKNINTNSFPYDFQNKFGMLHIKTISGIKSPIEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKNAAKLAGLNVLRLLNEPTSAAIAYKLDKNIFEGIFAVYDLGGGTFDISILKFKNGVFKVLSVGGDSNLGGDDFDYCLFSWIVKNAF**********ILMIKSREIKELLSYQSSVKLNVKLSDKKIVNITIDMKQFFTITQHLVNRTILLSSKALMDANLTIKDINNVILVGGSTRMKHIHEGVSNFFKTTLLTSIDPDKAVVFGAAIQANFLSGNRGIDDNFLLLDVIPLSLGIETIGGLVEKIIFRNTTIPCSYSGEFTTFKDNQTAIAIKVVQGEDELVKNCQVLANFELRDIPPMPAGRARIKVTYQVDADGLLSIFAYEKISGKK**ITIKPFYNMNLDEIKNGAIFNEN**************FIEHACEKSCACAT**************************************
MDYSATTPIDPRVVDKMIPYLRVQFGNPASRNHIYGWTAEKAIEKARNEVAQLIYADPREIIWTSGATESNNLAIKGAAHFYKKRGKHIITVQTEHKSVLDSIRKLENDGFRVTYLKPKNNGLITLSQLEEKICSDTILVSVMLVNNEIGVIQPILEIGELCRSKGVIFHCDAAQAVGKIDINIQNYKVDLMSFSAHKIYGPKGIGALYIRRNPRTRIEAQIHGGGHEYGLRSGTLATHQIVGMGEAFRLARIEMKEELKRILFLQKRLYNGLMESIEEIYINGDMNNRIPHNLNISFNFIEGESLLMAIKDIAVSSGSACTSASLEPSYVLRALGCNDELAHSSIRFTIGRFTTEKEIDFTIKLLKMKEFFMSYSEKVLDHYENPRNVGVFEKNDNTVGTGMVGAPACGDVMKLQIKVNKNGVITDAKFKTYGCGSAIASSSLVTEWVKGKTLDEAMSIKNTDIAEELVTKKAAKYINKYIQKRGKGIGLRLGVYNRGCSGLSYKLEYVDEKRKEDQVFKLNGVQIFINEKDLLYFNDNFIQKSKIDQDASVKLSTYLNKAYSILKDPFLRSIYLCKLNGIDLNTKLNLNFSHDFLEQQMKWRETLSIIKNKKDKVKFMALLQISEPDDISVKNKCVSIGIDFGTTNSLVAIVRNNIPEVLKDKYGYFLIPSIVRYLPDGKIYVGKKAKITQNIDPKNTISSIKRFIARDLKNINTNSFPYDFQNKFGMLHIKTISGIKSPIEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKNAAKLAGLNVLRLLNEPTSAAIAYKLDKNIFEGIFAVYDLGGGTFDISILKFKNGVFKVLSVGGDSNLGGDDFDYCLFSWIVKNAFLKKLSYKDVNILMIKSREIKELLSYQSSVKLNVKLSDKKIVNITIDMKQFFTITQHLVNRTILLSSKALMDANLTIKDINNVILVGGSTRMKHIHEGVSNFFKTTLLTSIDPDKAVVFGAAIQANFLSGNRGIDDNFLLLDVIPLSLGIETIGGLVEKIIFRNTTIPCSYSGEFTTFKDNQTAIAIKVVQGEDELVKNCQVLANFELRDIPPMPAGRARIKVTYQVDADGLLSIFAYEKISGKKKFITIKPFYNMNLDEIKNGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEENSRLSFDAKRGKICTRIMRELRVAINFGNNPDTNIKLRLAIEKALDANIPKNNIFRAIQKNNSNIKNENINYIEVRYEGYSVNGAAIIVDCITNNRMRTVSNIRNIFNKNGGNLSKEGSVLFMFKHCGQLLFLPNTKKNTLLDLALEKGAEDFLIDKDNKITIITSPSKFIEIKNSLEMTGFKAESSGIVMRPYTNIVFKDATTPIDPRVVDKMIPYLRVQFGNPASRNHIYGWTAEKAIEKARNEVAQLIYADPREIIWTSGATESNNLAIKGAAHFYKKRGKHIITVQTEHKSVLDSIRKLENDGFRVTYLKPKNNGLITLSQLEEKICSDTILVSVMLVNNEIGVIQPILEIGELCRSKGVIFHCDAAQAVGKIDINIQNYKVDLMSFSAHKIYGPKGIGALYIRRNPRTRIEAQIHGGGHEYGLRSGTLATHQIVGMGEAFRLARIEMKEELKRILFLQKRLYNGLMESIEEIYINGDMNNRIPHNLNISFNFIEGESLLMAIKDIAVSSGSACTSASLEPSYVLRALGCNDELAHSSIRFTIGRFTTEKEIDFTIKLLKMKEFFMSYSEKVLDHYENPRNVGVFEKNDNTVGTGMVGAPACGDVMKLQIKVNKNGVITDAKFKTYGCGSAIASSSLVTEWVKGKTLDEAMSIKNTDIAEELVTKKAAKYINKYIQKRGKGIGLRLGVYNRGCSGLSYKLEYVDEKRKEDQVFKLNGVQIFINEKDLLYFNDNFIQKSKIDQDASVKLSTYLNKAYSILKDPFLRSIYLCKLNGIDLNTKLNLNFSHDFLEQQMKWRETLSIIKNKKDKVKFMALLQISEPDDISVKNKCVSIGIDFGTTNSLVAIVRNNIPEVLKDKYGYFLIPSIVRYLPDGKIYVGKKAKITQNIDPKNTISSIKRFIARDLKNINTNSFPYDFQNKFGMLHIKTISGIKSPIEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKNAAKLAGLNVLRLLNEPTSAAIAYKLDKNIFEGIFAVYDLGGGTFDISILKFKNGVFKVLSVGGDSNLGGDDFDYCLFSWIVKNAFLKKLSYKDVNILMIKSREIKELLSYQSSVKLNVKLSDKKIVNITIDMKQFFTITQHLVNRTILLSSKALMDANLTIKDINNVILVGGSTRMKHIHEGVSNFFKTTLLTSIDPDKAVVFGAAIQANFLSGNRGIDDNFLLLDVIPLSLGIETIGGLVEKIIFRNTTIPCSYSGEFTTFKDNQTAIAIKVVQGEDELVKNCQVLANFELRDIPPMPAGRARIKVTYQVDADGLLSIFAYEKISGKKKFITIKPFYNMNLDEIKNGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLE********
*****TTPIDPRVVDKMIPYLRVQFGNPASRNHIYGWTAEKAIEKARNEVAQLIYADPREIIWTSGATESNNLAIKGAAHFYKKRGKHIITVQTEHKSVLDSIRKLENDGFRVTYLKPKNNGLITLSQLEEKICSDTILVSVMLVNNEIGVIQPILEIGELCRSKGVIFHCDAAQAVGKIDINIQNYKVDLMSFSAHKIYGPKGIGALYIRRNPRTRIEAQIHGGGHEYGLRSGTLATHQIVGMGEAFRLARIEMKEELKRILFLQKRLYNGLMESIEEIYINGDMNNRIPHNLNISFNFIEGESLLMAIKDIAVSSGSACTSASLEPSYVLRALGCNDELAHSSIRFTIGRFTTEKEIDFTIKLLKMKEFFMSYSEKVLDHYENPRNVGVFEKNDNTVGTGMVGAPACGDVMKLQIKVNKNGVITDAKFKTYGCGSAIASSSLVTEWVKGKTLDEAMSIKNTDIAEELVTKKAAKYINKYIQKRGKGIGLRLGVYNRGCSGLSYKLEYVDEKRKEDQVFKLNGVQIFINEKDLLYFNDNFIQKSKIDQDASVKLSTYLNKAYSILKDPFLRSIYLCKLNGIDLNTKLNLNFSHDFLEQQMKWRETLSIIKNKKDKVKFMALLQISEPDDISVKNKCVSIGIDFGTTNSLVAIVRNNIPEVLKDKYGYFLIPSIVRYLPDGKIYVGKKAKITQNIDPKNTISSIKRFIARDLKNINTNSFPYDFQNKFGMLHIKTISGIKSPIEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKNAAKLAGLNVLRLLNEPTSAAIAYKLDKNIFEGIFAVYDLGGGTFDISILKFKNGVFKVLSVGGDSNLGGDDFDYCLFSWIVKNAFLKKLSYKDVNILMIKSREIKELLSYQSSVKLNVKLSDKKIVNITIDMKQFFTITQHLVNRTILLSSKALMDANLTIKDINNVILVGGSTRMKHIHEGVSNFFKTTLLTSIDPDKAVVFGAAIQANFLSGNRGIDDNFLLLDVIPLSLGIETIGGLVEKIIFRNTTIPCSYSGEFTTFKDNQTAIAIKVVQGEDELVKNCQVLANFELRDIPPMPAGRARIKVTYQVDADGLLSIFAYEKISGKKKFITIKPFYNMNLDEIKNGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEENSRLSFDAKRGKICTRIMRELRVAINFGNNPDTNIKLRLAIEKALDANIPKNNIFRAIQKNNSNIKNENINYIEVRYEGYSVNGAAIIVDCITNNRMRTVSNIRNIFNKNGGNLSKEGSVLFMFKHCGQLLFLPNTKKNTLLDLALEKGAEDFLIDKDNKITIITSPSKFIEIKNSLEMTGFKAESSGIVMRPYTNIVFKDATTPIDPRVVDKMIPYLRVQFGNPASRNHIYGWTAEKAIEKARNEVAQLIYADPREIIWTSGATESNNLAIKGAAHFYKKRGKHIITVQTEHKSVLDSIRKLENDGFRVTYLKPKNNGLITLSQLEEKICSDTILVSVMLVNNEIGVIQPILEIGELCRSKGVIFHCDAAQAVGKIDINIQNYKVDLMSFSAHKIYGPKGIGALYIRRNPRTRIEAQIHGGGHEYGLRSGTLATHQIVGMGEAFRLARIEMKEELKRILFLQKRLYNGLMESIEEIYINGDMNNRIPHNLNISFNFIEGESLLMAIKDIAVSSGSACTSASLEPSYVLRALGCNDELAHSSIRFTIGRFTTEKEIDFTIKLLKMKEFFMSYSEKVLDHYENPRNVGVFEKNDNTVGTGMVGAPACGDVMKLQIKVNKNGVITDAKFKTYGCGSAIASSSLVTEWVKGKTLDEAMSIKNTDIAEELVTKKAAKYINKYIQKRGKGIGLRLGVYNRGCSGLSYKLEYVDEKRKEDQVFKLNGVQIFINEKDLLYFNDNFIQKSKIDQDASVKLSTYLNKAYSILKDPFLRSIYLCKLNGIDLNTKLNLNFSHDFLEQQMKWRETLSIIKNKKDKVKFMALLQISEPDDISVKNKCVSIGIDFGTTNSLVAIVRNNIPEVLKDKYGYFLIPSIVRYLPDGKIYVGKKAKITQNIDPKNTISSIKRFIARDLKNINTNSFPYDFQNKFGMLHIKTISGIKSPIEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKNAAKLAGLNVLRLLNEPTSAAIAYKLDKNIFEGIFAVYDLGGGTFDISILKFKNGVFKVLSVGGDSNLGGDDFDYCLFSWIVKNAFLKKLSYKDVNILMIKSREIKELLSYQSSVKLNVKLSDKKIVNITIDMKQFFTITQHLVNRTILLSSKALMDANLTIKDINNVILVGGSTRMKHIHEGVSNFFKTTLLTSIDPDKAVVFGAAIQANFLSGNRGIDDNFLLLDVIPLSLGIETIGGLVEKIIFRNTTIPCSYSGEFTTFKDNQTAIAIKVVQGEDELVKNCQVLANFELRDIPPMPAGRARIKVTYQVDADGLLSIFAYEKISGKKKFITIKPFYNMNLDEIKNGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEENS*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDYSATTPIDPRVVDKMIPYLRVQFGNPASRNHIYGWTAEKAIEKARNEVAQLIYADPREIIWTSGATESNNLAIKGAAHFYKKRGKHIITVQTEHKSVLDSIRKLENDGFRVTYLKPKNNGLITLSQLEEKICSDTILVSVMLVNNEIGVIQPILEIGELCRSKGVIFHCDAAQAVGKIDINIQNYKVDLMSFSAHKIYGPKGIGALYIRRNPRTRIEAQIHGGGHEYGLRSGTLATHQIVGMGEAFRLARIEMKEELKRILFLQKRLYNGLMESIEEIYINGDMNNRIPHNLNISFNFIEGESLLMAIKDIAVSSGSACTSASLEPSYVLRALGCNDELAHSSIRFTIGRFTTEKEIDFTIKLLKMKEFFMSYSEKVLDHYENPRNVGVFEKNDNTVGTGMVGAPACGDVMKLQIKVNKNGVITDAKFKTYGCGSAIASSSLVTEWVKGKTLDEAMSIKNTDIAEELVTKKAAKYINKYIQKRGKGIGLRLGVYNRGCSGLSYKLEYVDEKRKEDQVFKLNGVQIFINEKDLLYFNDNFIQKSKIDQDASVKLSTYLNKAYSILKDPFLRSIYLCKLNGIDLNTKLNLNFSHDFLEQQMKWRETLSIIKNKKDKVKFMALLQISEPDDISVKNKCVSIGIDFGTTNSLVAIVRNNIPEVLKDKYGYFLIPSIVRYLPDGKIYVGKKAKITQNIDPKNTISSIKRFIARDLKNINTNSFPYDFQNKFGMLHIKTISGIKSPIEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKNAAKLAGLNVLRLLNEPTSAAIAYKLDKNIFEGIFAVYDLGGGTFDISILKFKNGVFKVLSVGGDSNLGGDDFDYCLFSWIVKNAFLKKLSYKDVNILMIKSREIKELLSYQSSVKLNVKLSDKKIVNITIDMKQFFTITQHLVNRTILLSSKALMDANLTIKDINNVILVGGSTRMKHIHEGVSNFFKTTLLTSIDPDKAVVFGAAIQANFLSGNRGIDDNFLLLDVIPLSLGIETIGGLVEKIIFRNTTIPCSYSGEFTTFKDNQTAIAIKVVQGEDELVKNCQVLANFELRDIPPMPAGRARIKVTYQVDADGLLSIFAYEKISGKKKFITIKPFYNMNLDEIKNGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEENSRLSFDAKRGKICTRIMRELRVAINFGNNPDTNIKLRLAIEKALDANIPKNNIFRAIQKNNSNIKNENINYIEVRYEGYSVNGAAIIVDCITNNRMRTVSNIRNIFNKNGGNLSKEGSVLFMFKHCGQLLFLPNTKKNTLLDLALEKGAEDFLIDKDNKITIITSPSKFIEIKNSLEMTGFKAESSGIVMRPYTNIVFKDATTPIDPRVVDKMIPYLRVQFGNPASRNHIYGWTAEKAIEKARNEVAQLIYADPREIIWTSGATESNNLAIKGAAHFYKKRGKHIITVQTEHKSVLDSIRKLENDGFRVTYLKPKNNGLITLSQLEEKICSDTILVSVMLVNNEIGVIQPILEIGELCRSKGVIFHCDAAQAVGKIDINIQNYKVDLMSFSAHKIYGPKGIGALYIRRNPRTRIEAQIHGGGHEYGLRSGTLATHQIVGMGEAFRLARIEMKEELKRILFLQKRLYNGLMESIEEIYINGDMNNRIPHNLNISFNFIEGESLLMAIKDIAVSSGSACTSASLEPSYVLRALGCNDELAHSSIRFTIGRFTTEKEIDFTIKLLKMKEFFMSYSEKVLDHYENPRNVGVFEKNDNTVGTGMVGAPACGDVMKLQIKVNKNGVITDAKFKTYGCGSAIASSSLVTEWVKGKTLDEAMSIKNTDIAEELVTKKAAKYINKYIQKRGKGIGLRLGVYNRGCSGLSYKLEYVDEKRKEDQVFKLNGVQIFINEKDLLYFNDNFIQKSKIDQDASVKLSTYLNKAYSILKDPFLRSIYLCKLNGIDLNTKLNLNFSHDFLEQQMKWRETLSIIKNKKDKVKFMALLQISEPDDISVKNKCVSIGIDFGTTNSLVAIVRNNIPEVLKDKYGYFLIPSIVRYLPDGKIYVGKKAKITQNIDPKNTISSIKRFIARDLKNINTNSFPYDFQNKFGMLHIKTISGIKSPIEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKNAAKLAGLNVLRLLNEPTSAAIAYKLDKNIFEGIFAVYDLGGGTFDISILKFKNGVFKVLSVGGDSNLGGDDFDYCLFSWIVKNAFLKKLSYKDVNILMIKSREIKELLSYQSSVKLNVKLSDKKIVNITIDMKQFFTITQHLVNRTILLSSKALMDANLTIKDINNVILVGGSTRMKHIHEGVSNFFKTTLLTSIDPDKAVVFGAAIQANFLSGNRGIDDNFLLLDVIPLSLGIETIGGLVEKIIFRNTTIPCSYSGEFTTFKDNQTAIAIKVVQGEDELVKNCQVLANFELRDIPPMPAGRARIKVTYQVDADGLLSIFAYEKISGKKKFITIKPFYNMNLDEIKNGAIFNENSGISLCDALLKNSIFIEHACEKSCACATCHVIIREGFNEINKANEVEEDMLNKAWGLEENSRLSCQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query2602 2.2.26 [Sep-21-2011]
A4G782620 Chaperone protein HscA ho no N/A 0.196 0.824 0.589 1e-169
A6SXE9620 Chaperone protein HscA ho no N/A 0.196 0.824 0.593 1e-169
Q473J2621 Chaperone protein HscA ho no N/A 0.196 0.822 0.571 1e-163
A4SYY9621 Chaperone protein HscA ho no N/A 0.196 0.822 0.564 1e-161
Q0KCG7621 Chaperone protein HscA ho no N/A 0.196 0.822 0.562 1e-161
Q1H361405 Cysteine desulfurase OS=M yes N/A 0.141 0.908 0.724 1e-160
B2U8U5621 Chaperone protein HscA ho no N/A 0.196 0.822 0.556 1e-160
Q1LPL1621 Chaperone protein HscA ho no N/A 0.196 0.822 0.556 1e-160
B3R475621 Chaperone protein HscA ho no N/A 0.196 0.822 0.562 1e-160
Q8Y0L9621 Chaperone protein HscA ho no N/A 0.196 0.822 0.552 1e-159
>sp|A4G782|HSCA_HERAR Chaperone protein HscA homolog OS=Herminiimonas arsenicoxydans GN=hscA PE=3 SV=1 Back     alignment and function desciption
 Score =  598 bits (1541), Expect = e-169,   Method: Composition-based stats.
 Identities = 303/514 (58%), Positives = 395/514 (76%), Gaps = 3/514 (0%)

Query: 620  MALLQISEPDDISVKNKC-VSIGIDFGTTNSLVAIVRNNIPEVLKDKYGYFLIPSIVRYL 678
            MALLQI+EP   +  ++  +++GID GTTNSLVA VRN+IPE+L D+ G  L+PS+V YL
Sbjct: 1    MALLQIAEPGMSTAPHQHRLAVGIDLGTTNSLVATVRNSIPEILTDEEGRSLLPSVVHYL 60

Query: 679  PDGKIYVGKKAKITQNIDPKNTISSIKRFIARDLKNIN-TNSFPYDFQNKFGMLHIKTIS 737
             +G  ++G KA+  QN DPKNTI S+KRF+ R LK+I    + PYDF +  GM+ +KT++
Sbjct: 61   KNGSAHIGYKAQAAQNTDPKNTIVSVKRFMGRGLKDIAYAENLPYDFLDTPGMVQLKTVA 120

Query: 738  GIKSPIEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKNAAKLAGLNVLR 797
            G+KSP+E+SA+I  TL++ AE+A+ + + GAVITVPAYF+D QRQ TK+AAKLAGLNVLR
Sbjct: 121  GVKSPVEVSAEILATLRQQAEDALGDDLVGAVITVPAYFDDAQRQATKDAAKLAGLNVLR 180

Query: 798  LLNEPTSAAIAYKLDKNIFEGIFAVYDLGGGTFDISILKFKNGVFKVLSVGGDSNLGGDD 857
            LLNEPT+AAIAY LD N  EG+FAVYDLGGGTFD+SILK   GVF+VLS GGDS LGGDD
Sbjct: 181  LLNEPTAAAIAYGLD-NGSEGVFAVYDLGGGTFDVSILKLTKGVFEVLSTGGDSALGGDD 239

Query: 858  FDYCLFSWIVKNAFLKKLSYKDVNILMIKSREIKELLSYQSSVKLNVKLSDKKIVNITID 917
            FD+ LF WI++ A L  LS  D ++LM+K+RE KELLS +S   ++  L+  + V++T+ 
Sbjct: 240  FDHRLFCWIIEQAGLAPLSEIDTSVLMVKAREAKELLSSKSETLIDAVLTSGEEVHVTVT 299

Query: 918  MKQFFTITQHLVNRTILLSSKALMDANLTIKDINNVILVGGSTRMKHIHEGVSNFFKTTL 977
               F  +TQHLV +TI  + KAL DA L++ D++ V++VGG+TRM HI + V +FF++T 
Sbjct: 300  AADFIQMTQHLVTKTITPTKKALRDAGLSVDDVDGVVMVGGATRMPHIRKAVGDFFQSTP 359

Query: 978  LTSIDPDKAVVFGAAIQANFLSGNRGIDDNFLLLDVIPLSLGIETIGGLVEKIIFRNTTI 1037
            L +IDPDK V  GAA+QAN L+GNR   D++LLLDVIPLSLGIET+GGLVEK+I RN+TI
Sbjct: 360  LANIDPDKVVALGAAVQANLLAGNRAAGDDWLLLDVIPLSLGIETMGGLVEKVIPRNSTI 419

Query: 1038 PCSYSGEFTTFKDNQTAIAIKVVQGEDELVKNCQVLANFELRDIPPMPAGRARIKVTYQV 1097
            PC+ + EFTTFKD QTA+A+ +VQGE ELV +C+ LA FELR IPPM AG ARI+VTYQV
Sbjct: 420  PCARAQEFTTFKDGQTALAVHIVQGERELVTDCRSLAKFELRGIPPMAAGAARIRVTYQV 479

Query: 1098 DADGLLSIFAYEKISGKKKFITIKPFYNMNLDEI 1131
            DADGLLS+ A E  SG +  I++KP Y +  D+I
Sbjct: 480  DADGLLSVSARELRSGVEASISVKPSYGLADDQI 513




Chaperone involved in the maturation of iron-sulfur cluster-containing proteins. Has a low intrinsic ATPase activity which is markedly stimulated by HscB.
Herminiimonas arsenicoxydans (taxid: 204773)
>sp|A6SXE9|HSCA_JANMA Chaperone protein HscA homolog OS=Janthinobacterium sp. (strain Marseille) GN=hscA PE=3 SV=1 Back     alignment and function description
>sp|Q473J2|HSCA_CUPPJ Chaperone protein HscA homolog OS=Cupriavidus pinatubonensis (strain JMP134 / LMG 1197) GN=hscA PE=3 SV=1 Back     alignment and function description
>sp|A4SYY9|HSCA_POLSQ Chaperone protein HscA homolog OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=hscA PE=3 SV=1 Back     alignment and function description
>sp|Q0KCG7|HSCA_CUPNH Chaperone protein HscA homolog OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hscA PE=3 SV=1 Back     alignment and function description
>sp|Q1H361|ISCS_METFK Cysteine desulfurase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=iscS PE=3 SV=1 Back     alignment and function description
>sp|B2U8U5|HSCA_RALPJ Chaperone protein HscA homolog OS=Ralstonia pickettii (strain 12J) GN=hscA PE=3 SV=1 Back     alignment and function description
>sp|Q1LPL1|HSCA_RALME Chaperone protein HscA homolog OS=Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM 2839) GN=hscA PE=3 SV=1 Back     alignment and function description
>sp|B3R475|HSCA_CUPTR Chaperone protein HscA homolog OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=hscA PE=3 SV=1 Back     alignment and function description
>sp|Q8Y0L9|HSCA_RALSO Chaperone protein HscA homolog OS=Ralstonia solanacearum (strain GMI1000) GN=hscA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query2602
409406867621 molecular chaperone protein [Herbaspiril 0.196 0.822 0.616 1e-179
300312439621 molecular chaperone protein [Herbaspiril 0.196 0.822 0.608 1e-177
134095420417 tRNA 4-thiouridine sulfurtransferase [He 0.147 0.920 0.748 1e-174
152980888417 cysteine desulfurase [Janthinobacterium 0.141 0.882 0.775 1e-173
300312444417 cysteine desulfurase [Herbaspirillum ser 0.141 0.882 0.777 1e-173
329904115621 Chaperone protein HscA [Oxalobacteraceae 0.196 0.822 0.593 1e-173
409406872417 cysteine desulfurase [Herbaspirillum sp. 0.141 0.882 0.775 1e-172
399019488417 cysteine desulfurase IscS [Herbaspirillu 0.141 0.882 0.769 1e-172
398834079417 cysteine desulfurase IscS [Herbaspirillu 0.141 0.882 0.761 1e-172
415916354417 Cysteine desulfurase [Herbaspirillum fri 0.141 0.882 0.769 1e-171
>gi|409406867|ref|ZP_11255329.1| molecular chaperone protein [Herbaspirillum sp. GW103] gi|386435416|gb|EIJ48241.1| molecular chaperone protein [Herbaspirillum sp. GW103] Back     alignment and taxonomy information
 Score =  637 bits (1643), Expect = e-179,   Method: Composition-based stats.
 Identities = 317/514 (61%), Positives = 397/514 (77%), Gaps = 3/514 (0%)

Query: 620  MALLQISEPD-DISVKNKCVSIGIDFGTTNSLVAIVRNNIPEVLKDKYGYFLIPSIVRYL 678
            MALLQISEP    +   + +++GID GTTNSLVA VRN+IPEVL D  G  L+PSIVRYL
Sbjct: 1    MALLQISEPGMSTAPHQRRLAVGIDLGTTNSLVATVRNSIPEVLADDDGRVLLPSIVRYL 60

Query: 679  PDGKIYVGKKAKITQNIDPKNTISSIKRFIARDLKNI-NTNSFPYDFQNKFGMLHIKTIS 737
            P+G  ++G KA+  Q IDP+NTI S+KRF+ R LK+I +  + PYDFQ++ GM+ IKT++
Sbjct: 61   PNGHAHIGYKAQAAQTIDPRNTIVSVKRFMGRGLKDIAHAENMPYDFQDQPGMVQIKTVA 120

Query: 738  GIKSPIEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKNAAKLAGLNVLR 797
            G+KSP+E+SAQI  TL++ AE+A+ + + GAVITVPAYF+D QRQ TK+AA+LAGLNVLR
Sbjct: 121  GVKSPVEVSAQILATLRQTAEDALGDDLVGAVITVPAYFDDAQRQATKDAAQLAGLNVLR 180

Query: 798  LLNEPTSAAIAYKLDKNIFEGIFAVYDLGGGTFDISILKFKNGVFKVLSVGGDSNLGGDD 857
            LLNEPT+AAIAY LD N  EGIFAVYDLGGGTFDISILK   GVF+VLS GGDS LGGDD
Sbjct: 181  LLNEPTAAAIAYGLD-NASEGIFAVYDLGGGTFDISILKLTRGVFEVLSTGGDSALGGDD 239

Query: 858  FDYCLFSWIVKNAFLKKLSYKDVNILMIKSREIKELLSYQSSVKLNVKLSDKKIVNITID 917
            FD+ LF WI   A L+ LS +D  +LM+K+RE+KELLS +  V+++  L   + V+++I 
Sbjct: 240  FDHRLFCWISHEAQLQPLSDEDTRLLMVKAREVKELLSSKEEVQIDAVLKSGEEVHLSIT 299

Query: 918  MKQFFTITQHLVNRTILLSSKALMDANLTIKDINNVILVGGSTRMKHIHEGVSNFFKTTL 977
              QF  ITQHLV +T+    KAL DA+LT++D++ V+LVGG+TRM HI   V  FFKT  
Sbjct: 300  AAQFNEITQHLVAKTMAPVRKALRDASLTVEDVDGVVLVGGATRMPHIRRAVGEFFKTNP 359

Query: 978  LTSIDPDKAVVFGAAIQANFLSGNRGIDDNFLLLDVIPLSLGIETIGGLVEKIIFRNTTI 1037
            L++IDPDK V  GAA+QAN L+GNR   D++LLLDVIPLSLGIET+GGL EK+I RN+TI
Sbjct: 360  LSNIDPDKVVALGAAVQANLLAGNRAPGDDWLLLDVIPLSLGIETMGGLAEKVIPRNSTI 419

Query: 1038 PCSYSGEFTTFKDNQTAIAIKVVQGEDELVKNCQVLANFELRDIPPMPAGRARIKVTYQV 1097
            PC+ + EFTTFKD QTA+AI VVQGE ELV +C+ LA FELR IPPM AG ARI+VTYQV
Sbjct: 420  PCARAQEFTTFKDGQTAMAIHVVQGERELVADCRSLARFELRGIPPMAAGAARIRVTYQV 479

Query: 1098 DADGLLSIFAYEKISGKKKFITIKPFYNMNLDEI 1131
            DADGLL++ A E  SG +  IT+KP Y +  DEI
Sbjct: 480  DADGLLAVSAREMTSGVEASITVKPSYGLGDDEI 513




Source: Herbaspirillum sp. GW103

Species: Herbaspirillum sp. GW103

Genus: Herbaspirillum

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria

>gi|300312439|ref|YP_003776531.1| molecular chaperone protein [Herbaspirillum seropedicae SmR1] gi|300075224|gb|ADJ64623.1| molecular chaperone protein [Herbaspirillum seropedicae SmR1] Back     alignment and taxonomy information
>gi|134095420|ref|YP_001100495.1| tRNA 4-thiouridine sulfurtransferase [Herminiimonas arsenicoxydans] gi|133739323|emb|CAL62373.1| Cysteine desulfurase [Herminiimonas arsenicoxydans] Back     alignment and taxonomy information
>gi|152980888|ref|YP_001352942.1| cysteine desulfurase [Janthinobacterium sp. Marseille] gi|151280965|gb|ABR89375.1| cysteine desulfurase [Janthinobacterium sp. Marseille] Back     alignment and taxonomy information
>gi|300312444|ref|YP_003776536.1| cysteine desulfurase [Herbaspirillum seropedicae SmR1] gi|300075229|gb|ADJ64628.1| cysteine desulfurase protein [Herbaspirillum seropedicae SmR1] Back     alignment and taxonomy information
>gi|329904115|ref|ZP_08273681.1| Chaperone protein HscA [Oxalobacteraceae bacterium IMCC9480] gi|327548137|gb|EGF32853.1| Chaperone protein HscA [Oxalobacteraceae bacterium IMCC9480] Back     alignment and taxonomy information
>gi|409406872|ref|ZP_11255334.1| cysteine desulfurase [Herbaspirillum sp. GW103] gi|386435421|gb|EIJ48246.1| cysteine desulfurase [Herbaspirillum sp. GW103] Back     alignment and taxonomy information
>gi|399019488|ref|ZP_10721636.1| cysteine desulfurase IscS [Herbaspirillum sp. CF444] gi|398098098|gb|EJL88391.1| cysteine desulfurase IscS [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
>gi|398834079|ref|ZP_10592027.1| cysteine desulfurase IscS [Herbaspirillum sp. YR522] gi|398220600|gb|EJN07044.1| cysteine desulfurase IscS [Herbaspirillum sp. YR522] Back     alignment and taxonomy information
>gi|415916354|ref|ZP_11553975.1| Cysteine desulfurase [Herbaspirillum frisingense GSF30] gi|407761523|gb|EKF70572.1| Cysteine desulfurase [Herbaspirillum frisingense GSF30] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query2602
UNIPROTKB|P0A6B7404 iscS "cysteine desulfurase mon 0.140 0.905 0.663 3.3e-134
UNIPROTKB|Q9KTY2404 iscS "Cysteine desulfurase" [V 0.150 0.970 0.627 6.2e-133
TIGR_CMR|VC_0748404 VC_0748 "aminotransferase NifS 0.150 0.970 0.627 6.2e-133
TIGR_CMR|SO_2264404 SO_2264 "cysteine desulfurase" 0.140 0.903 0.671 1.5e-131
UNIPROTKB|Q486Z0404 iscS "Cysteine desulfurase" [C 0.140 0.903 0.671 1.5e-131
TIGR_CMR|CPS_1132404 CPS_1132 "cysteine desulfurase 0.140 0.903 0.671 1.5e-131
TIGR_CMR|SO_2268620 SO_2268 "chaperone protein Hsc 0.195 0.820 0.498 1e-119
UNIPROTKB|Q9Y697457 NFS1 "Cysteine desulfurase, mi 0.139 0.796 0.618 8.6e-118
ZFIN|ZDB-GENE-060405-1451 nfs1 "NFS1 nitrogen fixation 1 0.139 0.802 0.621 8.6e-118
UNIPROTKB|A5PKG4457 NFS1 "Uncharacterized protein" 0.139 0.796 0.620 1.4e-117
UNIPROTKB|P0A6B7 iscS "cysteine desulfurase monomer" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
 Score = 1328 (472.5 bits), Expect = 3.3e-134, P = 3.3e-134
 Identities = 245/369 (66%), Positives = 317/369 (85%)

Query:     1 MDYSATTPIDPRVVDKMIPYLRVQ--FGNPASRNHIYGWTAEKAIEKARNEVAQLIYADP 58
             +DYSATTP+DPRV +KM+ ++ +   FGNPASR+H +GW AE+A++ ARN++A L+ ADP
Sbjct:     7 LDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADP 66

Query:    59 REIIWTSGATESNNLAIKGAAHFYKKRGKHIITVQTEHKSVLDSIRKLENDGFRVTYLKP 118
             REI++TSGATES+NLAIKGAA+FY+K+GKHIIT +TEHK+VLD+ R+LE +GF VTYL P
Sbjct:    67 REIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAP 126

Query:   119 KNNGLITLSQLEEKICSDTILVSVMLVNNEIGVIQPILEIGELCRSKGVIFHCDAAQAVG 178
             + NG+I L +LE  +  DTILVS+M VNNEIGV+Q I  IGE+CR++G+I+H DA Q+VG
Sbjct:   127 QRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVG 186

Query:   179 KIDINIQNYKVDLMSFSAHKIYGPKGIGALYIRRNPRTRIEAQIHGGGHEYGLRSGTLAT 238
             K+ I++   KVDLMSFS HKIYGPKGIGALY+RR PR RIEAQ+HGGGHE G+RSGTL  
Sbjct:   187 KLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPV 246

Query:   239 HQIVGMGEAFRLARIEMKEELKRILFLQKRLYNGLMESIEEIYINGDMNNRIPHNLNISF 298
             HQIVGMGEA+R+A+ EM  E++R+  L+ RL+NG+ + IEE+Y+NGD+ +  P+ LN+SF
Sbjct:   247 HQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKD-IEEVYLNGDLEHGAPNILNVSF 305

Query:   299 NFIEGESLLMAIKDIAVSSGSACTSASLEPSYVLRALGCNDELAHSSIRFTIGRFTTEKE 358
             N++EGESL+MA+KD+AVSSGSACTSASLEPSYVLRALG NDELAHSSIRF++GRFTTE+E
Sbjct:   306 NYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEE 365

Query:   359 IDFTIKLLK 367
             ID+TI+L++
Sbjct:   366 IDYTIELVR 374


GO:0006534 "cysteine metabolic process" evidence=IEA
GO:0097163 "sulfur carrier activity" evidence=EXP
GO:0030170 "pyridoxal phosphate binding" evidence=IEA;IDA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0031119 "tRNA pseudouridine synthesis" evidence=IDA
GO:0031071 "cysteine desulfurase activity" evidence=IEA;IDA
GO:0009000 "selenocysteine lyase activity" evidence=IDA
GO:0016226 "iron-sulfur cluster assembly" evidence=IMP
GO:0018131 "oxazole or thiazole biosynthetic process" evidence=IMP
UNIPROTKB|Q9KTY2 iscS "Cysteine desulfurase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0748 VC_0748 "aminotransferase NifS, class V" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|SO_2264 SO_2264 "cysteine desulfurase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q486Z0 iscS "Cysteine desulfurase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_1132 CPS_1132 "cysteine desulfurase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|SO_2268 SO_2268 "chaperone protein HscA" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y697 NFS1 "Cysteine desulfurase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060405-1 nfs1 "NFS1 nitrogen fixation 1 (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A5PKG4 NFS1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q1H361ISCS_METFK2, ., 8, ., 1, ., 70.72430.14140.9086yesN/A
B5R5A2ISCS_SALEP2, ., 8, ., 1, ., 70.66660.14060.9059yesN/A
B5FR85ISCS_SALDC2, ., 8, ., 1, ., 70.66660.14060.9059yesN/A
Q8ZN40ISCS_SALTY2, ., 8, ., 1, ., 70.66660.14060.9059yesN/A
Q7MNG2ISCS_VIBVY2, ., 8, ., 1, ., 70.66750.14100.9084yesN/A
B5RD12ISCS_SALG22, ., 8, ., 1, ., 70.66660.14060.9059yesN/A
C3LT01ISCS_VIBCM2, ., 8, ., 1, ., 70.66480.14100.9084yesN/A
B4T0S2ISCS_SALNS2, ., 8, ., 1, ., 70.66660.14060.9059yesN/A
Q9KTY2ISCS_VIBCH2, ., 8, ., 1, ., 70.66210.14100.9084yesN/A
A7MGX8ISCS_CROS82, ., 8, ., 1, ., 70.66930.14060.9059yesN/A
Q3SEX4HSCA_THIDANo assigned EC number0.54080.19600.8225yesN/A
Q8DEY7ISCS_VIBVU2, ., 8, ., 1, ., 70.66750.14100.9084yesN/A
B5BAW6ISCS_SALPK2, ., 8, ., 1, ., 70.66660.14060.9059yesN/A
B4TDB6ISCS_SALHS2, ., 8, ., 1, ., 70.66660.14060.9059yesN/A
Q60C64ISCS_METCA2, ., 8, ., 1, ., 70.69370.14140.9131yesN/A
Q5PNG1ISCS_SALPA2, ., 8, ., 1, ., 70.66660.14060.9059yesN/A
A9N1X5ISCS_SALPB2, ., 8, ., 1, ., 70.66660.14060.9059yesN/A
A5F3G4ISCS_VIBC32, ., 8, ., 1, ., 70.66210.14100.9084yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.8.1.7LOW CONFIDENCE prediction!
3rd Layer2.8.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query2602
PRK05183616 PRK05183, hscA, chaperone protein HscA; Provisiona 0.0
PRK05183616 PRK05183, hscA, chaperone protein HscA; Provisiona 0.0
PRK14012404 PRK14012, PRK14012, cysteine desulfurase; Provisio 0.0
PRK14012404 PRK14012, PRK14012, cysteine desulfurase; Provisio 0.0
TIGR01991599 TIGR01991, HscA, Fe-S protein assembly chaperone H 0.0
TIGR01991599 TIGR01991, HscA, Fe-S protein assembly chaperone H 0.0
TIGR02006402 TIGR02006, IscS, cysteine desulfurase IscS 0.0
TIGR02006402 TIGR02006, IscS, cysteine desulfurase IscS 0.0
COG1104386 COG1104, NifS, Cysteine sulfinate desulfinase/cyst 0.0
COG1104386 COG1104, NifS, Cysteine sulfinate desulfinase/cyst 0.0
PLN02651364 PLN02651, PLN02651, cysteine desulfurase 0.0
PLN02651364 PLN02651, PLN02651, cysteine desulfurase 0.0
pfam00012598 pfam00012, HSP70, Hsp70 protein 1e-153
pfam00012598 pfam00012, HSP70, Hsp70 protein 1e-153
TIGR03402379 TIGR03402, FeS_nifS, cysteine desulfurase NifS 1e-150
COG0443579 COG0443, DnaK, Molecular chaperone [Posttranslatio 1e-149
COG0443579 COG0443, DnaK, Molecular chaperone [Posttranslatio 1e-149
TIGR03402379 TIGR03402, FeS_nifS, cysteine desulfurase NifS 1e-148
cd10236355 cd10236, HscA_like_NBD, Nucleotide-binding domain 1e-141
cd10236355 cd10236, HscA_like_NBD, Nucleotide-binding domain 1e-141
TIGR02350595 TIGR02350, prok_dnaK, chaperone protein DnaK 1e-139
TIGR02350595 TIGR02350, prok_dnaK, chaperone protein DnaK 1e-139
PRK00290627 PRK00290, dnaK, molecular chaperone DnaK; Provisio 1e-137
PRK00290627 PRK00290, dnaK, molecular chaperone DnaK; Provisio 1e-137
TIGR03235353 TIGR03235, DNA_S_dndA, cysteine desulfurase DndA 1e-128
TIGR03235353 TIGR03235, DNA_S_dndA, cysteine desulfurase DndA 1e-127
PRK13411653 PRK13411, PRK13411, molecular chaperone DnaK; Prov 1e-120
PRK13411653 PRK13411, PRK13411, molecular chaperone DnaK; Prov 1e-120
CHL00094621 CHL00094, dnaK, heat shock protein 70 1e-119
CHL00094621 CHL00094, dnaK, heat shock protein 70 1e-119
PRK01433595 PRK01433, hscA, chaperone protein HscA; Provisiona 1e-117
PRK01433595 PRK01433, hscA, chaperone protein HscA; Provisiona 1e-117
PRK13410668 PRK13410, PRK13410, molecular chaperone DnaK; Prov 1e-115
PRK13410668 PRK13410, PRK13410, molecular chaperone DnaK; Prov 1e-115
PTZ00400663 PTZ00400, PTZ00400, DnaK-type molecular chaperone; 1e-113
PTZ00400663 PTZ00400, PTZ00400, DnaK-type molecular chaperone; 1e-113
PLN03184673 PLN03184, PLN03184, chloroplast Hsp70; Provisional 1e-112
PLN03184673 PLN03184, PLN03184, chloroplast Hsp70; Provisional 1e-112
cd10170369 cd10170, HSP70_NBD, Nucleotide-binding domain of t 1e-108
cd10170369 cd10170, HSP70_NBD, Nucleotide-binding domain of t 1e-108
PTZ00186657 PTZ00186, PTZ00186, heat shock 70 kDa precursor pr 1e-103
PTZ00186657 PTZ00186, PTZ00186, heat shock 70 kDa precursor pr 1e-103
TIGR03403382 TIGR03403, nifS_epsilon, cysteine desulfurase, Nif 1e-102
TIGR03403382 TIGR03403, nifS_epsilon, cysteine desulfurase, Nif 1e-101
PTZ00009653 PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro 1e-101
PTZ00009653 PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro 1e-101
cd10234376 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding d 4e-95
cd10234376 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding d 4e-95
pfam00266370 pfam00266, Aminotran_5, Aminotransferase class-V 4e-92
cd10235339 cd10235, HscC_like_NBD, Nucleotide-binding domain 1e-91
cd10235339 cd10235, HscC_like_NBD, Nucleotide-binding domain 1e-91
pfam00266370 pfam00266, Aminotran_5, Aminotransferase class-V 4e-91
cd11733377 cd11733, HSPA9-like_NBD, Nucleotide-binding domain 4e-88
cd11733377 cd11733, HSPA9-like_NBD, Nucleotide-binding domain 4e-88
cd11734373 cd11734, Ssq1_like_NBD, Nucleotide-binding domain 5e-86
cd11734373 cd11734, Ssq1_like_NBD, Nucleotide-binding domain 5e-86
PRK02948381 PRK02948, PRK02948, cysteine desulfurase; Provisio 2e-84
PRK02948381 PRK02948, PRK02948, cysteine desulfurase; Provisio 3e-82
cd10241374 cd10241, HSPA5-like_NBD, Nucleotide-binding domain 1e-79
cd10241374 cd10241, HSPA5-like_NBD, Nucleotide-binding domain 1e-79
PRK11325127 PRK11325, PRK11325, scaffold protein; Provisional 3e-68
PRK11325127 PRK11325, PRK11325, scaffold protein; Provisional 3e-68
PRK00110245 PRK00110, PRK00110, hypothetical protein; Validate 3e-67
cd10233376 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding 1e-66
cd10233376 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding 1e-66
pfam01709234 pfam01709, Transcrip_reg, Transcriptional regulato 5e-63
cd10237417 cd10237, HSPA13-like_NBD, Nucleotide-binding domai 6e-62
cd10237417 cd10237, HSPA13-like_NBD, Nucleotide-binding domai 6e-62
COG0217241 COG0217, COG0217, Uncharacterized conserved protei 5e-59
COG0520405 COG0520, csdA, Selenocysteine lyase/Cysteine desul 1e-56
TIGR01999124 TIGR01999, iscU, FeS cluster assembly scaffold Isc 1e-55
TIGR01999124 TIGR01999, iscU, FeS cluster assembly scaffold Isc 1e-55
COG0520405 COG0520, csdA, Selenocysteine lyase/Cysteine desul 4e-55
cd10228381 cd10228, HSPA4_like_NDB, Nucleotide-binding domain 3e-54
cd10228381 cd10228, HSPA4_like_NDB, Nucleotide-binding domain 3e-54
cd06453373 cd06453, SufS_like, Cysteine desulfurase (SufS)-li 8e-54
cd06453373 cd06453, SufS_like, Cysteine desulfurase (SufS)-li 1e-53
TIGR01033238 TIGR01033, TIGR01033, DNA-binding regulatory prote 1e-51
PRK12378235 PRK12378, PRK12378, hypothetical protein; Provisio 2e-48
cd10238375 cd10238, HSPA14-like_NBD, Nucleotide-binding domai 1e-47
cd10238375 cd10238, HSPA14-like_NBD, Nucleotide-binding domai 1e-47
pfam01592126 pfam01592, NifU_N, NifU-like N terminal domain 4e-47
pfam01592126 pfam01592, NifU_N, NifU-like N terminal domain 4e-47
TIGR01977376 TIGR01977, am_tr_V_EF2568, cysteine desulfurase fa 4e-46
TIGR01977376 TIGR01977, am_tr_V_EF2568, cysteine desulfurase fa 3e-45
cd10230388 cd10230, HYOU1-like_NBD, Nucleotide-binding domain 2e-42
cd10230388 cd10230, HYOU1-like_NBD, Nucleotide-binding domain 2e-42
TIGR01979403 TIGR01979, sufS, cysteine desulfurases, SufSfamily 9e-41
TIGR01979403 TIGR01979, sufS, cysteine desulfurases, SufSfamily 3e-40
COG0822150 COG0822, IscU, NifU homolog involved in Fe-S clust 5e-39
COG0822150 COG0822, IscU, NifU homolog involved in Fe-S clust 5e-39
cd11739383 cd11739, HSPH1_NBD, Nucleotide-binding domain of H 1e-38
cd11739383 cd11739, HSPH1_NBD, Nucleotide-binding domain of H 1e-38
cd10232386 cd10232, ScSsz1p_like_NBD, Nucleotide-binding doma 4e-38
cd10232386 cd10232, ScSsz1p_like_NBD, Nucleotide-binding doma 4e-38
cd11732377 cd11732, HSP105-110_like_NBD, Nucleotide-binding d 5e-38
cd11732377 cd11732, HSP105-110_like_NBD, Nucleotide-binding d 5e-38
cd06664123 cd06664, IscU_like, Iron-sulfur cluster scaffold-l 4e-37
cd06664123 cd06664, IscU_like, Iron-sulfur cluster scaffold-l 4e-37
TIGR03419121 TIGR03419, NifU_clost, FeS cluster assembly scaffo 3e-36
TIGR03419121 TIGR03419, NifU_clost, FeS cluster assembly scaffo 3e-36
cd11737383 cd11737, HSPA4_NBD, Nucleotide-binding domain of H 7e-36
cd11737383 cd11737, HSPA4_NBD, Nucleotide-binding domain of H 7e-36
TIGR02007110 TIGR02007, fdx_isc, ferredoxin, 2Fe-2S type, ISC s 2e-33
cd11738383 cd11738, HSPA4L_NBD, Nucleotide-binding domain of 1e-32
cd11738383 cd11738, HSPA4L_NBD, Nucleotide-binding domain of 1e-32
TIGR02007110 TIGR02007, fdx_isc, ferredoxin, 2Fe-2S type, ISC s 2e-31
TIGR02000290 TIGR02000, NifU_proper, Fe-S cluster assembly prot 3e-29
TIGR02000290 TIGR02000, NifU_proper, Fe-S cluster assembly prot 3e-29
COG0633102 COG0633, Fdx, Ferredoxin [Energy production and co 3e-21
TIGR03392398 TIGR03392, FeS_syn_CsdA, cysteine desulfurase, cat 4e-21
PRK10874401 PRK10874, PRK10874, cysteine sulfinate desulfinase 1e-20
PRK10874401 PRK10874, PRK10874, cysteine sulfinate desulfinase 1e-20
TIGR03392398 TIGR03392, FeS_syn_CsdA, cysteine desulfurase, cat 2e-20
PLN02855424 PLN02855, PLN02855, Bifunctional selenocysteine ly 4e-20
PLN02855424 PLN02855, PLN02855, Bifunctional selenocysteine ly 9e-20
PRK09295406 PRK09295, PRK09295, bifunctional cysteine desulfur 2e-19
PRK09295406 PRK09295, PRK09295, bifunctional cysteine desulfur 2e-19
COG0633102 COG0633, Fdx, Ferredoxin [Energy production and co 1e-18
pfam0152191 pfam01521, Fe-S_biosyn, Iron-sulphur cluster biosy 1e-18
pfam0152191 pfam01521, Fe-S_biosyn, Iron-sulphur cluster biosy 1e-18
TIGR02011105 TIGR02011, IscA, iron-sulfur cluster assembly prot 3e-18
TIGR02011105 TIGR02011, IscA, iron-sulfur cluster assembly prot 3e-18
TIGR01976397 TIGR01976, am_tr_V_VC1184, cysteine desulfurase fa 6e-18
TIGR01976397 TIGR01976, am_tr_V_VC1184, cysteine desulfurase fa 6e-17
COG0316110 COG0316, sufA, Fe-S cluster assembly scaffold prot 2e-16
COG0316110 COG0316, sufA, Fe-S cluster assembly scaffold prot 2e-16
cd10229404 cd10229, HSPA12_like_NBD, Nucleotide-binding domai 6e-16
cd10229404 cd10229, HSPA12_like_NBD, Nucleotide-binding domai 6e-16
PLN02593117 PLN02593, PLN02593, adrenodoxin-like ferredoxin pr 7e-16
TIGR01994137 TIGR01994, SUF_scaf_2, SUF system FeS assembly pro 9e-16
TIGR01994137 TIGR01994, SUF_scaf_2, SUF system FeS assembly pro 9e-16
PRK09502107 PRK09502, iscA, iron-sulfur cluster assembly prote 1e-15
PRK09502107 PRK09502, iscA, iron-sulfur cluster assembly prote 1e-15
TIGR00049105 TIGR00049, TIGR00049, Iron-sulfur cluster assembly 4e-15
TIGR00049105 TIGR00049, TIGR00049, Iron-sulfur cluster assembly 4e-15
cd10231415 cd10231, YegD_like, Escherichia coli YegD, a putat 7e-14
cd10231415 cd10231, YegD_like, Escherichia coli YegD, a putat 7e-14
PLN02593117 PLN02593, PLN02593, adrenodoxin-like ferredoxin pr 1e-13
PRK03578176 PRK03578, hscB, co-chaperone HscB; Provisional 4e-13
PRK03578176 PRK03578, hscB, co-chaperone HscB; Provisional 4e-13
cd01494170 cd01494, AAT_I, Aspartate aminotransferase (AAT) s 1e-12
cd01494170 cd01494, AAT_I, Aspartate aminotransferase (AAT) s 1e-12
PRK01773173 PRK01773, hscB, co-chaperone HscB; Provisional 3e-12
PRK01773173 PRK01773, hscB, co-chaperone HscB; Provisional 3e-12
COG0076460 COG0076, GadB, Glutamate decarboxylase and related 2e-11
COG0076460 COG0076, GadB, Glutamate decarboxylase and related 2e-11
TIGR00714155 TIGR00714, hscB, Fe-S protein assembly co-chaperon 3e-11
TIGR00714155 TIGR00714, hscB, Fe-S protein assembly co-chaperon 3e-11
PTZ00490143 PTZ00490, PTZ00490, Ferredoxin superfamily; Provis 4e-11
PRK05014171 PRK05014, hscB, co-chaperone HscB; Provisional 1e-10
PRK05014171 PRK05014, hscB, co-chaperone HscB; Provisional 1e-10
TIGR04343370 TIGR04343, egtE_PLP_lyase, ergothioneine biosynthe 2e-10
TIGR04343370 TIGR04343, egtE_PLP_lyase, ergothioneine biosynthe 2e-10
TIGR01997107 TIGR01997, sufA_proteo, FeS assembly scaffold SufA 5e-09
TIGR01997107 TIGR01997, sufA_proteo, FeS assembly scaffold SufA 5e-09
cd0020784 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding 6e-09
COG1076174 COG1076, DjlA, DnaJ-domain-containing proteins 1 [ 9e-09
COG1076174 COG1076, DjlA, DnaJ-domain-containing proteins 1 [ 9e-09
PTZ00490143 PTZ00490, PTZ00490, Ferredoxin superfamily; Provis 1e-08
PRK00294173 PRK00294, hscB, co-chaperone HscB; Provisional 8e-08
PRK00294173 PRK00294, hscB, co-chaperone HscB; Provisional 8e-08
PRK09504122 PRK09504, sufA, iron-sulfur cluster assembly scaff 8e-08
PRK09504122 PRK09504, sufA, iron-sulfur cluster assembly scaff 8e-08
TIGR03301355 TIGR03301, PhnW-AepZ, 2-aminoethylphosphonate amin 1e-07
TIGR03301355 TIGR03301, PhnW-AepZ, 2-aminoethylphosphonate amin 1e-07
TIGR00904333 TIGR00904, mreB, cell shape determining protein, M 1e-07
TIGR00904333 TIGR00904, mreB, cell shape determining protein, M 1e-07
cd06450345 cd06450, DOPA_deC_like, DOPA decarboxylase family 2e-07
cd06450345 cd06450, DOPA_deC_like, DOPA decarboxylase family 2e-07
TIGR03812373 TIGR03812, tyr_de_CO2_Arch, tyrosine decarboxylase 5e-07
TIGR03812373 TIGR03812, tyr_de_CO2_Arch, tyrosine decarboxylase 5e-07
cd0020784 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding 2e-06
COG0075383 COG0075, COG0075, Serine-pyruvate aminotransferase 2e-06
COG0075383 COG0075, COG0075, Serine-pyruvate aminotransferase 2e-06
COG2008342 COG2008, GLY1, Threonine aldolase [Amino acid tran 3e-06
COG2008342 COG2008, GLY1, Threonine aldolase [Amino acid tran 3e-06
pfam0011177 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster bindin 3e-06
PRK13520371 PRK13520, PRK13520, L-tyrosine decarboxylase; Prov 5e-06
PRK13520371 PRK13520, PRK13520, L-tyrosine decarboxylase; Prov 5e-06
cd06451356 cd06451, AGAT_like, Alanine-glyoxylate aminotransf 1e-05
cd06451356 cd06451, AGAT_like, Alanine-glyoxylate aminotransf 1e-05
TIGR02529239 TIGR02529, EutJ, ethanolamine utilization protein 2e-05
TIGR02529239 TIGR02529, EutJ, ethanolamine utilization protein 2e-05
cd10225320 cd10225, MreB_like, MreB and similar proteins 3e-05
cd10225320 cd10225, MreB_like, MreB and similar proteins 3e-05
COG1077342 COG1077, MreB, Actin-like ATPase involved in cell 4e-05
COG1077342 COG1077, MreB, Actin-like ATPase involved in cell 4e-05
PRK15080267 PRK15080, PRK15080, ethanolamine utilization prote 4e-05
PRK15080267 PRK15080, PRK15080, ethanolamine utilization prote 4e-05
pfam0011177 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster bindin 2e-04
pfam06723327 pfam06723, MreB_Mbl, MreB/Mbl protein 2e-04
pfam06723327 pfam06723, MreB_Mbl, MreB/Mbl protein 2e-04
PRK13928336 PRK13928, PRK13928, rod shape-determining protein 4e-04
PRK13928336 PRK13928, PRK13928, rod shape-determining protein 4e-04
PLN03082163 PLN03082, PLN03082, Iron-sulfur cluster assembly; 6e-04
PLN03082163 PLN03082, PLN03082, Iron-sulfur cluster assembly; 6e-04
pfam01212288 pfam01212, Beta_elim_lyase, Beta-eliminating lyase 7e-04
pfam01212288 pfam01212, Beta_elim_lyase, Beta-eliminating lyase 7e-04
COG2871 410 COG2871, NqrF, Na+-transporting NADH:ubiquinone ox 8e-04
COG4820277 COG4820, EutJ, Ethanolamine utilization protein, p 9e-04
COG4820277 COG4820, EutJ, Ethanolamine utilization protein, p 9e-04
TIGR02539370 TIGR02539, SepCysS, O-phospho-L-seryl-tRNA:Cys-tRN 0.002
TIGR02539370 TIGR02539, SepCysS, O-phospho-L-seryl-tRNA:Cys-tRN 0.002
PRK13929335 PRK13929, PRK13929, rod-share determining protein 0.003
PRK13929335 PRK13929, PRK13929, rod-share determining protein 0.003
TIGR01941 405 TIGR01941, nqrF, NADH:ubiquinone oxidoreductase, N 0.004
>gnl|CDD|235360 PRK05183, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
 Score =  749 bits (1936), Expect = 0.0
 Identities = 289/517 (55%), Positives = 363/517 (70%), Gaps = 13/517 (2%)

Query: 620  MALLQISEPDDISVKN-KCVSIGIDFGTTNSLVAIVRNNIPEVLKDKYGYFLIPSIVRYL 678
            MALLQISEP   +  + + +++GID GTTNSLVA VR+   EVL D+ G  L+PS+VRYL
Sbjct: 1    MALLQISEPGQSAAPHQRRLAVGIDLGTTNSLVATVRSGQAEVLPDEQGRVLLPSVVRYL 60

Query: 679  PDGKIYVGKKAKITQNIDPKNTISSIKRFIARDLKNINTN--SFPYDFQ-NKFGMLHIKT 735
             DG I VG +A+     DPKNTISS+KRF+ R L +I       PY F  ++ GM  I+T
Sbjct: 61   EDG-IEVGYEARANAAQDPKNTISSVKRFMGRSLADIQQRYPHLPYQFVASENGMPLIRT 119

Query: 736  ISGIKSPIEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKNAAKLAGLNV 795
              G+KSP+E+SA+I   L++ AE  +   + GAVITVPAYF+D QRQ TK+AA+LAGLNV
Sbjct: 120  AQGLKSPVEVSAEILKALRQRAEETLGGELDGAVITVPAYFDDAQRQATKDAARLAGLNV 179

Query: 796  LRLLNEPTSAAIAYKLDKNIFEGIFAVYDLGGGTFDISILKFKNGVFKVLSVGGDSNLGG 855
            LRLLNEPT+AAIAY LD    EG+ AVYDLGGGTFDISIL+   GVF+VL+ GGDS LGG
Sbjct: 180  LRLLNEPTAAAIAYGLDSGQ-EGVIAVYDLGGGTFDISILRLSKGVFEVLATGGDSALGG 238

Query: 856  DDFDYCLFSWIVKNAFLK-KLSYKDVNILMIKSREIKELLSYQSSVKLNVKLSDKKIVNI 914
            DDFD+ L  WI++ A L  +L  +D  +L+  +R  KE LS   SV+++V L        
Sbjct: 239  DDFDHLLADWILEQAGLSPRLDPEDQRLLLDAARAAKEALSDADSVEVSVALWQG----- 293

Query: 915  TIDMKQFFTITQHLVNRTILLSSKALMDANLTIKDINNVILVGGSTRMKHIHEGVSNFFK 974
             I  +QF  +   LV RT+L   +AL DA +   ++  V++VGGSTR+  + E V  FF 
Sbjct: 294  EITREQFNALIAPLVKRTLLACRRALRDAGVEADEVKEVVMVGGSTRVPLVREAVGEFFG 353

Query: 975  TTLLTSIDPDKAVVFGAAIQANFLSGNRGIDDNFLLLDVIPLSLGIETIGGLVEKIIFRN 1034
             T LTSIDPDK V  GAAIQA+ L+GN+  D + LLLDVIPLSLG+ET+GGLVEKII RN
Sbjct: 354  RTPLTSIDPDKVVAIGAAIQADILAGNKP-DSDMLLLDVIPLSLGLETMGGLVEKIIPRN 412

Query: 1035 TTIPCSYSGEFTTFKDNQTAIAIKVVQGEDELVKNCQVLANFELRDIPPMPAGRARIKVT 1094
            TTIP + + EFTTFKD QTA+AI VVQGE ELV +C+ LA FELR IPPM AG ARI+VT
Sbjct: 413  TTIPVARAQEFTTFKDGQTAMAIHVVQGERELVADCRSLARFELRGIPPMAAGAARIRVT 472

Query: 1095 YQVDADGLLSIFAYEKISGKKKFITIKPFYNMNLDEI 1131
            +QVDADGLLS+ A EK +G +  I +KP Y +  DEI
Sbjct: 473  FQVDADGLLSVTAMEKSTGVEASIQVKPSYGLTDDEI 509


Length = 616

>gnl|CDD|235360 PRK05183, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|184450 PRK14012, PRK14012, cysteine desulfurase; Provisional Back     alignment and domain information
>gnl|CDD|184450 PRK14012, PRK14012, cysteine desulfurase; Provisional Back     alignment and domain information
>gnl|CDD|233673 TIGR01991, HscA, Fe-S protein assembly chaperone HscA Back     alignment and domain information
>gnl|CDD|233673 TIGR01991, HscA, Fe-S protein assembly chaperone HscA Back     alignment and domain information
>gnl|CDD|131061 TIGR02006, IscS, cysteine desulfurase IscS Back     alignment and domain information
>gnl|CDD|131061 TIGR02006, IscS, cysteine desulfurase IscS Back     alignment and domain information
>gnl|CDD|224029 COG1104, NifS, Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224029 COG1104, NifS, Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|178257 PLN02651, PLN02651, cysteine desulfurase Back     alignment and domain information
>gnl|CDD|178257 PLN02651, PLN02651, cysteine desulfurase Back     alignment and domain information
>gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein Back     alignment and domain information
>gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein Back     alignment and domain information
>gnl|CDD|132443 TIGR03402, FeS_nifS, cysteine desulfurase NifS Back     alignment and domain information
>gnl|CDD|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|132443 TIGR03402, FeS_nifS, cysteine desulfurase NifS Back     alignment and domain information
>gnl|CDD|212678 cd10236, HscA_like_NBD, Nucleotide-binding domain of HscA and similar proteins Back     alignment and domain information
>gnl|CDD|212678 cd10236, HscA_like_NBD, Nucleotide-binding domain of HscA and similar proteins Back     alignment and domain information
>gnl|CDD|233830 TIGR02350, prok_dnaK, chaperone protein DnaK Back     alignment and domain information
>gnl|CDD|233830 TIGR02350, prok_dnaK, chaperone protein DnaK Back     alignment and domain information
>gnl|CDD|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|163191 TIGR03235, DNA_S_dndA, cysteine desulfurase DndA Back     alignment and domain information
>gnl|CDD|163191 TIGR03235, DNA_S_dndA, cysteine desulfurase DndA Back     alignment and domain information
>gnl|CDD|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|214360 CHL00094, dnaK, heat shock protein 70 Back     alignment and domain information
>gnl|CDD|214360 CHL00094, dnaK, heat shock protein 70 Back     alignment and domain information
>gnl|CDD|234955 PRK01433, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|234955 PRK01433, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>gnl|CDD|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>gnl|CDD|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional Back     alignment and domain information
>gnl|CDD|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional Back     alignment and domain information
>gnl|CDD|212667 cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family Back     alignment and domain information
>gnl|CDD|212667 cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family Back     alignment and domain information
>gnl|CDD|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>gnl|CDD|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>gnl|CDD|132444 TIGR03403, nifS_epsilon, cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>gnl|CDD|132444 TIGR03403, nifS_epsilon, cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional Back     alignment and domain information
>gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional Back     alignment and domain information
>gnl|CDD|212676 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding domain of human HSPA9 and similar proteins Back     alignment and domain information
>gnl|CDD|212676 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding domain of human HSPA9 and similar proteins Back     alignment and domain information
>gnl|CDD|215829 pfam00266, Aminotran_5, Aminotransferase class-V Back     alignment and domain information
>gnl|CDD|212677 cd10235, HscC_like_NBD, Nucleotide-binding domain of Escherichia coli HscC and similar proteins Back     alignment and domain information
>gnl|CDD|212677 cd10235, HscC_like_NBD, Nucleotide-binding domain of Escherichia coli HscC and similar proteins Back     alignment and domain information
>gnl|CDD|215829 pfam00266, Aminotran_5, Aminotransferase class-V Back     alignment and domain information
>gnl|CDD|212683 cd11733, HSPA9-like_NBD, Nucleotide-binding domain of human HSPA9, Escherichia coli DnaK, and similar proteins Back     alignment and domain information
>gnl|CDD|212683 cd11733, HSPA9-like_NBD, Nucleotide-binding domain of human HSPA9, Escherichia coli DnaK, and similar proteins Back     alignment and domain information
>gnl|CDD|212684 cd11734, Ssq1_like_NBD, Nucleotide-binding domain of Saccharomyces cerevisiae Ssq1 and similar proteins Back     alignment and domain information
>gnl|CDD|212684 cd11734, Ssq1_like_NBD, Nucleotide-binding domain of Saccharomyces cerevisiae Ssq1 and similar proteins Back     alignment and domain information
>gnl|CDD|179511 PRK02948, PRK02948, cysteine desulfurase; Provisional Back     alignment and domain information
>gnl|CDD|179511 PRK02948, PRK02948, cysteine desulfurase; Provisional Back     alignment and domain information
>gnl|CDD|212681 cd10241, HSPA5-like_NBD, Nucleotide-binding domain of human HSPA5 and similar proteins Back     alignment and domain information
>gnl|CDD|212681 cd10241, HSPA5-like_NBD, Nucleotide-binding domain of human HSPA5 and similar proteins Back     alignment and domain information
>gnl|CDD|183087 PRK11325, PRK11325, scaffold protein; Provisional Back     alignment and domain information
>gnl|CDD|183087 PRK11325, PRK11325, scaffold protein; Provisional Back     alignment and domain information
>gnl|CDD|234640 PRK00110, PRK00110, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins Back     alignment and domain information
>gnl|CDD|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins Back     alignment and domain information
>gnl|CDD|216656 pfam01709, Transcrip_reg, Transcriptional regulator Back     alignment and domain information
>gnl|CDD|212679 cd10237, HSPA13-like_NBD, Nucleotide-binding domain of human HSPA13 and similar proteins Back     alignment and domain information
>gnl|CDD|212679 cd10237, HSPA13-like_NBD, Nucleotide-binding domain of human HSPA13 and similar proteins Back     alignment and domain information
>gnl|CDD|223295 COG0217, COG0217, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|223594 COG0520, csdA, Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|188192 TIGR01999, iscU, FeS cluster assembly scaffold IscU Back     alignment and domain information
>gnl|CDD|188192 TIGR01999, iscU, FeS cluster assembly scaffold IscU Back     alignment and domain information
>gnl|CDD|223594 COG0520, csdA, Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|212670 cd10228, HSPA4_like_NDB, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4 and similar proteins Back     alignment and domain information
>gnl|CDD|212670 cd10228, HSPA4_like_NDB, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4 and similar proteins Back     alignment and domain information
>gnl|CDD|99746 cd06453, SufS_like, Cysteine desulfurase (SufS)-like Back     alignment and domain information
>gnl|CDD|99746 cd06453, SufS_like, Cysteine desulfurase (SufS)-like Back     alignment and domain information
>gnl|CDD|233240 TIGR01033, TIGR01033, DNA-binding regulatory protein, YebC/PmpR family Back     alignment and domain information
>gnl|CDD|237084 PRK12378, PRK12378, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|212680 cd10238, HSPA14-like_NBD, Nucleotide-binding domain of human HSPA14 and similar proteins Back     alignment and domain information
>gnl|CDD|212680 cd10238, HSPA14-like_NBD, Nucleotide-binding domain of human HSPA14 and similar proteins Back     alignment and domain information
>gnl|CDD|216592 pfam01592, NifU_N, NifU-like N terminal domain Back     alignment and domain information
>gnl|CDD|216592 pfam01592, NifU_N, NifU-like N terminal domain Back     alignment and domain information
>gnl|CDD|131032 TIGR01977, am_tr_V_EF2568, cysteine desulfurase family protein Back     alignment and domain information
>gnl|CDD|131032 TIGR01977, am_tr_V_EF2568, cysteine desulfurase family protein Back     alignment and domain information
>gnl|CDD|212672 cd10230, HYOU1-like_NBD, Nucleotide-binding domain of human HYOU1 and similar proteins Back     alignment and domain information
>gnl|CDD|212672 cd10230, HYOU1-like_NBD, Nucleotide-binding domain of human HYOU1 and similar proteins Back     alignment and domain information
>gnl|CDD|131034 TIGR01979, sufS, cysteine desulfurases, SufSfamily Back     alignment and domain information
>gnl|CDD|131034 TIGR01979, sufS, cysteine desulfurases, SufSfamily Back     alignment and domain information
>gnl|CDD|223892 COG0822, IscU, NifU homolog involved in Fe-S cluster formation [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223892 COG0822, IscU, NifU homolog involved in Fe-S cluster formation [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|212689 cd11739, HSPH1_NBD, Nucleotide-binding domain of HSPH1 Back     alignment and domain information
>gnl|CDD|212689 cd11739, HSPH1_NBD, Nucleotide-binding domain of HSPH1 Back     alignment and domain information
>gnl|CDD|212674 cd10232, ScSsz1p_like_NBD, Nucleotide-binding domain of Saccharmomyces cerevisiae Ssz1pp and similar proteins Back     alignment and domain information
>gnl|CDD|212674 cd10232, ScSsz1p_like_NBD, Nucleotide-binding domain of Saccharmomyces cerevisiae Ssz1pp and similar proteins Back     alignment and domain information
>gnl|CDD|212682 cd11732, HSP105-110_like_NBD, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4, HYOU1, and similar proteins Back     alignment and domain information
>gnl|CDD|212682 cd11732, HSP105-110_like_NBD, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4, HYOU1, and similar proteins Back     alignment and domain information
>gnl|CDD|143480 cd06664, IscU_like, Iron-sulfur cluster scaffold-like proteins Back     alignment and domain information
>gnl|CDD|143480 cd06664, IscU_like, Iron-sulfur cluster scaffold-like proteins Back     alignment and domain information
>gnl|CDD|132460 TIGR03419, NifU_clost, FeS cluster assembly scaffold protein NifU, Clostridium type Back     alignment and domain information
>gnl|CDD|132460 TIGR03419, NifU_clost, FeS cluster assembly scaffold protein NifU, Clostridium type Back     alignment and domain information
>gnl|CDD|212687 cd11737, HSPA4_NBD, Nucleotide-binding domain of HSPA4 Back     alignment and domain information
>gnl|CDD|212687 cd11737, HSPA4_NBD, Nucleotide-binding domain of HSPA4 Back     alignment and domain information
>gnl|CDD|131062 TIGR02007, fdx_isc, ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information
>gnl|CDD|212688 cd11738, HSPA4L_NBD, Nucleotide-binding domain of HSPA4L Back     alignment and domain information
>gnl|CDD|212688 cd11738, HSPA4L_NBD, Nucleotide-binding domain of HSPA4L Back     alignment and domain information
>gnl|CDD|131062 TIGR02007, fdx_isc, ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information
>gnl|CDD|233679 TIGR02000, NifU_proper, Fe-S cluster assembly protein NifU Back     alignment and domain information
>gnl|CDD|233679 TIGR02000, NifU_proper, Fe-S cluster assembly protein NifU Back     alignment and domain information
>gnl|CDD|223706 COG0633, Fdx, Ferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|132433 TIGR03392, FeS_syn_CsdA, cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>gnl|CDD|182799 PRK10874, PRK10874, cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>gnl|CDD|182799 PRK10874, PRK10874, cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>gnl|CDD|132433 TIGR03392, FeS_syn_CsdA, cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>gnl|CDD|215460 PLN02855, PLN02855, Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>gnl|CDD|215460 PLN02855, PLN02855, Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>gnl|CDD|181766 PRK09295, PRK09295, bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>gnl|CDD|181766 PRK09295, PRK09295, bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>gnl|CDD|223706 COG0633, Fdx, Ferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|110518 pfam01521, Fe-S_biosyn, Iron-sulphur cluster biosynthesis Back     alignment and domain information
>gnl|CDD|110518 pfam01521, Fe-S_biosyn, Iron-sulphur cluster biosynthesis Back     alignment and domain information
>gnl|CDD|213674 TIGR02011, IscA, iron-sulfur cluster assembly protein IscA Back     alignment and domain information
>gnl|CDD|213674 TIGR02011, IscA, iron-sulfur cluster assembly protein IscA Back     alignment and domain information
>gnl|CDD|233664 TIGR01976, am_tr_V_VC1184, cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>gnl|CDD|233664 TIGR01976, am_tr_V_VC1184, cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>gnl|CDD|223393 COG0316, sufA, Fe-S cluster assembly scaffold protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223393 COG0316, sufA, Fe-S cluster assembly scaffold protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|212671 cd10229, HSPA12_like_NBD, Nucleotide-binding domain of HSPA12A, HSPA12B and similar proteins Back     alignment and domain information
>gnl|CDD|212671 cd10229, HSPA12_like_NBD, Nucleotide-binding domain of HSPA12A, HSPA12B and similar proteins Back     alignment and domain information
>gnl|CDD|178203 PLN02593, PLN02593, adrenodoxin-like ferredoxin protein Back     alignment and domain information
>gnl|CDD|233676 TIGR01994, SUF_scaf_2, SUF system FeS assembly protein, NifU family Back     alignment and domain information
>gnl|CDD|233676 TIGR01994, SUF_scaf_2, SUF system FeS assembly protein, NifU family Back     alignment and domain information
>gnl|CDD|181914 PRK09502, iscA, iron-sulfur cluster assembly protein; Provisional Back     alignment and domain information
>gnl|CDD|181914 PRK09502, iscA, iron-sulfur cluster assembly protein; Provisional Back     alignment and domain information
>gnl|CDD|232799 TIGR00049, TIGR00049, Iron-sulfur cluster assembly accessory protein Back     alignment and domain information
>gnl|CDD|232799 TIGR00049, TIGR00049, Iron-sulfur cluster assembly accessory protein Back     alignment and domain information
>gnl|CDD|212673 cd10231, YegD_like, Escherichia coli YegD, a putative chaperone protein, and related proteins Back     alignment and domain information
>gnl|CDD|212673 cd10231, YegD_like, Escherichia coli YegD, a putative chaperone protein, and related proteins Back     alignment and domain information
>gnl|CDD|178203 PLN02593, PLN02593, adrenodoxin-like ferredoxin protein Back     alignment and domain information
>gnl|CDD|235133 PRK03578, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|235133 PRK03578, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|179335 PRK01773, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|179335 PRK01773, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|223154 COG0076, GadB, Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223154 COG0076, GadB, Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|211601 TIGR00714, hscB, Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>gnl|CDD|211601 TIGR00714, hscB, Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>gnl|CDD|185668 PTZ00490, PTZ00490, Ferredoxin superfamily; Provisional Back     alignment and domain information
>gnl|CDD|179914 PRK05014, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|179914 PRK05014, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|234554 TIGR04343, egtE_PLP_lyase, ergothioneine biosynthesis PLP-dependent enzyme EgtE Back     alignment and domain information
>gnl|CDD|234554 TIGR04343, egtE_PLP_lyase, ergothioneine biosynthesis PLP-dependent enzyme EgtE Back     alignment and domain information
>gnl|CDD|131052 TIGR01997, sufA_proteo, FeS assembly scaffold SufA Back     alignment and domain information
>gnl|CDD|131052 TIGR01997, sufA_proteo, FeS assembly scaffold SufA Back     alignment and domain information
>gnl|CDD|238126 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|185668 PTZ00490, PTZ00490, Ferredoxin superfamily; Provisional Back     alignment and domain information
>gnl|CDD|166894 PRK00294, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|166894 PRK00294, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|181915 PRK09504, sufA, iron-sulfur cluster assembly scaffold protein; Provisional Back     alignment and domain information
>gnl|CDD|181915 PRK09504, sufA, iron-sulfur cluster assembly scaffold protein; Provisional Back     alignment and domain information
>gnl|CDD|213793 TIGR03301, PhnW-AepZ, 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>gnl|CDD|213793 TIGR03301, PhnW-AepZ, 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>gnl|CDD|129982 TIGR00904, mreB, cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>gnl|CDD|129982 TIGR00904, mreB, cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>gnl|CDD|99743 cd06450, DOPA_deC_like, DOPA decarboxylase family Back     alignment and domain information
>gnl|CDD|99743 cd06450, DOPA_deC_like, DOPA decarboxylase family Back     alignment and domain information
>gnl|CDD|234361 TIGR03812, tyr_de_CO2_Arch, tyrosine decarboxylase MnfA Back     alignment and domain information
>gnl|CDD|234361 TIGR03812, tyr_de_CO2_Arch, tyrosine decarboxylase MnfA Back     alignment and domain information
>gnl|CDD|238126 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|223153 COG0075, COG0075, Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223153 COG0075, COG0075, Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224919 COG2008, GLY1, Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224919 COG2008, GLY1, Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|215725 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|237409 PRK13520, PRK13520, L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|237409 PRK13520, PRK13520, L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|99744 cd06451, AGAT_like, Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>gnl|CDD|99744 cd06451, AGAT_like, Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>gnl|CDD|213718 TIGR02529, EutJ, ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>gnl|CDD|213718 TIGR02529, EutJ, ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>gnl|CDD|212668 cd10225, MreB_like, MreB and similar proteins Back     alignment and domain information
>gnl|CDD|212668 cd10225, MreB_like, MreB and similar proteins Back     alignment and domain information
>gnl|CDD|224003 COG1077, MreB, Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224003 COG1077, MreB, Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|237904 PRK15080, PRK15080, ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>gnl|CDD|237904 PRK15080, PRK15080, ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>gnl|CDD|215725 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|115385 pfam06723, MreB_Mbl, MreB/Mbl protein Back     alignment and domain information
>gnl|CDD|115385 pfam06723, MreB_Mbl, MreB/Mbl protein Back     alignment and domain information
>gnl|CDD|237563 PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>gnl|CDD|237563 PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>gnl|CDD|215564 PLN03082, PLN03082, Iron-sulfur cluster assembly; Provisional Back     alignment and domain information
>gnl|CDD|215564 PLN03082, PLN03082, Iron-sulfur cluster assembly; Provisional Back     alignment and domain information
>gnl|CDD|216367 pfam01212, Beta_elim_lyase, Beta-eliminating lyase Back     alignment and domain information
>gnl|CDD|216367 pfam01212, Beta_elim_lyase, Beta-eliminating lyase Back     alignment and domain information
>gnl|CDD|225426 COG2871, NqrF, Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|227157 COG4820, EutJ, Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|227157 COG4820, EutJ, Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|233915 TIGR02539, SepCysS, O-phospho-L-seryl-tRNA:Cys-tRNA synthase Back     alignment and domain information
>gnl|CDD|233915 TIGR02539, SepCysS, O-phospho-L-seryl-tRNA:Cys-tRNA synthase Back     alignment and domain information
>gnl|CDD|184403 PRK13929, PRK13929, rod-share determining protein MreBH; Provisional Back     alignment and domain information
>gnl|CDD|184403 PRK13929, PRK13929, rod-share determining protein MreBH; Provisional Back     alignment and domain information
>gnl|CDD|130996 TIGR01941, nqrF, NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 2602
KOG0100|consensus663 100.0
KOG0100|consensus663 100.0
KOG0102|consensus640 100.0
PTZ00186657 heat shock 70 kDa precursor protein; Provisional 100.0
PRK13410668 molecular chaperone DnaK; Provisional 100.0
TIGR01991599 HscA Fe-S protein assembly chaperone HscA. The Hea 100.0
PRK05183616 hscA chaperone protein HscA; Provisional 100.0
PRK13411653 molecular chaperone DnaK; Provisional 100.0
KOG0102|consensus640 100.0
PTZ00186657 heat shock 70 kDa precursor protein; Provisional 100.0
PTZ00400663 DnaK-type molecular chaperone; Provisional 100.0
PLN03184673 chloroplast Hsp70; Provisional 100.0
KOG0101|consensus620 100.0
PRK01433595 hscA chaperone protein HscA; Provisional 100.0
PRK00290627 dnaK molecular chaperone DnaK; Provisional 100.0
PTZ00009653 heat shock 70 kDa protein; Provisional 100.0
TIGR01991599 HscA Fe-S protein assembly chaperone HscA. The Hea 100.0
TIGR02350595 prok_dnaK chaperone protein DnaK. Members of this 100.0
PRK13410668 molecular chaperone DnaK; Provisional 100.0
PRK05183616 hscA chaperone protein HscA; Provisional 100.0
CHL00094621 dnaK heat shock protein 70 100.0
PRK13411653 molecular chaperone DnaK; Provisional 100.0
COG0443579 DnaK Molecular chaperone [Posttranslational modifi 100.0
PTZ00400663 DnaK-type molecular chaperone; Provisional 100.0
PLN03184673 chloroplast Hsp70; Provisional 100.0
PRK01433595 hscA chaperone protein HscA; Provisional 100.0
KOG0101|consensus620 100.0
PRK00290627 dnaK molecular chaperone DnaK; Provisional 100.0
TIGR02350595 prok_dnaK chaperone protein DnaK. Members of this 100.0
PTZ00009653 heat shock 70 kDa protein; Provisional 100.0
CHL00094621 dnaK heat shock protein 70 100.0
COG0443579 DnaK Molecular chaperone [Posttranslational modifi 100.0
PF00012602 HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho 100.0
PF00012602 HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho 100.0
COG0217241 Uncharacterized conserved protein [Function unknow 100.0
KOG0103|consensus727 100.0
PRK12378235 hypothetical protein; Provisional 100.0
PRK00110245 hypothetical protein; Validated 100.0
KOG0103|consensus 727 100.0
TIGR01033238 DNA-binding regulatory protein, YebC/PmpR family. 100.0
PF01709234 Transcrip_reg: Transcriptional regulator; InterPro 100.0
KOG0104|consensus902 100.0
PRK11678450 putative chaperone; Provisional 100.0
KOG0104|consensus 902 100.0
PRK11678450 putative chaperone; Provisional 100.0
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 100.0
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 100.0
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 100.0
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 100.0
KOG1549|consensus428 100.0
KOG1549|consensus428 100.0
PLN02651364 cysteine desulfurase 100.0
KOG2972|consensus276 100.0
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 100.0
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 100.0
PLN02651364 cysteine desulfurase 100.0
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 100.0
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 100.0
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 100.0
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 100.0
PRK10874401 cysteine sulfinate desulfinase; Provisional 100.0
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 100.0
PRK02948381 cysteine desulfurase; Provisional 100.0
PRK14012404 cysteine desulfurase; Provisional 100.0
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 100.0
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 100.0
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 100.0
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 100.0
PRK14012404 cysteine desulfurase; Provisional 100.0
PRK10874401 cysteine sulfinate desulfinase; Provisional 100.0
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 100.0
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 100.0
PRK02948381 cysteine desulfurase; Provisional 100.0
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 100.0
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 100.0
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 100.0
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 100.0
PRK13928336 rod shape-determining protein Mbl; Provisional 100.0
PLN02724805 Molybdenum cofactor sulfurase 100.0
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 100.0
PRK13929335 rod-share determining protein MreBH; Provisional 100.0
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 100.0
PRK13928336 rod shape-determining protein Mbl; Provisional 100.0
PRK13929335 rod-share determining protein MreBH; Provisional 100.0
PLN02724805 Molybdenum cofactor sulfurase 100.0
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 100.0
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 100.0
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 100.0
PRK13927334 rod shape-determining protein MreB; Provisional 100.0
TIGR00904333 mreB cell shape determining protein, MreB/Mrl fami 99.98
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 99.98
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 99.98
PRK13927334 rod shape-determining protein MreB; Provisional 99.97
TIGR00904333 mreB cell shape determining protein, MreB/Mrl fami 99.97
PRK13930335 rod shape-determining protein MreB; Provisional 99.97
TIGR01814406 kynureninase kynureninase. This model describes ky 99.97
KOG3361|consensus157 99.97
KOG3361|consensus157 99.97
PRK13930335 rod shape-determining protein MreB; Provisional 99.97
TIGR01814406 kynureninase kynureninase. This model describes ky 99.97
PLN02409401 serine--glyoxylate aminotransaminase 99.96
PLN02409401 serine--glyoxylate aminotransaminase 99.96
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.95
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 99.95
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.95
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 99.95
PF06723326 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba 99.95
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 99.95
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 99.95
PF06723326 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba 99.95
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 99.94
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 99.94
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 99.94
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 99.94
PRK03080378 phosphoserine aminotransferase; Provisional 99.94
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 99.94
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 99.94
PRK02769380 histidine decarboxylase; Provisional 99.93
PRK03080378 phosphoserine aminotransferase; Provisional 99.93
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 99.93
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 99.93
PRK02769380 histidine decarboxylase; Provisional 99.93
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 99.93
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 99.93
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 99.93
COG1077342 MreB Actin-like ATPase involved in cell morphogene 99.93
COG1077342 MreB Actin-like ATPase involved in cell morphogene 99.93
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 99.93
PTZ00094452 serine hydroxymethyltransferase; Provisional 99.93
TIGR02529239 EutJ ethanolamine utilization protein EutJ family 99.93
PLN03032374 serine decarboxylase; Provisional 99.93
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.93
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 99.92
PTZ00094452 serine hydroxymethyltransferase; Provisional 99.92
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 99.92
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferas 99.92
PRK13520371 L-tyrosine decarboxylase; Provisional 99.92
PRK13520371 L-tyrosine decarboxylase; Provisional 99.92
TIGR02529239 EutJ ethanolamine utilization protein EutJ family 99.92
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.92
PLN03032374 serine decarboxylase; Provisional 99.92
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.92
PRK15080267 ethanolamine utilization protein EutJ; Provisional 99.91
PLN03026380 histidinol-phosphate aminotransferase; Provisional 99.91
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-c 99.91
PRK15080267 ethanolamine utilization protein EutJ; Provisional 99.91
PRK14807351 histidinol-phosphate aminotransferase; Provisional 99.91
PRK09105370 putative aminotransferase; Provisional 99.91
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 99.91
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.91
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.91
PRK01533366 histidinol-phosphate aminotransferase; Validated 99.91
PRK06225380 aspartate aminotransferase; Provisional 99.9
PRK03158359 histidinol-phosphate aminotransferase; Provisional 99.9
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.9
KOG2862|consensus385 99.9
PRK05957389 aspartate aminotransferase; Provisional 99.9
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.9
PRK01688351 histidinol-phosphate aminotransferase; Provisional 99.9
PRK07681399 aspartate aminotransferase; Provisional 99.9
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 99.9
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 99.9
PRK06207405 aspartate aminotransferase; Provisional 99.9
PRK04870356 histidinol-phosphate aminotransferase; Provisional 99.9
PRK05387353 histidinol-phosphate aminotransferase; Provisional 99.9
PRK06108382 aspartate aminotransferase; Provisional 99.9
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 99.9
PRK08056356 threonine-phosphate decarboxylase; Provisional 99.9
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 99.9
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 99.9
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 99.9
PRK07324373 transaminase; Validated 99.9
PRK13355517 bifunctional HTH-domain containing protein/aminotr 99.9
KOG2862|consensus385 99.89
PRK06225380 aspartate aminotransferase; Provisional 99.89
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-c 99.89
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 99.89
PRK08960387 hypothetical protein; Provisional 99.89
PRK02731367 histidinol-phosphate aminotransferase; Validated 99.89
PRK00950361 histidinol-phosphate aminotransferase; Validated 99.89
PLN03026380 histidinol-phosphate aminotransferase; Provisional 99.89
PRK07681399 aspartate aminotransferase; Provisional 99.89
PRK14807351 histidinol-phosphate aminotransferase; Provisional 99.89
COG3844407 Kynureninase [Amino acid transport and metabolism] 99.89
PRK07324373 transaminase; Validated 99.89
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 99.89
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 99.89
PTZ00377481 alanine aminotransferase; Provisional 99.89
PRK06207405 aspartate aminotransferase; Provisional 99.89
PRK13355517 bifunctional HTH-domain containing protein/aminotr 99.89
PRK01533366 histidinol-phosphate aminotransferase; Validated 99.89
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 99.89
KOG0257|consensus420 99.89
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 99.89
PRK04635354 histidinol-phosphate aminotransferase; Provisional 99.89
PRK05957389 aspartate aminotransferase; Provisional 99.89
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.89
KOG0257|consensus420 99.89
cd06454349 KBL_like KBL_like; this family belongs to the pyri 99.89
PLN02187462 rooty/superroot1 99.89
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferas 99.89
PRK06108382 aspartate aminotransferase; Provisional 99.89
PRK03158359 histidinol-phosphate aminotransferase; Provisional 99.89
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 99.89
PRK09105370 putative aminotransferase; Provisional 99.89
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 99.88
PRK08361391 aspartate aminotransferase; Provisional 99.88
PRK07908349 hypothetical protein; Provisional 99.88
PLN00175413 aminotransferase family protein; Provisional 99.88
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 99.88
PRK08153369 histidinol-phosphate aminotransferase; Provisional 99.88
PLN00175413 aminotransferase family protein; Provisional 99.88
PRK06348384 aspartate aminotransferase; Provisional 99.88
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 99.88
PRK08960387 hypothetical protein; Provisional 99.88
PRK07682378 hypothetical protein; Validated 99.88
PTZ00377481 alanine aminotransferase; Provisional 99.88
PRK05942394 aspartate aminotransferase; Provisional 99.88
PRK05166371 histidinol-phosphate aminotransferase; Provisional 99.88
PRK04366481 glycine dehydrogenase subunit 2; Validated 99.88
PRK05387353 histidinol-phosphate aminotransferase; Provisional 99.88
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzym 99.88
PRK07366388 succinyldiaminopimelate transaminase; Validated 99.88
PLN02187462 rooty/superroot1 99.88
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 99.88
PRK00451447 glycine dehydrogenase subunit 1; Validated 99.88
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 99.88
PRK06358354 threonine-phosphate decarboxylase; Provisional 99.88
PRK04870356 histidinol-phosphate aminotransferase; Provisional 99.88
PRK14809357 histidinol-phosphate aminotransferase; Provisional 99.88
PRK08056356 threonine-phosphate decarboxylase; Provisional 99.88
PRK08912387 hypothetical protein; Provisional 99.87
PTZ00433412 tyrosine aminotransferase; Provisional 99.87
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 99.87
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.87
PRK05942394 aspartate aminotransferase; Provisional 99.87
cd06454349 KBL_like KBL_like; this family belongs to the pyri 99.87
PRK08361391 aspartate aminotransferase; Provisional 99.87
PRK00950361 histidinol-phosphate aminotransferase; Validated 99.87
PRK12414384 putative aminotransferase; Provisional 99.87
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 99.87
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 99.87
PRK08068389 transaminase; Reviewed 99.87
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzym 99.87
PRK07337388 aminotransferase; Validated 99.87
PRK02731367 histidinol-phosphate aminotransferase; Validated 99.87
PRK07568397 aspartate aminotransferase; Provisional 99.87
PRK05764393 aspartate aminotransferase; Provisional 99.87
PRK07392360 threonine-phosphate decarboxylase; Validated 99.87
PLN02656409 tyrosine transaminase 99.87
PRK08363398 alanine aminotransferase; Validated 99.87
PLN02656409 tyrosine transaminase 99.87
PRK04366481 glycine dehydrogenase subunit 2; Validated 99.87
PRK03321352 putative aminotransferase; Provisional 99.87
PRK09147396 succinyldiaminopimelate transaminase; Provisional 99.87
PRK04635354 histidinol-phosphate aminotransferase; Provisional 99.87
PRK06348384 aspartate aminotransferase; Provisional 99.87
PRK07683387 aminotransferase A; Validated 99.87
PRK01688351 histidinol-phosphate aminotransferase; Provisional 99.87
PRK06290410 aspartate aminotransferase; Provisional 99.87
PRK05764393 aspartate aminotransferase; Provisional 99.87
PRK07366388 succinyldiaminopimelate transaminase; Validated 99.87
PRK07337388 aminotransferase; Validated 99.87
PRK15481431 transcriptional regulatory protein PtsJ; Provision 99.87
PRK07908349 hypothetical protein; Provisional 99.87
PRK07682378 hypothetical protein; Validated 99.87
KOG0259|consensus447 99.87
PRK00451447 glycine dehydrogenase subunit 1; Validated 99.86
PRK03317368 histidinol-phosphate aminotransferase; Provisional 99.86
PLN02414993 glycine dehydrogenase (decarboxylating) 99.86
PRK09082386 methionine aminotransferase; Validated 99.86
PRK09147396 succinyldiaminopimelate transaminase; Provisional 99.86
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 99.86
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 99.86
PRK04781364 histidinol-phosphate aminotransferase; Provisional 99.86
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 99.86
PRK08912387 hypothetical protein; Provisional 99.86
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 99.86
PRK08363398 alanine aminotransferase; Validated 99.86
PRK02610374 histidinol-phosphate aminotransferase; Provisional 99.86
COG3844407 Kynureninase [Amino acid transport and metabolism] 99.86
PRK07309391 aromatic amino acid aminotransferase; Validated 99.86
PRK06107402 aspartate aminotransferase; Provisional 99.86
PRK06290410 aspartate aminotransferase; Provisional 99.86
PRK07550386 hypothetical protein; Provisional 99.86
PTZ00433412 tyrosine aminotransferase; Provisional 99.86
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.86
PRK14809357 histidinol-phosphate aminotransferase; Provisional 99.86
PRK09265404 aminotransferase AlaT; Validated 99.86
PRK07179407 hypothetical protein; Provisional 99.86
PRK05166371 histidinol-phosphate aminotransferase; Provisional 99.86
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 99.86
PRK06358354 threonine-phosphate decarboxylase; Provisional 99.86
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 99.86
PLN02414993 glycine dehydrogenase (decarboxylating) 99.86
PRK08153369 histidinol-phosphate aminotransferase; Provisional 99.86
PRK09148405 aminotransferase; Validated 99.85
PRK12414384 putative aminotransferase; Provisional 99.85
PRK06107402 aspartate aminotransferase; Provisional 99.85
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 99.85
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 99.85
PRK09265404 aminotransferase AlaT; Validated 99.85
PRK15481431 transcriptional regulatory protein PtsJ; Provision 99.85
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.85
PRK09082386 methionine aminotransferase; Validated 99.85
PRK07777387 aminotransferase; Validated 99.85
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.85
PRK07683387 aminotransferase A; Validated 99.85
PRK08068389 transaminase; Reviewed 99.85
PRK07568397 aspartate aminotransferase; Provisional 99.85
PRK03967337 histidinol-phosphate aminotransferase; Provisional 99.85
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 99.85
PLN02376496 1-aminocyclopropane-1-carboxylate synthase 99.85
PRK13238460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 99.85
PRK06425332 histidinol-phosphate aminotransferase; Validated 99.85
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 99.85
PRK07179407 hypothetical protein; Provisional 99.85
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.85
PRK07550386 hypothetical protein; Provisional 99.85
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 99.85
PRK08636403 aspartate aminotransferase; Provisional 99.85
PLN02721353 threonine aldolase 99.85
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 99.85
PRK06855433 aminotransferase; Validated 99.85
PLN02231534 alanine transaminase 99.85
PRK14808335 histidinol-phosphate aminotransferase; Provisional 99.85
PRK09148405 aminotransferase; Validated 99.85
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.85
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 99.85
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 99.84
PRK03321352 putative aminotransferase; Provisional 99.84
PRK08636403 aspartate aminotransferase; Provisional 99.84
PRK07309391 aromatic amino acid aminotransferase; Validated 99.84
cd00609350 AAT_like Aspartate aminotransferase family. This f 99.84
KOG0259|consensus447 99.84
PLN026721082 methionine S-methyltransferase 99.84
PRK08064390 cystathionine beta-lyase; Provisional 99.84
PRK07392360 threonine-phosphate decarboxylase; Validated 99.84
PRK06855433 aminotransferase; Validated 99.84
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 99.84
PRK06836394 aspartate aminotransferase; Provisional 99.84
PRK11325127 scaffold protein; Provisional 99.84
PLN02450468 1-aminocyclopropane-1-carboxylate synthase 99.84
PRK03317368 histidinol-phosphate aminotransferase; Provisional 99.84
PRK07777387 aminotransferase; Validated 99.84
PRK04781364 histidinol-phosphate aminotransferase; Provisional 99.84
PRK02610374 histidinol-phosphate aminotransferase; Provisional 99.84
PLN02376496 1-aminocyclopropane-1-carboxylate synthase 99.84
PRK08354311 putative aminotransferase; Provisional 99.84
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 99.84
PLN02483489 serine palmitoyltransferase 99.84
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 99.84
PLN02450468 1-aminocyclopropane-1-carboxylate synthase 99.83
PLN02231534 alanine transaminase 99.83
PRK06836394 aspartate aminotransferase; Provisional 99.83
PRK13580493 serine hydroxymethyltransferase; Provisional 99.83
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 99.83
PRK05839374 hypothetical protein; Provisional 99.83
COG0822150 IscU NifU homolog involved in Fe-S cluster formati 99.83
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 99.83
COG0822150 IscU NifU homolog involved in Fe-S cluster formati 99.83
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 99.83
PRK08133390 O-succinylhomoserine sulfhydrylase; Validated 99.83
PLN02721353 threonine aldolase 99.83
PRK06425332 histidinol-phosphate aminotransferase; Validated 99.83
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 99.83
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; 99.83
PLN02452365 phosphoserine transaminase 99.83
TIGR01329378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 99.83
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 99.83
TIGR01174371 ftsA cell division protein FtsA. This bacterial ce 99.83
PLN02271586 serine hydroxymethyltransferase 99.83
PLN02452365 phosphoserine transaminase 99.83
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 99.82
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. T 99.82
PLN02483489 serine palmitoyltransferase 99.82
PRK05839374 hypothetical protein; Provisional 99.82
PRK11325127 scaffold protein; Provisional 99.82
PRK09275527 aspartate aminotransferase; Provisional 99.82
PRK06767386 methionine gamma-lyase; Provisional 99.82
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 99.82
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 99.82
PRK13392410 5-aminolevulinate synthase; Provisional 99.82
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 99.82
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 99.82
PLN02607447 1-aminocyclopropane-1-carboxylate synthase 99.82
PRK03967337 histidinol-phosphate aminotransferase; Provisional 99.82
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 99.82
PLN026721082 methionine S-methyltransferase 99.82
PRK08175395 aminotransferase; Validated 99.82
PRK06959339 putative threonine-phosphate decarboxylase; Provis 99.82
PRK08354311 putative aminotransferase; Provisional 99.82
cd00609350 AAT_like Aspartate aminotransferase family. This f 99.82
PRK09472420 ftsA cell division protein FtsA; Reviewed 99.82
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 99.82
PRK08064390 cystathionine beta-lyase; Provisional 99.82
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 99.82
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 99.82
PLN02263470 serine decarboxylase 99.82
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 99.82
TIGR01999124 iscU FeS cluster assembly scaffold IscU. This mode 99.82
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; 99.82
PLN02822481 serine palmitoyltransferase 99.81
PF01041363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 99.81
PRK08249398 cystathionine gamma-synthase; Provisional 99.81
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 99.81
PRK05968389 hypothetical protein; Provisional 99.81
PRK08175395 aminotransferase; Validated 99.81
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 99.81
PRK09275527 aspartate aminotransferase; Provisional 99.81
PRK08861388 cystathionine gamma-synthase; Provisional 99.81
PRK14808335 histidinol-phosphate aminotransferase; Provisional 99.81
PF01041363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 99.81
PRK06234400 methionine gamma-lyase; Provisional 99.81
PRK09064407 5-aminolevulinate synthase; Validated 99.81
TIGR01324377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 99.81
TIGR01999124 iscU FeS cluster assembly scaffold IscU. This mode 99.81
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 99.8
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 99.8
PLN02607447 1-aminocyclopropane-1-carboxylate synthase 99.8
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 99.8
PRK13238460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 99.8
PRK08133390 O-succinylhomoserine sulfhydrylase; Validated 99.8
TIGR01174371 ftsA cell division protein FtsA. This bacterial ce 99.8
PLN02263470 serine decarboxylase 99.8
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 99.8
PRK13392410 5-aminolevulinate synthase; Provisional 99.8
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 99.8
PRK07504398 O-succinylhomoserine sulfhydrylase; Reviewed 99.8
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 99.8
PRK06767386 methionine gamma-lyase; Provisional 99.8
PRK08045386 cystathionine gamma-synthase; Provisional 99.8
TIGR01329378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 99.8
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 99.8
TIGR03801521 asp_4_decarbox aspartate 4-decarboxylase. This enz 99.8
PRK13393406 5-aminolevulinate synthase; Provisional 99.8
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 99.8
PRK05664330 threonine-phosphate decarboxylase; Reviewed 99.8
PRK08776405 cystathionine gamma-synthase; Provisional 99.8
PRK01773173 hscB co-chaperone HscB; Provisional 99.8
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. T 99.8
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 99.8
TIGR03801521 asp_4_decarbox aspartate 4-decarboxylase. This enz 99.79
PRK09440416 avtA valine--pyruvate transaminase; Provisional 99.79
PLN02822481 serine palmitoyltransferase 99.79
TIGR03419121 NifU_clost FeS cluster assembly scaffold protein N 99.79
PRK07503403 methionine gamma-lyase; Provisional 99.79
PRK06460376 hypothetical protein; Provisional 99.79
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 99.79
TIGR02080382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 99.79
TIGR01325380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 99.79
PRK09472420 ftsA cell division protein FtsA; Reviewed 99.79
TIGR01328391 met_gam_lyase methionine gamma-lyase. This model d 99.79
PRK09028394 cystathionine beta-lyase; Provisional 99.79
PLN03226475 serine hydroxymethyltransferase; Provisional 99.79
PRK07811388 cystathionine gamma-synthase; Provisional 99.79
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is 99.79
PLN02368407 alanine transaminase 99.79
PLN02242418 methionine gamma-lyase 99.79
PRK13580493 serine hydroxymethyltransferase; Provisional 99.78
PRK08574385 cystathionine gamma-synthase; Provisional 99.78
PRK08249398 cystathionine gamma-synthase; Provisional 99.78
PRK05968389 hypothetical protein; Provisional 99.78
PF01592126 NifU_N: NifU-like N terminal domain; InterPro: IPR 99.78
PRK01773173 hscB co-chaperone HscB; Provisional 99.78
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 99.78
PRK06234400 methionine gamma-lyase; Provisional 99.78
cd00617431 Tnase_like Tryptophanase family (Tnase). This fami 99.78
PRK07810403 O-succinylhomoserine sulfhydrylase; Provisional 99.78
PRK09064407 5-aminolevulinate synthase; Validated 99.78
PRK05664330 threonine-phosphate decarboxylase; Reviewed 99.78
PRK09440416 avtA valine--pyruvate transaminase; Provisional 99.78
PLN02880490 tyrosine decarboxylase 99.78
PRK08114395 cystathionine beta-lyase; Provisional 99.78
TIGR03419121 NifU_clost FeS cluster assembly scaffold protein N 99.78
PRK06959339 putative threonine-phosphate decarboxylase; Provis 99.78
PLN02880490 tyrosine decarboxylase 99.78
PRK15407438 lipopolysaccharide biosynthesis protein RfbH; Prov 99.78
PRK08861388 cystathionine gamma-synthase; Provisional 99.78
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; 99.78
PRK05939397 hypothetical protein; Provisional 99.77
PLN02590539 probable tyrosine decarboxylase 99.77
PF01592126 NifU_N: NifU-like N terminal domain; InterPro: IPR 99.77
PRK10534333 L-threonine aldolase; Provisional 99.77
PLN02271586 serine hydroxymethyltransferase 99.77
PRK13393406 5-aminolevulinate synthase; Provisional 99.77
TIGR01324377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 99.77
PRK08045386 cystathionine gamma-synthase; Provisional 99.77
PRK07582366 cystathionine gamma-lyase; Validated 99.77
PRK07504398 O-succinylhomoserine sulfhydrylase; Reviewed 99.77
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.77
PRK12462364 phosphoserine aminotransferase; Provisional 99.77
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.77
PRK15407438 lipopolysaccharide biosynthesis protein RfbH; Prov 99.77
PRK06176380 cystathionine gamma-synthase/cystathionine beta-ly 99.77
PRK08247366 cystathionine gamma-synthase; Reviewed 99.77
PLN02242418 methionine gamma-lyase 99.77
PRK07050394 cystathionine beta-lyase; Provisional 99.76
PLN02509464 cystathionine beta-lyase 99.76
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; 99.76
>KOG0100|consensus Back     alignment and domain information
Probab=100.00  E-value=2.4e-109  Score=935.56  Aligned_cols=522  Identities=40%  Similarity=0.603  Sum_probs=494.2

Q ss_pred             CceEEEEEcCcccEEEEEEECCeeEEEeCCCCCccccEEEEEecCCcEEEcHHHHhhhccCCCCchhhhhhhhCCCCCCC
Q psy15216        636 KCVSIGIDFGTTNSLVAIVRNNIPEVLKDKYGYFLIPSIVRYLPDGKIYVGKKAKITQNIDPKNTISSIKRFIARDLKNI  715 (2602)
Q Consensus       636 ~~~vvGID~GTt~s~va~~~~~~~~ii~~~~g~~~~PS~v~~~~~~~~~vG~~A~~~~~~~p~~~~~~~K~~lg~~~~~~  715 (2602)
                      ...|||||||||||||++++||+++||.|++|+|.+||+|+|+++ ++++|.+|++++..||+|++++.||+|||++++.
T Consensus        35 ~gtvigIdLGTTYsCVgV~kNgrvEIiANdQGNRItPSyVaFt~d-erLiGdAAKNQ~~~NPenTiFD~KRLIGr~~~d~  113 (663)
T KOG0100|consen   35 LGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTDD-ERLIGDAAKNQLTSNPENTIFDAKRLIGRKFNDK  113 (663)
T ss_pred             cceEEEEecCCceeeEEEEeCCeEEEEecCCCCccccceeeeccc-hhhhhhHhhcccccCcccceechHHHhCcccCCh
Confidence            457899999999999999999999999999999999999999988 7999999999999999999999999999999885


Q ss_pred             CCC----CCCeeeecCCCceEEEEe-----CceeCHHHHHHHHHHHHHHHHHHhhcCccceEEEEEcCCCCHHHHHHHHH
Q psy15216        716 NTN----SFPYDFQNKFGMLHIKTI-----SGIKSPIEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKN  786 (2602)
Q Consensus       716 ~~~----~~~~~~~~~~~~~~~~~~-----~~~~~~~ev~a~~L~~l~~~a~~~~~~~~~~~ViTVPa~f~~~qr~~~~~  786 (2602)
                      ..+    .|||+++++++++.+++.     .+.++|+|+++|+|.++|+.|+.|+|.+++++|+||||||++.|||++++
T Consensus       114 ~vq~Dik~~Pfkvv~k~~kp~i~v~v~~g~~K~FtPeEiSaMiL~KMKe~AEayLGkkv~~AVvTvPAYFNDAQrQATKD  193 (663)
T KOG0100|consen  114 SVQKDIKFLPFKVVNKDGKPYIQVKVGGGETKVFTPEEISAMILTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKD  193 (663)
T ss_pred             hhhhhhhcCceEEEcCCCCccEEEEccCCcccccCHHHHHHHHHHHHHHHHHHHhCCcccceEEecchhcchHHHhhhcc
Confidence            433    899999999988887753     34899999999999999999999999999999999999999999999999


Q ss_pred             HHHHcCCceEEEechhHHHHHHhhhccCcccceEEEEEeCCceEEEEEEEEECCEEEEEEEecCCCCcchHHHHHHHHHH
Q psy15216        787 AAKLAGLNVLRLLNEPTSAAIAYKLDKNIFEGIFAVYDLGGGTFDISILKFKNGVFKVLSVGGDSNLGGDDFDYCLFSWI  866 (2602)
Q Consensus       787 Aa~~AGl~~~~li~EPtAAAl~y~~~~~~~~~~vlV~D~GGGT~Dvsv~~~~~~~~~v~~~~g~~~lGG~~~D~~l~~~l  866 (2602)
                      |..+|||+++|+||||||||++|++++...+.++||||+||||||||++.+++|+|+|+++.||.+|||+|||+++++|+
T Consensus       194 AGtIAgLnV~RIiNePTaAAIAYGLDKk~gEknilVfDLGGGTFDVSlLtIdnGVFeVlaTnGDThLGGEDFD~rvm~~f  273 (663)
T KOG0100|consen  194 AGTIAGLNVVRIINEPTAAAIAYGLDKKDGEKNILVFDLGGGTFDVSLLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYF  273 (663)
T ss_pred             cceeccceEEEeecCccHHHHHhcccccCCcceEEEEEcCCceEEEEEEEEcCceEEEEecCCCcccCccchHHHHHHHH
Confidence            99999999999999999999999999988889999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhcc-----CCHHHHHHHHHHHHHHHHHcccccceEEEEE-ecCCceEEEEeCHHHHHHHHHHHHHHHHHHHHHHH
Q psy15216        867 VKNAFLKK-----LSYKDVNILMIKSREIKELLSYQSSVKLNVK-LSDKKIVNITIDMKQFFTITQHLVNRTILLSSKAL  940 (2602)
Q Consensus       867 ~~~~~~~~-----~~~~~~~~l~~~~e~~K~~LS~~~~~~~~i~-~~~~~~~~~~itr~~fe~l~~~~~~~~~~~i~~~l  940 (2602)
                      .+-++++.     .+.+++++|++++|+||+.||++.++.++++ +.+|.+++-++||..||++.-++|.+++.++.++|
T Consensus       274 iklykkK~gkDv~kdnkA~~KLrRe~EkAKRaLSsqhq~riEIeS~fdG~DfSEtLtRAkFEElNmDLFr~TlkPv~kvl  353 (663)
T KOG0100|consen  274 IKLYKKKHGKDVRKDNKAVQKLRREVEKAKRALSSQHQVRIEIESLFDGVDFSETLTRAKFEELNMDLFRKTLKPVQKVL  353 (663)
T ss_pred             HHHHhhhcCCccchhhHHHHHHHHHHHHHHhhhccccceEEeeeeccccccccchhhhhHHHHhhhHHHHHhhHHHHHHH
Confidence            99887665     5788999999999999999999999999999 89999999999999999999999999999999999


Q ss_pred             HHcCCCccccceEEEecCccchHHHHHHHHhhc-cCcccCcCCcchHhHHHHHHHhHHhcCCCCCCCceeeeccccccce
Q psy15216        941 MDANLTIKDINNVILVGGSTRMKHIHEGVSNFF-KTTLLTSIDPDKAVVFGAAIQANFLSGNRGIDDNFLLLDVIPLSLG 1019 (2602)
Q Consensus       941 ~~a~~~~~~i~~V~LvGG~sr~P~v~~~l~~~f-~~~~~~~~~p~~aVa~GAa~~a~~l~~~~~~~~~~~~~dv~~~~~g 1019 (2602)
                      +++++.+.+|+.|+|||||+|||.||++|+++| |+++.+.+||+||||+|||.||..++|... ..++++.||+|+++|
T Consensus       354 ~Ds~lkKsdideiVLVGGsTrIPKvQqllk~fF~GKepskGinPdEAVAYGAAVQaGvlsGee~-t~divLLDv~pLtlG  432 (663)
T KOG0100|consen  354 EDSDLKKSDIDEIVLVGGSTRIPKVQQLLKDFFNGKEPSKGINPDEAVAYGAAVQAGVLSGEED-TGDIVLLDVNPLTLG  432 (663)
T ss_pred             hhcCcccccCceEEEecCcccChhHHHHHHHHhCCCCccCCCChHHHHHhhhhhhhcccccccC-cCcEEEEeeccccce
Confidence            999999999999999999999999999999999 899999999999999999999999999865 678999999999999


Q ss_pred             EeeeccEEEEEEecCCCCCCCcEEEEEeccccccceeeeEeecCccccccCceeeeeEecCCCCCCCCccEEEEEEEECC
Q psy15216       1020 IETIGGLVEKIIFRNTTIPCSYSGEFTTFKDNQTAIAIKVVQGEDELVKNCQVLANFELRDIPPMPAGRARIKVTYQVDA 1099 (2602)
Q Consensus      1020 i~~~~~~~~~ii~~~t~iP~~~~~~~~~~~d~q~~~~i~i~~ge~~~~~~~~~lg~~~l~~i~~~~~g~~~i~v~f~~d~ 1099 (2602)
                      ||+.||.|..+|||||.||+++++.|+|..|||+.+.|+||+||+.+.++|++||+|.++||||+|+|.|+|+|+|++|.
T Consensus       433 IETvGGVMTklI~RNTviPTkKSQvFsTa~DnQ~tV~I~vyEGER~mtkdn~lLGkFdltGipPAPRGvpqIEVtFevDa  512 (663)
T KOG0100|consen  433 IETVGGVMTKLIPRNTVIPTKKSQVFSTAQDNQPTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGVPQIEVTFEVDA  512 (663)
T ss_pred             eeeecceeeccccCCcccCccccceeeecccCCceEEEEEeeccccccccccccccccccCCCCCCCCCccEEEEEEEcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CeeEEEEEEEecCCceEEEEEecCCC-CCHHHHHhhhhccccCCCchhHHHHhcccchhhhcc
Q psy15216       1100 DGLLSIFAYEKISGKKKFITIKPFYN-MNLDEIKNGAIFNENSGISLCDALLKNSIFIEHACE 1161 (2602)
Q Consensus      1100 ~g~l~v~a~~~~~g~~~~~~~~~~~~-l~~~~i~~~~~~~~~~g~~~~~~~~~~~~~~~~~c~ 1161 (2602)
                      ||+|+|+|.|+.||++.+++|.++.+ ||+|+|++|+  ++++-..-.+..+...+.-.++.+
T Consensus       513 ngiL~VsAeDKgtg~~~kitItNd~~rLt~EdIerMv--~eAekFAeeDk~~KekieaRN~LE  573 (663)
T KOG0100|consen  513 NGILQVSAEDKGTGKKEKITITNDKGRLTPEDIERMV--NEAEKFAEEDKKLKEKIEARNELE  573 (663)
T ss_pred             CceEEEEeeccCCCCcceEEEecCCCCCCHHHHHHHH--HHHHHHhhhhHHHHHHHHhHHHHH
Confidence            99999999999999999999999966 9999999986  877776666666555554444333



>KOG0100|consensus Back     alignment and domain information
>KOG0102|consensus Back     alignment and domain information
>PTZ00186 heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>PRK13410 molecular chaperone DnaK; Provisional Back     alignment and domain information
>TIGR01991 HscA Fe-S protein assembly chaperone HscA Back     alignment and domain information
>PRK05183 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>PRK13411 molecular chaperone DnaK; Provisional Back     alignment and domain information
>KOG0102|consensus Back     alignment and domain information
>PTZ00186 heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>PTZ00400 DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>PLN03184 chloroplast Hsp70; Provisional Back     alignment and domain information
>KOG0101|consensus Back     alignment and domain information
>PRK01433 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>PRK00290 dnaK molecular chaperone DnaK; Provisional Back     alignment and domain information
>PTZ00009 heat shock 70 kDa protein; Provisional Back     alignment and domain information
>TIGR01991 HscA Fe-S protein assembly chaperone HscA Back     alignment and domain information
>TIGR02350 prok_dnaK chaperone protein DnaK Back     alignment and domain information
>PRK13410 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PRK05183 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>CHL00094 dnaK heat shock protein 70 Back     alignment and domain information
>PRK13411 molecular chaperone DnaK; Provisional Back     alignment and domain information
>COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00400 DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>PLN03184 chloroplast Hsp70; Provisional Back     alignment and domain information
>PRK01433 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>KOG0101|consensus Back     alignment and domain information
>PRK00290 dnaK molecular chaperone DnaK; Provisional Back     alignment and domain information
>TIGR02350 prok_dnaK chaperone protein DnaK Back     alignment and domain information
>PTZ00009 heat shock 70 kDa protein; Provisional Back     alignment and domain information
>CHL00094 dnaK heat shock protein 70 Back     alignment and domain information
>COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins Back     alignment and domain information
>PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins Back     alignment and domain information
>COG0217 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0103|consensus Back     alignment and domain information
>PRK12378 hypothetical protein; Provisional Back     alignment and domain information
>PRK00110 hypothetical protein; Validated Back     alignment and domain information
>KOG0103|consensus Back     alignment and domain information
>TIGR01033 DNA-binding regulatory protein, YebC/PmpR family Back     alignment and domain information
>PF01709 Transcrip_reg: Transcriptional regulator; InterPro: IPR002876 This entry represents the core region of several hypothetical proteins found in bacteria, plants, and yeast proteins Back     alignment and domain information
>KOG0104|consensus Back     alignment and domain information
>PRK11678 putative chaperone; Provisional Back     alignment and domain information
>KOG0104|consensus Back     alignment and domain information
>PRK11678 putative chaperone; Provisional Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1549|consensus Back     alignment and domain information
>KOG1549|consensus Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>KOG2972|consensus Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>PRK13928 rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>PRK13929 rod-share determining protein MreBH; Provisional Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>PRK13928 rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>PRK13929 rod-share determining protein MreBH; Provisional Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>PRK13927 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>TIGR00904 mreB cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>PRK13927 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>TIGR00904 mreB cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>PRK13930 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>KOG3361|consensus Back     alignment and domain information
>KOG3361|consensus Back     alignment and domain information
>PRK13930 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK15080 ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15080 ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>KOG2862|consensus Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>KOG2862|consensus Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>KOG0257|consensus Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>KOG0257|consensus Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>KOG0259|consensus Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>KOG0259|consensus Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK11325 scaffold protein; Provisional Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>COG0822 IscU NifU homolog involved in Fe-S cluster formation [Energy production and conversion] Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>COG0822 IscU NifU homolog involved in Fe-S cluster formation [Energy production and conversion] Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>TIGR01174 ftsA cell division protein FtsA Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>PRK11325 scaffold protein; Provisional Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>PRK09472 ftsA cell division protein FtsA; Reviewed Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>TIGR01999 iscU FeS cluster assembly scaffold IscU Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>TIGR01999 iscU FeS cluster assembly scaffold IscU Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>TIGR01174 ftsA cell division protein FtsA Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>TIGR03419 NifU_clost FeS cluster assembly scaffold protein NifU, Clostridium type Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>PRK09472 ftsA cell division protein FtsA; Reviewed Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PF01592 NifU_N: NifU-like N terminal domain; InterPro: IPR002871 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>TIGR03419 NifU_clost FeS cluster assembly scaffold protein NifU, Clostridium type Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>PF01592 NifU_N: NifU-like N terminal domain; InterPro: IPR002871 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query2602
1p3w_B404 X-Ray Crystal Structure Of E. Coli Iscs Length = 40 1e-152
1p3w_B404 X-Ray Crystal Structure Of E. Coli Iscs Length = 40 1e-150
3lvj_A423 Crystal Structure Of E.Coli Iscs-Tusa Complex (Form 1e-152
3lvj_A423 Crystal Structure Of E.Coli Iscs-Tusa Complex (Form 1e-150
2kho_A605 Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAP 1e-95
2kho_A605 Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAP 1e-95
4b9q_A605 Open Conformation Of Atp-Bound Hsp70 Homolog Dnak L 2e-92
4b9q_A605 Open Conformation Of Atp-Bound Hsp70 Homolog Dnak L 2e-92
2v7y_A509 Crystal Structure Of The Molecular Chaperone Dnak F 5e-90
2v7y_A509 Crystal Structure Of The Molecular Chaperone Dnak F 5e-90
3c7n_B554 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 6e-89
3c7n_B554 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 6e-89
1yuw_A554 Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214 2e-88
1yuw_A554 Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214 2e-88
2v7z_A543 Crystal Structure Of The 70-Kda Heat Shock Cognate 4e-88
2v7z_A543 Crystal Structure Of The 70-Kda Heat Shock Cognate 4e-88
4eb5_A382 A. Fulgidus Iscs-Iscu Complex Structure Length = 38 6e-79
4eb5_A382 A. Fulgidus Iscs-Iscu Complex Structure Length = 38 3e-77
3vax_A400 Crytal Structure Of Dnda From Streptomyces Lividans 9e-73
3vax_A400 Crytal Structure Of Dnda From Streptomyces Lividans 7e-72
1ecx_A384 Nifs-Like Protein Length = 384 3e-68
1ecx_A384 Nifs-Like Protein Length = 384 5e-68
1dkg_D383 Crystal Structure Of The Nucleotide Exchange Factor 9e-67
1dkg_D383 Crystal Structure Of The Nucleotide Exchange Factor 9e-67
3qfp_A390 Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE D 9e-66
3qfp_A390 Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE D 9e-66
3qfu_A394 Crystal Structure Of Yeast Hsp70 (BipKAR2) COMPLEXE 1e-65
3qfu_A394 Crystal Structure Of Yeast Hsp70 (BipKAR2) COMPLEXE 1e-65
1eg5_A384 Nifs-like Protein Length = 384 1e-64
1eg5_A384 Nifs-like Protein Length = 384 3e-64
3iuc_A408 Crystal Structure Of The Human 70kda Heat Shock Pro 4e-62
3iuc_A408 Crystal Structure Of The Human 70kda Heat Shock Pro 4e-62
3ldl_A384 Crystal Structure Of Human Grp78 (70kda Heat Shock 7e-62
3ldl_A384 Crystal Structure Of Human Grp78 (70kda Heat Shock 7e-62
2qw9_B394 Crystal Structure Of Bovine Hsc70 (1-394aa)in The A 6e-57
2qw9_B394 Crystal Structure Of Bovine Hsc70 (1-394aa)in The A 6e-57
1hpm_A386 How Potassium Affects The Activity Of The Molecular 7e-57
1hpm_A386 How Potassium Affects The Activity Of The Molecular 7e-57
1ba1_A386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 1e-56
1ba1_A386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 1e-56
1ngb_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 2e-56
1ngb_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 2e-56
1bup_A386 T13s Mutant Of Bovine 70 Kilodalton Heat Shock Prot 3e-56
1bup_A386 T13s Mutant Of Bovine 70 Kilodalton Heat Shock Prot 3e-56
1atr_A386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 4e-56
1atr_A386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 4e-56
1ngd_A386 Structural Basis Of The 70-kilodalton Heat Shock Co 4e-56
1ngd_A386 Structural Basis Of The 70-kilodalton Heat Shock Co 4e-56
1ngf_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 4e-56
1ngf_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 4e-56
1ngh_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 4e-56
1ngh_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 4e-56
1ats_A386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 4e-56
1ats_A386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 4e-56
1nga_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 5e-56
1nga_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 5e-56
1ngg_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 5e-56
1ngg_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 5e-56
1ngc_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 5e-56
1ngc_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 5e-56
1nge_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 5e-56
1nge_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 5e-56
1ba0_A386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 6e-56
1ba0_A386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 6e-56
2qwn_A394 Crystal Structure Of Disulfide-Bond-Crosslinked Com 8e-56
2qwn_A394 Crystal Structure Of Disulfide-Bond-Crosslinked Com 8e-56
3i33_A404 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-55
3i33_A404 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-55
3fe1_A403 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-55
3fe1_A403 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-55
3cqx_A386 Chaperone Complex Length = 386 1e-55
3cqx_A386 Chaperone Complex Length = 386 1e-55
1hx1_A400 Crystal Structure Of A Bag Domain In Complex With T 3e-55
1hx1_A400 Crystal Structure Of A Bag Domain In Complex With T 3e-55
3fzf_A381 Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP 3e-55
3fzf_A381 Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP 3e-55
1kaz_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71e 4e-55
1kaz_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71e 4e-55
3gdq_A408 Crystal Structure Of The Human 70kda Heat Shock Pro 6e-55
3gdq_A408 Crystal Structure Of The Human 70kda Heat Shock Pro 6e-55
1kay_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71a 6e-55
1kay_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71a 6e-55
4fsv_A387 Crystal Structure Of A Heat Shock 70kda Protein 2 ( 7e-55
4fsv_A387 Crystal Structure Of A Heat Shock 70kda Protein 2 ( 7e-55
2bup_A381 T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 8e-55
2bup_A381 T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 8e-55
1kax_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71m 9e-55
1kax_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71m 9e-55
1qqn_A378 D206s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 1e-54
1qqn_A378 D206s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 1e-54
1qqm_A378 D199s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 1e-54
1qqm_A378 D199s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 1e-54
3gl1_A387 Crystal Structure Of Atpase Domain Of Ssb1 Chaperon 2e-54
3gl1_A387 Crystal Structure Of Atpase Domain Of Ssb1 Chaperon 2e-54
1qqo_A378 E175s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 2e-54
1qqo_A378 E175s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 2e-54
3a8y_A392 Crystal Structure Of The Complex Between The Bag5 B 7e-54
3a8y_A392 Crystal Structure Of The Complex Between The Bag5 B 7e-54
3jxu_A409 Crystal Structure Of The Human 70kda Heat Shock Pro 7e-54
3jxu_A409 Crystal Structure Of The Human 70kda Heat Shock Pro 7e-54
2e8a_A391 Crystal Structure Of The Human Hsp70 Atpase Domain 7e-54
2e8a_A391 Crystal Structure Of The Human Hsp70 Atpase Domain 7e-54
2e88_A391 Crystal Structure Of The Human Hsp70 Atpase Domain 7e-54
2e88_A391 Crystal Structure Of The Human Hsp70 Atpase Domain 7e-54
3d2f_B382 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 1e-53
3d2f_B382 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 1e-53
1s3x_A382 The Crystal Structure Of The Human Hsp70 Atpase Dom 2e-53
1s3x_A382 The Crystal Structure Of The Human Hsp70 Atpase Dom 2e-53
1hjo_A380 Atpase Domain Of Human Heat Shock 70kda Protein 1 L 2e-53
1hjo_A380 Atpase Domain Of Human Heat Shock 70kda Protein 1 L 2e-53
3kvg_A400 Crystal Structure Of The N-Terminal Domain Of Hsp70 3e-53
3kvg_A400 Crystal Structure Of The N-Terminal Domain Of Hsp70 3e-53
3d2e_B382 Crystal Structure Of A Complex Of Sse1p And Hsp70, 3e-53
3d2e_B382 Crystal Structure Of A Complex Of Sse1p And Hsp70, 3e-53
3a9x_A432 Crystal Structure Of Rat Selenocysteine Lyase Lengt 9e-46
3a9x_A432 Crystal Structure Of Rat Selenocysteine Lyase Lengt 4e-44
3gzc_A440 Structure Of Human Selenocysteine Lyase Length = 44 1e-44
3gzc_A440 Structure Of Human Selenocysteine Lyase Length = 44 2e-42
2l4x_A128 Solution Structure Of Apo-Iscu(Wt) Length = 128 8e-44
2l4x_A128 Solution Structure Of Apo-Iscu(Wt) Length = 128 8e-44
3gzd_A440 Human Selenocysteine Lyase, P1 Crystal Form Length 2e-43
3gzd_A440 Human Selenocysteine Lyase, P1 Crystal Form Length 4e-41
3lvl_A129 Crystal Structure Of E.Coli Iscs-Iscu Complex Lengt 4e-43
3lvl_A129 Crystal Structure Of E.Coli Iscs-Iscu Complex Lengt 4e-43
2kqk_A128 Solution Structure Of Apo-Iscu(D39a) Length = 128 6e-43
2kqk_A128 Solution Structure Of Apo-Iscu(D39a) Length = 128 6e-43
1q48_A134 Solution Nmr Structure Of The Haemophilus Influenza 1e-41
1q48_A134 Solution Nmr Structure Of The Haemophilus Influenza 1e-41
1u00_A227 Hsca Substrate Binding Domain Complexed With The Is 4e-37
1u00_A227 Hsca Substrate Binding Domain Complexed With The Is 4e-37
1wfz_A130 Solution Structure Of Iron-Sulfur Cluster Protein U 7e-33
1wfz_A130 Solution Structure Of Iron-Sulfur Cluster Protein U 7e-33
4ixo_A380 X-ray Structure Of Nifs-like Protein From Rickettsi 7e-33
4ixo_A380 X-ray Structure Of Nifs-like Protein From Rickettsi 1e-31
1kon_A249 Crystal Structure Of E.Coli Yebc Length = 249 6e-32
3c7n_A668 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 2e-31
3c7n_A668 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 2e-31
2qxl_A658 Crystal Structure Analysis Of Sse1, A Yeast Hsp110 2e-31
2qxl_A658 Crystal Structure Analysis Of Sse1, A Yeast Hsp110 2e-31
3d2f_A675 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 3e-31
3d2f_A675 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 3e-31
4f3q_A247 Structure Of A Yebc Family Protein (Cbu_1566) From 3e-31
3d2e_A675 Crystal Structure Of A Complex Of Sse1p And Hsp70, 4e-31
3d2e_A675 Crystal Structure Of A Complex Of Sse1p And Hsp70, 4e-31
1dky_A219 The Substrate Binding Domain Of Dnak In Complex Wit 4e-26
1dky_A219 The Substrate Binding Domain Of Dnak In Complex Wit 4e-26
1bpr_A191 Nmr Structure Of The Substrate Binding Domain Of Dn 5e-26
1bpr_A191 Nmr Structure Of The Substrate Binding Domain Of Dn 5e-26
3dpo_A219 Crystal Structure Of The Substrate Binding Domain O 5e-26
3dpo_A219 Crystal Structure Of The Substrate Binding Domain O 5e-26
1dkx_A219 The Substrate Binding Domain Of Dnak In Complex Wit 5e-26
1dkx_A219 The Substrate Binding Domain Of Dnak In Complex Wit 5e-26
1ckr_A159 High Resolution Solution Structure Of The Heat Shoc 7e-26
1ckr_A159 High Resolution Solution Structure Of The Heat Shoc 7e-26
1lfp_A249 Crystal Structure Of A Conserved Hypothetical Prote 1e-25
3dqg_A151 Peptide-Binding Domain Of Heat Shock 70 Kda Protein 4e-25
3dqg_A151 Peptide-Binding Domain Of Heat Shock 70 Kda Protein 4e-25
3n8e_A182 Substrate Binding Domain Of The Human Heat Shock 70 7e-25
3n8e_A182 Substrate Binding Domain Of The Human Heat Shock 70 7e-25
1dg4_A115 Nmr Structure Of The Substrate Binding Domain Of Dn 6e-24
1dg4_A115 Nmr Structure Of The Substrate Binding Domain Of Dn 6e-24
1i7h_A111 Crystal Sturcuture Of Fdx Length = 111 2e-23
4gni_A409 Structure Of The Ssz1 Atpase Bound To Atp And Magne 3e-23
4gni_A409 Structure Of The Ssz1 Atpase Bound To Atp And Magne 3e-23
1q5l_A135 Nmr Structure Of The Substrate Binding Domain Of Dn 3e-23
1q5l_A135 Nmr Structure Of The Substrate Binding Domain Of Dn 3e-23
2z7e_A157 Crystal Structure Of Aquifex Aeolicus Iscu With Bou 4e-22
2z7e_A157 Crystal Structure Of Aquifex Aeolicus Iscu With Bou 4e-22
3dob_A152 Peptide-Binding Domain Of Heat Shock 70 Kda Protein 4e-22
3dob_A152 Peptide-Binding Domain Of Heat Shock 70 Kda Protein 4e-22
2op6_A152 Peptide-Binding Domain Of Heat Shock 70 Kda Protein 2e-21
2op6_A152 Peptide-Binding Domain Of Heat Shock 70 Kda Protein 2e-21
4eb5_C153 A. Fulgidus Iscs-Iscu Complex Structure Length = 15 3e-21
4eb5_C153 A. Fulgidus Iscs-Iscu Complex Structure Length = 15 3e-21
3h0x_A152 Crystal Structure Of Peptide-Binding Domain Of Kar2 2e-20
3h0x_A152 Crystal Structure Of Peptide-Binding Domain Of Kar2 2e-20
1xqs_C191 Crystal Structure Of The Hspbp1 Core Domain Complex 1e-17
1xqs_C191 Crystal Structure Of The Hspbp1 Core Domain Complex 1e-17
1t3i_A420 Structure Of Slr0077SUFS, THE ESSENTIAL CYSTEINE De 4e-17
1c0n_A406 Csdb Protein, Nifs Homologue Length = 406 2e-14
1c0n_A406 Csdb Protein, Nifs Homologue Length = 406 9e-14
1i29_A406 Crystal Structure Of Csdb Complexed With L-Propargy 5e-14
1i29_A406 Crystal Structure Of Csdb Complexed With L-Propargy 3e-13
1jf9_A408 Crystal Structure Of Selenocysteine Lyase Length = 5e-14
1jf9_A408 Crystal Structure Of Selenocysteine Lyase Length = 3e-13
1kmj_A406 E. Coli NifsCSDB PROTEIN AT 2.0A WITH THE CYSTEINE 5e-14
1kmj_A406 E. Coli NifsCSDB PROTEIN AT 2.0A WITH THE CYSTEINE 3e-13
1xjs_A147 Solution Structure Of Iron-Sulfur Cluster Assembly 2e-11
1xjs_A147 Solution Structure Of Iron-Sulfur Cluster Assembly 2e-11
1r94_A118 Crystal Structure Of Isca (mercury Derivative) Leng 2e-11
1r94_A118 Crystal Structure Of Isca (mercury Derivative) Leng 2e-11
1s98_A107 E.Coli Isca Crystal Structure To 2.3 A Length = 107 3e-11
1s98_A107 E.Coli Isca Crystal Structure To 2.3 A Length = 107 3e-11
2wlb_A103 Adrenodoxin-Like Ferredoxin Etp1fd(516-618) Of Schi 3e-11
1mw7_A240 X-Ray Structure Of Y162_helpy Northeast Structural 6e-11
2qq4_A138 Crystal Structure Of Iron-Sulfur Cluster Biosynthes 1e-10
2qq4_A138 Crystal Structure Of Iron-Sulfur Cluster Biosynthes 1e-10
3hui_A126 Crystal Structure Of The Mutant A105r Of [2fe-2s] F 4e-08
3ah7_A113 Crystal Structure Of The Isc-Like [2fe-2s] Ferredox 4e-08
1fpo_A171 Hsc20 (Hscb), A J-Type Co-Chaperone From E. Coli Le 2e-07
1fpo_A171 Hsc20 (Hscb), A J-Type Co-Chaperone From E. Coli Le 2e-07
2bt6_A108 Ru(Bpy)2(Mbpy)-Modified Bovine Adrenodoxin Length = 5e-07
1ayf_A105 Bovine Adrenodoxin (oxidized) Length = 105 5e-07
2jqr_B105 Solution Model Of Crosslinked Complex Of Cytochrome 6e-07
1cje_A127 Adrenodoxin From Bovine Length = 127 7e-07
1l6u_A128 Nmr Structure Of Oxidized Adrenodoxin Length = 128 7e-07
1e6e_B128 Adrenodoxin ReductaseADRENODOXIN COMPLEX OF MITOCHO 7e-07
1l6v_A128 Structure Of Reduced Bovine Adrenodoxin Length = 12 7e-07
3na0_C68 Crystal Structure Of Human Cyp11a1 In Complex With 1e-06
3n9y_C114 Crystal Structure Of Human Cyp11a1 In Complex With 1e-06
3n9z_C123 Crystal Structure Of Human Cyp11a1 In Complex With 1e-06
3p1m_A132 Crystal Structure Of Human Ferredoxin-1 (Fdx1) In C 1e-06
2y5c_A109 Structure Of Human Ferredoxin 2 (Fdx2)in Complex Wi 2e-06
1oqq_A106 Crystal Structure Of C73sC85S MUTANT OF PUTIDAREDOX 4e-06
1su0_B159 Crystal Structure Of A Hypothetical Protein At 2.3 8e-06
1su0_B159 Crystal Structure Of A Hypothetical Protein At 2.3 8e-06
1gpx_A106 C85s Gapdx, Nmr, 20 Structures Length = 106 8e-06
1oqr_A106 Crystal Structure Of C73s Mutant Of Putidaredoxin, 1e-05
1r7s_A106 Putidaredoxin (Fe2s2 Ferredoxin), C73g Mutant Lengt 2e-05
2d2a_A145 Crystal Structure Of Escherichia Coli Sufa Involved 3e-05
2d2a_A145 Crystal Structure Of Escherichia Coli Sufa Involved 3e-05
1put_A106 An Nmr-Derived Model For The Solution Structure Of 3e-05
1pdx_A106 Putidaredoxin Length = 106 3e-05
3cai_A406 Crystal Structure Of Mycobacterium Tuberculosis Rv3 8e-05
3cai_A406 Crystal Structure Of Mycobacterium Tuberculosis Rv3 8e-05
1elq_A390 Crystal Structure Of The Cystine C-S Lyase C-Des Le 1e-04
1elq_A390 Crystal Structure Of The Cystine C-S Lyase C-Des Le 1e-04
3bvo_A207 Crystal Structure Of Human Co-Chaperone Protein Hsc 3e-04
3bvo_A207 Crystal Structure Of Human Co-Chaperone Protein Hsc 3e-04
1n2t_A386 C-Des Mutant K223a With Gly Covalenty Linked To The 6e-04
1n2t_A386 C-Des Mutant K223a With Gly Covalenty Linked To The 6e-04
>pdb|1P3W|B Chain B, X-Ray Crystal Structure Of E. Coli Iscs Length = 404 Back     alignment and structure

Iteration: 1

Score = 538 bits (1385), Expect = e-152, Method: Compositional matrix adjust. Identities = 245/369 (66%), Positives = 317/369 (85%), Gaps = 3/369 (0%) Query: 1 MDYSATTPIDPRVVDKMIPYLRVQ--FGNPASRNHIYGWTAEKAIEKARNEVAQLIYADP 58 +DYSATTP+DPRV +KM+ ++ + FGNPASR+H +GW AE+A++ ARN++A L+ ADP Sbjct: 7 LDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADP 66 Query: 59 REIIWTSGATESNNLAIKGAAHFYKKRGKHIITVQTEHKSVLDSIRKLENDGFRVTYLKP 118 REI++TSGATES+NLAIKGAA+FY+K+GKHIIT +TEHK+VLD+ R+LE +GF VTYL P Sbjct: 67 REIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAP 126 Query: 119 KNNGLITLSQLEEKICSDTILVSVMLVNNEIGVIQPILEIGELCRSKGVIFHCDAAQAVG 178 + NG+I L +LE + DTILVS+M VNNEIGV+Q I IGE+CR++G+I+H DA Q+VG Sbjct: 127 QRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVG 186 Query: 179 KIDINIQNYKVDLMSFSAHKIYGPKGIGALYIRRNPRTRIEAQIHGGGHEYGLRSGTLAT 238 K+ I++ KVDLMSFS HKIYGPKGIGALY+RR PR RIEAQ+HGGGHE G+RSGTL Sbjct: 187 KLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPV 246 Query: 239 HQIVGMGEAFRLARIEMKEELKRILFLQKRLYNGLMESIEEIYINGDMNNRIPHNLNISF 298 HQIVGMGEA+R+A+ EM E++R+ L+ RL+NG+ + IEE+Y+NGD+ + P+ LN+SF Sbjct: 247 HQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGI-KDIEEVYLNGDLEHGAPNILNVSF 305 Query: 299 NFIEGESLLMAIKDIAVSSGSACTSASLEPSYVLRALGCNDELAHSSIRFTIGRFTTEKE 358 N++EGESL+MA+KD+AVSSGSACTSASLEPSYVLRALG NDELAHSSIRF++GRFTTE+E Sbjct: 306 NYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEE 365 Query: 359 IDFTIKLLK 367 ID+TI+L++ Sbjct: 366 IDYTIELVR 374
>pdb|1P3W|B Chain B, X-Ray Crystal Structure Of E. Coli Iscs Length = 404 Back     alignment and structure
>pdb|3LVJ|A Chain A, Crystal Structure Of E.Coli Iscs-Tusa Complex (Form 1) Length = 423 Back     alignment and structure
>pdb|3LVJ|A Chain A, Crystal Structure Of E.Coli Iscs-Tusa Complex (Form 1) Length = 423 Back     alignment and structure
>pdb|2KHO|A Chain A, Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAPERONE (1-605) Complexed With Adp And Substrate Length = 605 Back     alignment and structure
>pdb|2KHO|A Chain A, Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAPERONE (1-605) Complexed With Adp And Substrate Length = 605 Back     alignment and structure
>pdb|4B9Q|A Chain A, Open Conformation Of Atp-Bound Hsp70 Homolog Dnak Length = 605 Back     alignment and structure
>pdb|4B9Q|A Chain A, Open Conformation Of Atp-Bound Hsp70 Homolog Dnak Length = 605 Back     alignment and structure
>pdb|2V7Y|A Chain A, Crystal Structure Of The Molecular Chaperone Dnak From Geobacillus Kaustophilus Hta426 In Post-Atp Hydrolysis State Length = 509 Back     alignment and structure
>pdb|2V7Y|A Chain A, Crystal Structure Of The Molecular Chaperone Dnak From Geobacillus Kaustophilus Hta426 In Post-Atp Hydrolysis State Length = 509 Back     alignment and structure
>pdb|3C7N|B Chain B, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 554 Back     alignment and structure
>pdb|3C7N|B Chain B, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 554 Back     alignment and structure
>pdb|1YUW|A Chain A, Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214A MUTANT Length = 554 Back     alignment and structure
>pdb|1YUW|A Chain A, Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214A MUTANT Length = 554 Back     alignment and structure
>pdb|2V7Z|A Chain A, Crystal Structure Of The 70-Kda Heat Shock Cognate Protein From Rattus Norvegicus In Post-Atp Hydrolysis State Length = 543 Back     alignment and structure
>pdb|2V7Z|A Chain A, Crystal Structure Of The 70-Kda Heat Shock Cognate Protein From Rattus Norvegicus In Post-Atp Hydrolysis State Length = 543 Back     alignment and structure
>pdb|4EB5|A Chain A, A. Fulgidus Iscs-Iscu Complex Structure Length = 382 Back     alignment and structure
>pdb|4EB5|A Chain A, A. Fulgidus Iscs-Iscu Complex Structure Length = 382 Back     alignment and structure
>pdb|3VAX|A Chain A, Crytal Structure Of Dnda From Streptomyces Lividans Length = 400 Back     alignment and structure
>pdb|3VAX|A Chain A, Crytal Structure Of Dnda From Streptomyces Lividans Length = 400 Back     alignment and structure
>pdb|1ECX|A Chain A, Nifs-Like Protein Length = 384 Back     alignment and structure
>pdb|1ECX|A Chain A, Nifs-Like Protein Length = 384 Back     alignment and structure
>pdb|1DKG|D Chain D, Crystal Structure Of The Nucleotide Exchange Factor Grpe Bound To The Atpase Domain Of The Molecular Chaperone Dnak Length = 383 Back     alignment and structure
>pdb|1DKG|D Chain D, Crystal Structure Of The Nucleotide Exchange Factor Grpe Bound To The Atpase Domain Of The Molecular Chaperone Dnak Length = 383 Back     alignment and structure
>pdb|3QFP|A Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE DOMAIN Length = 390 Back     alignment and structure
>pdb|3QFP|A Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE DOMAIN Length = 390 Back     alignment and structure
>pdb|1EG5|A Chain A, Nifs-like Protein Length = 384 Back     alignment and structure
>pdb|1EG5|A Chain A, Nifs-like Protein Length = 384 Back     alignment and structure
>pdb|3IUC|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 5 (BipGRP78) ATPASE DOMAIN IN COMPLEX WITH ADP Length = 408 Back     alignment and structure
>pdb|3IUC|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 5 (BipGRP78) ATPASE DOMAIN IN COMPLEX WITH ADP Length = 408 Back     alignment and structure
>pdb|3LDL|A Chain A, Crystal Structure Of Human Grp78 (70kda Heat Shock Protein 5 BIP) Atpase Domain In Complex With Atp Length = 384 Back     alignment and structure
>pdb|3LDL|A Chain A, Crystal Structure Of Human Grp78 (70kda Heat Shock Protein 5 BIP) Atpase Domain In Complex With Atp Length = 384 Back     alignment and structure
>pdb|1HPM|A Chain A, How Potassium Affects The Activity Of The Molecular Chaperone Hsc70. Ii. Potassium Binds Specifically In The Atpase Active Site Length = 386 Back     alignment and structure
>pdb|1HPM|A Chain A, How Potassium Affects The Activity Of The Molecular Chaperone Hsc70. Ii. Potassium Binds Specifically In The Atpase Active Site Length = 386 Back     alignment and structure
>pdb|1BA1|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal Mutant With Cys 17 Replaced By Lys Length = 386 Back     alignment and structure
>pdb|1BA1|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal Mutant With Cys 17 Replaced By Lys Length = 386 Back     alignment and structure
>pdb|1NGB|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGB|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1BUP|A Chain A, T13s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 386 Back     alignment and structure
>pdb|1BUP|A Chain A, T13s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 386 Back     alignment and structure
>pdb|1ATR|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>pdb|1ATR|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>pdb|1NGD|A Chain A, Structural Basis Of The 70-kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGD|A Chain A, Structural Basis Of The 70-kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGF|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGF|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGH|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGH|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1ATS|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>pdb|1ATS|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>pdb|1NGA|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGA|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGG|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGG|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGC|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGC|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGE|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGE|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1BA0|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal 1nge 3 Length = 386 Back     alignment and structure
>pdb|1BA0|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal 1nge 3 Length = 386 Back     alignment and structure
>pdb|2QWN|A Chain A, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-386aa)r171c And Bovine Auxilin (810-910aa)d876c In The AdpPi State Length = 394 Back     alignment and structure
>pdb|2QWN|A Chain A, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-386aa)r171c And Bovine Auxilin (810-910aa)d876c In The AdpPi State Length = 394 Back     alignment and structure
>pdb|3I33|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 2 (Hsp70-2) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 404 Back     alignment and structure
>pdb|3I33|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 2 (Hsp70-2) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 404 Back     alignment and structure
>pdb|3FE1|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 6 (Hsp70b') Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 403 Back     alignment and structure
>pdb|3FE1|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 6 (Hsp70b') Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 403 Back     alignment and structure
>pdb|3CQX|A Chain A, Chaperone Complex Length = 386 Back     alignment and structure
>pdb|3CQX|A Chain A, Chaperone Complex Length = 386 Back     alignment and structure
>pdb|1HX1|A Chain A, Crystal Structure Of A Bag Domain In Complex With The Hsc70 Atpase Domain Length = 400 Back     alignment and structure
>pdb|1HX1|A Chain A, Crystal Structure Of A Bag Domain In Complex With The Hsc70 Atpase Domain Length = 400 Back     alignment and structure
>pdb|3FZF|A Chain A, Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP Length = 381 Back     alignment and structure
>pdb|3FZF|A Chain A, Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP Length = 381 Back     alignment and structure
>pdb|1KAZ|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71e Mutant Length = 381 Back     alignment and structure
>pdb|1KAZ|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71e Mutant Length = 381 Back     alignment and structure
>pdb|3GDQ|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1-Like Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 408 Back     alignment and structure
>pdb|3GDQ|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1-Like Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 408 Back     alignment and structure
>pdb|1KAY|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71a Mutant Length = 381 Back     alignment and structure
>pdb|1KAY|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71a Mutant Length = 381 Back     alignment and structure
>pdb|4FSV|A Chain A, Crystal Structure Of A Heat Shock 70kda Protein 2 (Hspa2) From Homo Sapiens At 1.80 A Resolution Length = 387 Back     alignment and structure
>pdb|4FSV|A Chain A, Crystal Structure Of A Heat Shock 70kda Protein 2 (Hspa2) From Homo Sapiens At 1.80 A Resolution Length = 387 Back     alignment and structure
>pdb|2BUP|A Chain A, T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 Length = 381 Back     alignment and structure
>pdb|2BUP|A Chain A, T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 Length = 381 Back     alignment and structure
>pdb|1KAX|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71m Mutant Length = 381 Back     alignment and structure
>pdb|1KAX|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71m Mutant Length = 381 Back     alignment and structure
>pdb|1QQN|A Chain A, D206s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|1QQN|A Chain A, D206s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|1QQM|A Chain A, D199s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|1QQM|A Chain A, D199s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|3GL1|A Chain A, Crystal Structure Of Atpase Domain Of Ssb1 Chaperone, A Member Of The Hsp70 Family, From Saccharomyces Cerevisiae Length = 387 Back     alignment and structure
>pdb|3GL1|A Chain A, Crystal Structure Of Atpase Domain Of Ssb1 Chaperone, A Member Of The Hsp70 Family, From Saccharomyces Cerevisiae Length = 387 Back     alignment and structure
>pdb|1QQO|A Chain A, E175s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|1QQO|A Chain A, E175s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|3A8Y|A Chain A, Crystal Structure Of The Complex Between The Bag5 Bd5 And Hsp70 Nbd Length = 392 Back     alignment and structure
>pdb|3A8Y|A Chain A, Crystal Structure Of The Complex Between The Bag5 Bd5 And Hsp70 Nbd Length = 392 Back     alignment and structure
>pdb|3JXU|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1a (Hsp70-1) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 409 Back     alignment and structure
>pdb|3JXU|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1a (Hsp70-1) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 409 Back     alignment and structure
>pdb|2E8A|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In Complex With Amp-Pnp Length = 391 Back     alignment and structure
>pdb|2E8A|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In Complex With Amp-Pnp Length = 391 Back     alignment and structure
>pdb|2E88|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In The Apo Form Length = 391 Back     alignment and structure
>pdb|2E88|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In The Apo Form Length = 391 Back     alignment and structure
>pdb|3D2F|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 382 Back     alignment and structure
>pdb|3D2F|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 382 Back     alignment and structure
>pdb|1S3X|A Chain A, The Crystal Structure Of The Human Hsp70 Atpase Domain Length = 382 Back     alignment and structure
>pdb|1S3X|A Chain A, The Crystal Structure Of The Human Hsp70 Atpase Domain Length = 382 Back     alignment and structure
>pdb|1HJO|A Chain A, Atpase Domain Of Human Heat Shock 70kda Protein 1 Length = 380 Back     alignment and structure
>pdb|1HJO|A Chain A, Atpase Domain Of Human Heat Shock 70kda Protein 1 Length = 380 Back     alignment and structure
>pdb|3KVG|A Chain A, Crystal Structure Of The N-Terminal Domain Of Hsp70 (Cgd2_20) From Cryptosporidium Parvum In Complex With Amppnp Length = 400 Back     alignment and structure
>pdb|3KVG|A Chain A, Crystal Structure Of The N-Terminal Domain Of Hsp70 (Cgd2_20) From Cryptosporidium Parvum In Complex With Amppnp Length = 400 Back     alignment and structure
>pdb|3D2E|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 382 Back     alignment and structure
>pdb|3D2E|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 382 Back     alignment and structure
>pdb|3A9X|A Chain A, Crystal Structure Of Rat Selenocysteine Lyase Length = 432 Back     alignment and structure
>pdb|3A9X|A Chain A, Crystal Structure Of Rat Selenocysteine Lyase Length = 432 Back     alignment and structure
>pdb|3GZC|A Chain A, Structure Of Human Selenocysteine Lyase Length = 440 Back     alignment and structure
>pdb|3GZC|A Chain A, Structure Of Human Selenocysteine Lyase Length = 440 Back     alignment and structure
>pdb|2L4X|A Chain A, Solution Structure Of Apo-Iscu(Wt) Length = 128 Back     alignment and structure
>pdb|2L4X|A Chain A, Solution Structure Of Apo-Iscu(Wt) Length = 128 Back     alignment and structure
>pdb|3GZD|A Chain A, Human Selenocysteine Lyase, P1 Crystal Form Length = 440 Back     alignment and structure
>pdb|3GZD|A Chain A, Human Selenocysteine Lyase, P1 Crystal Form Length = 440 Back     alignment and structure
>pdb|3LVL|A Chain A, Crystal Structure Of E.Coli Iscs-Iscu Complex Length = 129 Back     alignment and structure
>pdb|3LVL|A Chain A, Crystal Structure Of E.Coli Iscs-Iscu Complex Length = 129 Back     alignment and structure
>pdb|2KQK|A Chain A, Solution Structure Of Apo-Iscu(D39a) Length = 128 Back     alignment and structure
>pdb|2KQK|A Chain A, Solution Structure Of Apo-Iscu(D39a) Length = 128 Back     alignment and structure
>pdb|1Q48|A Chain A, Solution Nmr Structure Of The Haemophilus Influenzae Iron- Sulfur Cluster Assembly Protein U (Iscu) With Zinc Bound At The Active Site. Northeast Structural Genomics Consortium Target Ir24. This Protein Is Not Apo, It Is A Model Without Zinc Binding Constraints. Length = 134 Back     alignment and structure
>pdb|1Q48|A Chain A, Solution Nmr Structure Of The Haemophilus Influenzae Iron- Sulfur Cluster Assembly Protein U (Iscu) With Zinc Bound At The Active Site. Northeast Structural Genomics Consortium Target Ir24. This Protein Is Not Apo, It Is A Model Without Zinc Binding Constraints. Length = 134 Back     alignment and structure
>pdb|1U00|A Chain A, Hsca Substrate Binding Domain Complexed With The Iscu Recognition Peptide Elppvkihc Length = 227 Back     alignment and structure
>pdb|1U00|A Chain A, Hsca Substrate Binding Domain Complexed With The Iscu Recognition Peptide Elppvkihc Length = 227 Back     alignment and structure
>pdb|1WFZ|A Chain A, Solution Structure Of Iron-Sulfur Cluster Protein U (Iscu) Length = 130 Back     alignment and structure
>pdb|1WFZ|A Chain A, Solution Structure Of Iron-Sulfur Cluster Protein U (Iscu) Length = 130 Back     alignment and structure
>pdb|4IXO|A Chain A, X-ray Structure Of Nifs-like Protein From Rickettsia Africae Esf-5 Length = 380 Back     alignment and structure
>pdb|4IXO|A Chain A, X-ray Structure Of Nifs-like Protein From Rickettsia Africae Esf-5 Length = 380 Back     alignment and structure
>pdb|1KON|A Chain A, Crystal Structure Of E.Coli Yebc Length = 249 Back     alignment and structure
>pdb|3C7N|A Chain A, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 668 Back     alignment and structure
>pdb|3C7N|A Chain A, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 668 Back     alignment and structure
>pdb|2QXL|A Chain A, Crystal Structure Analysis Of Sse1, A Yeast Hsp110 Length = 658 Back     alignment and structure
>pdb|2QXL|A Chain A, Crystal Structure Analysis Of Sse1, A Yeast Hsp110 Length = 658 Back     alignment and structure
>pdb|3D2F|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 675 Back     alignment and structure
>pdb|3D2F|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 675 Back     alignment and structure
>pdb|4F3Q|A Chain A, Structure Of A Yebc Family Protein (Cbu_1566) From Coxiella Burnetii Length = 247 Back     alignment and structure
>pdb|3D2E|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 675 Back     alignment and structure
>pdb|3D2E|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 675 Back     alignment and structure
>pdb|1DKY|A Chain A, The Substrate Binding Domain Of Dnak In Complex With A Substrate Peptide, Determined From Type 2 Native Crystals Length = 219 Back     alignment and structure
>pdb|1DKY|A Chain A, The Substrate Binding Domain Of Dnak In Complex With A Substrate Peptide, Determined From Type 2 Native Crystals Length = 219 Back     alignment and structure
>pdb|1BPR|A Chain A, Nmr Structure Of The Substrate Binding Domain Of Dnak, Minimized Average Structure Length = 191 Back     alignment and structure
>pdb|1BPR|A Chain A, Nmr Structure Of The Substrate Binding Domain Of Dnak, Minimized Average Structure Length = 191 Back     alignment and structure
>pdb|3DPO|A Chain A, Crystal Structure Of The Substrate Binding Domain Of E. Coli Dnak In Complex With A Short Pyrrhocoricin-Derived Inhibitor Peptide Length = 219 Back     alignment and structure
>pdb|3DPO|A Chain A, Crystal Structure Of The Substrate Binding Domain Of E. Coli Dnak In Complex With A Short Pyrrhocoricin-Derived Inhibitor Peptide Length = 219 Back     alignment and structure
>pdb|1DKX|A Chain A, The Substrate Binding Domain Of Dnak In Complex With A Substrate Peptide, Determined From Type 1 Selenomethionyl Crystals Length = 219 Back     alignment and structure
>pdb|1DKX|A Chain A, The Substrate Binding Domain Of Dnak In Complex With A Substrate Peptide, Determined From Type 1 Selenomethionyl Crystals Length = 219 Back     alignment and structure
>pdb|1CKR|A Chain A, High Resolution Solution Structure Of The Heat Shock Cognate-70 Kd Substrate Binding Domain Obtained By Multidimensional Nmr Techniques Length = 159 Back     alignment and structure
>pdb|1CKR|A Chain A, High Resolution Solution Structure Of The Heat Shock Cognate-70 Kd Substrate Binding Domain Obtained By Multidimensional Nmr Techniques Length = 159 Back     alignment and structure
>pdb|1LFP|A Chain A, Crystal Structure Of A Conserved Hypothetical Protein Aq1575 From Aquifex Aeolicus Length = 249 Back     alignment and structure
>pdb|3DQG|A Chain A, Peptide-Binding Domain Of Heat Shock 70 Kda Protein F, Mitochondrial Precursor, From Caenorhabditis Elegans. Length = 151 Back     alignment and structure
>pdb|3DQG|A Chain A, Peptide-Binding Domain Of Heat Shock 70 Kda Protein F, Mitochondrial Precursor, From Caenorhabditis Elegans. Length = 151 Back     alignment and structure
>pdb|3N8E|A Chain A, Substrate Binding Domain Of The Human Heat Shock 70kda Prote (Mortalin) Length = 182 Back     alignment and structure
>pdb|3N8E|A Chain A, Substrate Binding Domain Of The Human Heat Shock 70kda Prote (Mortalin) Length = 182 Back     alignment and structure
>pdb|1DG4|A Chain A, Nmr Structure Of The Substrate Binding Domain Of Dnak In The Apo Form Length = 115 Back     alignment and structure
>pdb|1DG4|A Chain A, Nmr Structure Of The Substrate Binding Domain Of Dnak In The Apo Form Length = 115 Back     alignment and structure
>pdb|1I7H|A Chain A, Crystal Sturcuture Of Fdx Length = 111 Back     alignment and structure
>pdb|4GNI|A Chain A, Structure Of The Ssz1 Atpase Bound To Atp And Magnesium Length = 409 Back     alignment and structure
>pdb|4GNI|A Chain A, Structure Of The Ssz1 Atpase Bound To Atp And Magnesium Length = 409 Back     alignment and structure
>pdb|1Q5L|A Chain A, Nmr Structure Of The Substrate Binding Domain Of Dnak Bound To The Peptide Nrllltg Length = 135 Back     alignment and structure
>pdb|1Q5L|A Chain A, Nmr Structure Of The Substrate Binding Domain Of Dnak Bound To The Peptide Nrllltg Length = 135 Back     alignment and structure
>pdb|2Z7E|A Chain A, Crystal Structure Of Aquifex Aeolicus Iscu With Bound [2fe- 2s] Cluster Length = 157 Back     alignment and structure
>pdb|2Z7E|A Chain A, Crystal Structure Of Aquifex Aeolicus Iscu With Bound [2fe- 2s] Cluster Length = 157 Back     alignment and structure
>pdb|3DOB|A Chain A, Peptide-Binding Domain Of Heat Shock 70 Kda Protein F44e5.5 From C.Elegans. Length = 152 Back     alignment and structure
>pdb|3DOB|A Chain A, Peptide-Binding Domain Of Heat Shock 70 Kda Protein F44e5.5 From C.Elegans. Length = 152 Back     alignment and structure
>pdb|2OP6|A Chain A, Peptide-Binding Domain Of Heat Shock 70 Kda Protein D Precursor From C.Elegans Length = 152 Back     alignment and structure
>pdb|2OP6|A Chain A, Peptide-Binding Domain Of Heat Shock 70 Kda Protein D Precursor From C.Elegans Length = 152 Back     alignment and structure
>pdb|4EB5|C Chain C, A. Fulgidus Iscs-Iscu Complex Structure Length = 153 Back     alignment and structure
>pdb|4EB5|C Chain C, A. Fulgidus Iscs-Iscu Complex Structure Length = 153 Back     alignment and structure
>pdb|3H0X|A Chain A, Crystal Structure Of Peptide-Binding Domain Of Kar2 Protein From Saccharomyces Cerevisiae Length = 152 Back     alignment and structure
>pdb|3H0X|A Chain A, Crystal Structure Of Peptide-Binding Domain Of Kar2 Protein From Saccharomyces Cerevisiae Length = 152 Back     alignment and structure
>pdb|1XQS|C Chain C, Crystal Structure Of The Hspbp1 Core Domain Complexed With The Fragment Of Hsp70 Atpase Domain Length = 191 Back     alignment and structure
>pdb|1XQS|C Chain C, Crystal Structure Of The Hspbp1 Core Domain Complexed With The Fragment Of Hsp70 Atpase Domain Length = 191 Back     alignment and structure
>pdb|1T3I|A Chain A, Structure Of Slr0077SUFS, THE ESSENTIAL CYSTEINE Desulfurase From Synechocystis Pcc 6803 Length = 420 Back     alignment and structure
>pdb|1C0N|A Chain A, Csdb Protein, Nifs Homologue Length = 406 Back     alignment and structure
>pdb|1C0N|A Chain A, Csdb Protein, Nifs Homologue Length = 406 Back     alignment and structure
>pdb|1I29|A Chain A, Crystal Structure Of Csdb Complexed With L-Propargylglycine Length = 406 Back     alignment and structure
>pdb|1I29|A Chain A, Crystal Structure Of Csdb Complexed With L-Propargylglycine Length = 406 Back     alignment and structure
>pdb|1JF9|A Chain A, Crystal Structure Of Selenocysteine Lyase Length = 408 Back     alignment and structure
>pdb|1JF9|A Chain A, Crystal Structure Of Selenocysteine Lyase Length = 408 Back     alignment and structure
>pdb|1KMJ|A Chain A, E. Coli NifsCSDB PROTEIN AT 2.0A WITH THE CYSTEINE PERSULFIDE Intermediate (Residue Css). Length = 406 Back     alignment and structure
>pdb|1KMJ|A Chain A, E. Coli NifsCSDB PROTEIN AT 2.0A WITH THE CYSTEINE PERSULFIDE Intermediate (Residue Css). Length = 406 Back     alignment and structure
>pdb|1XJS|A Chain A, Solution Structure Of Iron-Sulfur Cluster Assembly Protein Iscu From Bacillus Subtilis, With Zinc Bound At The Active Site. Northeast Structural Genomics Consortium Target Sr17 Length = 147 Back     alignment and structure
>pdb|1XJS|A Chain A, Solution Structure Of Iron-Sulfur Cluster Assembly Protein Iscu From Bacillus Subtilis, With Zinc Bound At The Active Site. Northeast Structural Genomics Consortium Target Sr17 Length = 147 Back     alignment and structure
>pdb|1R94|A Chain A, Crystal Structure Of Isca (mercury Derivative) Length = 118 Back     alignment and structure
>pdb|1R94|A Chain A, Crystal Structure Of Isca (mercury Derivative) Length = 118 Back     alignment and structure
>pdb|1S98|A Chain A, E.Coli Isca Crystal Structure To 2.3 A Length = 107 Back     alignment and structure
>pdb|1S98|A Chain A, E.Coli Isca Crystal Structure To 2.3 A Length = 107 Back     alignment and structure
>pdb|2WLB|A Chain A, Adrenodoxin-Like Ferredoxin Etp1fd(516-618) Of Schizosaccharomyces Pombe Mitochondria Length = 103 Back     alignment and structure
>pdb|1MW7|A Chain A, X-Ray Structure Of Y162_helpy Northeast Structural Genomics Consortium Target Pr6 Length = 240 Back     alignment and structure
>pdb|2QQ4|A Chain A, Crystal Structure Of Iron-Sulfur Cluster Biosynthesis Protein Iscu (Ttha1736) From Thermus Thermophilus Hb8 Length = 138 Back     alignment and structure
>pdb|2QQ4|A Chain A, Crystal Structure Of Iron-Sulfur Cluster Biosynthesis Protein Iscu (Ttha1736) From Thermus Thermophilus Hb8 Length = 138 Back     alignment and structure
>pdb|3HUI|A Chain A, Crystal Structure Of The Mutant A105r Of [2fe-2s] Ferredoxin In The Class I Cyp199a2 System From Rhodopseudomonas Palustris Length = 126 Back     alignment and structure
>pdb|3AH7|A Chain A, Crystal Structure Of The Isc-Like [2fe-2s] Ferredoxin (Fdxb) From Pseudomonas Putida Jcm 20004 Length = 113 Back     alignment and structure
>pdb|1FPO|A Chain A, Hsc20 (Hscb), A J-Type Co-Chaperone From E. Coli Length = 171 Back     alignment and structure
>pdb|1FPO|A Chain A, Hsc20 (Hscb), A J-Type Co-Chaperone From E. Coli Length = 171 Back     alignment and structure
>pdb|2BT6|A Chain A, Ru(Bpy)2(Mbpy)-Modified Bovine Adrenodoxin Length = 108 Back     alignment and structure
>pdb|1AYF|A Chain A, Bovine Adrenodoxin (oxidized) Length = 105 Back     alignment and structure
>pdb|2JQR|B Chain B, Solution Model Of Crosslinked Complex Of Cytochrome C And Adrenodoxin Length = 105 Back     alignment and structure
>pdb|1CJE|A Chain A, Adrenodoxin From Bovine Length = 127 Back     alignment and structure
>pdb|1L6U|A Chain A, Nmr Structure Of Oxidized Adrenodoxin Length = 128 Back     alignment and structure
>pdb|1E6E|B Chain B, Adrenodoxin ReductaseADRENODOXIN COMPLEX OF MITOCHONDRIAL P450 Systems Length = 128 Back     alignment and structure
>pdb|1L6V|A Chain A, Structure Of Reduced Bovine Adrenodoxin Length = 128 Back     alignment and structure
>pdb|3NA0|C Chain C, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 68 Back     alignment and structure
>pdb|3N9Y|C Chain C, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 114 Back     alignment and structure
>pdb|3N9Z|C Chain C, Crystal Structure Of Human Cyp11a1 In Complex With 22- Hydroxycholesterol Length = 123 Back     alignment and structure
>pdb|3P1M|A Chain A, Crystal Structure Of Human Ferredoxin-1 (Fdx1) In Complex With Iron- Sulfur Cluster Length = 132 Back     alignment and structure
>pdb|2Y5C|A Chain A, Structure Of Human Ferredoxin 2 (Fdx2)in Complex With 2fe2s Cluster Length = 109 Back     alignment and structure
>pdb|1OQQ|A Chain A, Crystal Structure Of C73sC85S MUTANT OF PUTIDAREDOXIN, A [2FE-2s] Ferredoxin From Pseudomonas Putida, At 1.47a Resolution Length = 106 Back     alignment and structure
>pdb|1SU0|B Chain B, Crystal Structure Of A Hypothetical Protein At 2.3 A Resolution Length = 159 Back     alignment and structure
>pdb|1SU0|B Chain B, Crystal Structure Of A Hypothetical Protein At 2.3 A Resolution Length = 159 Back     alignment and structure
>pdb|1GPX|A Chain A, C85s Gapdx, Nmr, 20 Structures Length = 106 Back     alignment and structure
>pdb|1OQR|A Chain A, Crystal Structure Of C73s Mutant Of Putidaredoxin, A [2fe- 2s] Ferredoxin From Pseudomonas Putida, At 1.65a Resolution Length = 106 Back     alignment and structure
>pdb|1R7S|A Chain A, Putidaredoxin (Fe2s2 Ferredoxin), C73g Mutant Length = 106 Back     alignment and structure
>pdb|2D2A|A Chain A, Crystal Structure Of Escherichia Coli Sufa Involved In Biosynthesis Of Iron-Sulfur Clusters Length = 145 Back     alignment and structure
>pdb|2D2A|A Chain A, Crystal Structure Of Escherichia Coli Sufa Involved In Biosynthesis Of Iron-Sulfur Clusters Length = 145 Back     alignment and structure
>pdb|1PUT|A Chain A, An Nmr-Derived Model For The Solution Structure Of Oxidized Putidaredoxin, A 2fe, 2-S Ferredoxin From Pseudomonas Length = 106 Back     alignment and structure
>pdb|1PDX|A Chain A, Putidaredoxin Length = 106 Back     alignment and structure
>pdb|3CAI|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Rv3778c Protein Length = 406 Back     alignment and structure
>pdb|3CAI|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Rv3778c Protein Length = 406 Back     alignment and structure
>pdb|1ELQ|A Chain A, Crystal Structure Of The Cystine C-S Lyase C-Des Length = 390 Back     alignment and structure
>pdb|1ELQ|A Chain A, Crystal Structure Of The Cystine C-S Lyase C-Des Length = 390 Back     alignment and structure
>pdb|3BVO|A Chain A, Crystal Structure Of Human Co-Chaperone Protein Hscb Length = 207 Back     alignment and structure
>pdb|3BVO|A Chain A, Crystal Structure Of Human Co-Chaperone Protein Hscb Length = 207 Back     alignment and structure
>pdb|1N2T|A Chain A, C-Des Mutant K223a With Gly Covalenty Linked To The Plp-Cofactor Length = 386 Back     alignment and structure
>pdb|1N2T|A Chain A, C-Des Mutant K223a With Gly Covalenty Linked To The Plp-Cofactor Length = 386 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query2602
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 0.0
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 0.0
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 0.0
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 0.0
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 0.0
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 0.0
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 0.0
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 0.0
2kho_A605 Heat shock protein 70; molecular chaperone, HSP70, 1e-140
2kho_A605 Heat shock protein 70; molecular chaperone, HSP70, 1e-140
2v7y_A509 Chaperone protein DNAK; HSP70, heat shock protein, 1e-136
2v7y_A509 Chaperone protein DNAK; HSP70, heat shock protein, 1e-136
1yuw_A554 Heat shock cognate 71 kDa protein; chaperone; 2.60 1e-134
1yuw_A554 Heat shock cognate 71 kDa protein; chaperone; 2.60 1e-134
3d2f_A675 Heat shock protein homolog SSE1; nucleotide exchan 1e-124
3d2f_A675 Heat shock protein homolog SSE1; nucleotide exchan 1e-124
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 4e-97
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 4e-97
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 9e-88
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 9e-88
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 8e-86
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 8e-86
4f3q_A247 Transcriptional regulatory protein CBU_1566; YEBC 9e-68
1kon_A249 Protein YEBC, YEBC; alpha/beta, two-domains, montr 2e-66
1lfp_A249 Hypothetical protein AQ_1575; NEW fold, thermostab 2e-64
1mw7_A240 Hypothetical protein HP0162; structural genomics, 1e-60
1u00_A227 HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A 2e-59
1u00_A227 HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A 2e-59
2z7e_A157 ISCU protein, NIFU-like protein; iron-sulfur clust 2e-47
2z7e_A157 ISCU protein, NIFU-like protein; iron-sulfur clust 2e-47
3lvl_A129 NIFU-like protein; protein-protein complex, struct 3e-47
3lvl_A129 NIFU-like protein; protein-protein complex, struct 3e-47
4eb5_C153 NIFU protein (NIFU-1); scaffold, transferase-metal 9e-45
4eb5_C153 NIFU protein (NIFU-1); scaffold, transferase-metal 9e-45
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 1e-42
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 1e-42
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 7e-41
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 1e-39
1q5l_A135 Chaperone protein DNAK; HSP70, chaperone, heat sho 5e-39
1q5l_A135 Chaperone protein DNAK; HSP70, chaperone, heat sho 5e-39
3n8e_A182 Stress-70 protein, mitochondrial; beta-sandwich, h 8e-39
3n8e_A182 Stress-70 protein, mitochondrial; beta-sandwich, h 8e-39
3h0x_A152 78 kDa glucose-regulated protein homolog; structur 1e-38
3h0x_A152 78 kDa glucose-regulated protein homolog; structur 1e-38
3dob_A152 Heat shock 70 kDa protein F44E5.5; structural geno 1e-38
3dob_A152 Heat shock 70 kDa protein F44E5.5; structural geno 1e-38
2op6_A152 Heat shock 70 kDa protein D; HSP70/peptide-binding 2e-38
2op6_A152 Heat shock 70 kDa protein D; HSP70/peptide-binding 2e-38
4e81_A219 Chaperone protein DNAK; chaperone; 1.90A {Escheric 1e-36
4e81_A219 Chaperone protein DNAK; chaperone; 1.90A {Escheric 1e-36
3dqg_A151 Heat shock 70 kDa protein F; structural genomics, 2e-36
3dqg_A151 Heat shock 70 kDa protein F; structural genomics, 2e-36
1su0_B159 NIFU like protein ISCU; structural genomics, BSGC 3e-36
1su0_B159 NIFU like protein ISCU; structural genomics, BSGC 3e-36
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 1e-35
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 3e-35
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 2e-35
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 2e-32
2qq4_A138 Iron-sulfur cluster biosynthesis protein ISCU; zin 4e-35
2qq4_A138 Iron-sulfur cluster biosynthesis protein ISCU; zin 4e-35
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 1e-34
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 9e-32
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 1e-33
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 2e-33
1xjs_A147 NIFU-like protein; SR17, structure, autostructure, 6e-33
1xjs_A147 NIFU-like protein; SR17, structure, autostructure, 6e-33
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 8e-33
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 1e-32
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 2e-28
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 1e-25
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 2e-26
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 2e-23
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 4e-26
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 3e-23
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 8e-26
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 6e-23
1r94_A118 Protein YFHF; tetrameric, beta barrel, iron-sulfur 8e-24
1r94_A118 Protein YFHF; tetrameric, beta barrel, iron-sulfur 8e-24
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 1e-23
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 1e-23
2zgy_A320 Plasmid segregation protein PARM; plasmid partitio 2e-23
2zgy_A320 Plasmid segregation protein PARM; plasmid partitio 2e-23
2d2a_A145 SUFA protein; iron-sulfur cluster, iron, ISCA, YAD 7e-23
2d2a_A145 SUFA protein; iron-sulfur cluster, iron, ISCA, YAD 7e-23
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 1e-22
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 1e-22
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 3e-21
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 3e-18
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 2e-20
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 1e-17
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 4e-20
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 4e-17
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 5e-20
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 4e-17
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 3e-19
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 2e-16
1x0g_A112 ISCA; [2Fe-2S], biosynthesis, cyanobacteria, domai 6e-19
1x0g_A112 ISCA; [2Fe-2S], biosynthesis, cyanobacteria, domai 6e-19
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 3e-17
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 2e-14
2k4z_A125 DSRR; ISCA/SUFA/HESB like fold, structural genomic 1e-16
2k4z_A125 DSRR; ISCA/SUFA/HESB like fold, structural genomic 1e-16
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 4e-16
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 4e-16
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 2e-15
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 2e-15
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 2e-14
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 2e-14
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 3e-14
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 3e-14
1nwb_A124 Hypothetical protein AQ_1857; QR6, structural geno 4e-14
1nwb_A124 Hypothetical protein AQ_1857; QR6, structural geno 4e-14
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-13
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-12
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 5e-13
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 5e-13
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 5e-13
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 5e-13
2fsj_A346 Hypothetical protein TA0583; actin homologs, archa 3e-12
2fsj_A346 Hypothetical protein TA0583; actin homologs, archa 3e-12
2apn_A114 Protein HI1723; HI1723 solution structure, structu 3e-12
2apn_A114 Protein HI1723; HI1723 solution structure, structu 3e-12
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 6e-10
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 6e-10
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 7e-10
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 7e-10
3js6_A355 Uncharacterized PARM protein; partition, segregati 7e-10
3js6_A355 Uncharacterized PARM protein; partition, segregati 7e-10
4apw_A329 ALP12; actin-like protein; 19.70A {Clostridium tet 1e-09
4apw_A329 ALP12; actin-like protein; 19.70A {Clostridium tet 1e-09
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 2e-09
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 2e-09
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 2e-08
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 2e-08
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 7e-08
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 7e-08
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 1e-07
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 1e-07
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 1e-07
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 1e-07
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 1e-07
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 1e-07
3pj0_A359 LMO0305 protein; structural genomics, joint center 2e-06
3pj0_A359 LMO0305 protein; structural genomics, joint center 2e-06
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 4e-06
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 4e-06
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 6e-06
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 6e-06
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 1e-05
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 1e-05
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 2e-05
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 2e-05
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 3e-05
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 3e-05
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 6e-05
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 6e-05
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 7e-05
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 7e-05
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 7e-05
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 7e-05
2yrr_A353 Aminotransferase, class V; structural genomics, NP 7e-05
2yrr_A353 Aminotransferase, class V; structural genomics, NP 7e-05
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 8e-05
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 8e-05
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 8e-05
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 8e-05
3f0h_A376 Aminotransferase; RER070207000802, structural geno 2e-04
3f0h_A376 Aminotransferase; RER070207000802, structural geno 2e-04
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 2e-04
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 2e-04
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 2e-04
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 2e-04
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 3e-04
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 3e-04
1iug_A352 Putative aspartate aminotransferase; wild type, py 3e-04
1iug_A352 Putative aspartate aminotransferase; wild type, py 3e-04
3n75_A715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 9e-04
3n75_A715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 9e-04
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Length = 423 Back     alignment and structure
 Score =  721 bits (1863), Expect = 0.0
 Identities = 245/369 (66%), Positives = 317/369 (85%), Gaps = 3/369 (0%)

Query: 1   MDYSATTPIDPRVVDKMIPYLRVQ--FGNPASRNHIYGWTAEKAIEKARNEVAQLIYADP 58
           +DYSATTP+DPRV +KM+ ++ +   FGNPASR+H +GW AE+A++ ARN++A L+ ADP
Sbjct: 26  LDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADP 85

Query: 59  REIIWTSGATESNNLAIKGAAHFYKKRGKHIITVQTEHKSVLDSIRKLENDGFRVTYLKP 118
           REI++TSGATES+NLAIKGAA+FY+K+GKHIIT +TEHK+VLD+ R+LE +GF VTYL P
Sbjct: 86  REIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAP 145

Query: 119 KNNGLITLSQLEEKICSDTILVSVMLVNNEIGVIQPILEIGELCRSKGVIFHCDAAQAVG 178
           + NG+I L +LE  +  DTILVS+M VNNEIGV+Q I  IGE+CR++G+I+H DA Q+VG
Sbjct: 146 QRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVG 205

Query: 179 KIDINIQNYKVDLMSFSAHKIYGPKGIGALYIRRNPRTRIEAQIHGGGHEYGLRSGTLAT 238
           K+ I++   KVDLMSFS HKIYGPKGIGALY+RR PR RIEAQ+HGGGHE G+RSGTL  
Sbjct: 206 KLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPV 265

Query: 239 HQIVGMGEAFRLARIEMKEELKRILFLQKRLYNGLMESIEEIYINGDMNNRIPHNLNISF 298
           HQIVGMGEA+R+A+ EM  E++R+  L+ RL+NG+ + IEE+Y+NGD+ +  P+ LN+SF
Sbjct: 266 HQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKD-IEEVYLNGDLEHGAPNILNVSF 324

Query: 299 NFIEGESLLMAIKDIAVSSGSACTSASLEPSYVLRALGCNDELAHSSIRFTIGRFTTEKE 358
           N++EGESL+MA+KD+AVSSGSACTSASLEPSYVLRALG NDELAHSSIRF++GRFTTE+E
Sbjct: 325 NYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEE 384

Query: 359 IDFTIKLLK 367
           ID+TI+L++
Sbjct: 385 IDYTIELVR 393


>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Length = 423 Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Length = 382 Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Length = 382 Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Length = 384 Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Length = 384 Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Length = 432 Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Length = 432 Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Length = 605 Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Length = 605 Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Length = 509 Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Length = 509 Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Length = 554 Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Length = 554 Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675 Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675 Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Length = 383 Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Length = 383 Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* 1ngf_A* ... Length = 404 Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* 1ngf_A* ... Length = 404 Back     alignment and structure
>4f3q_A Transcriptional regulatory protein CBU_1566; YEBC family; 2.15A {Coxiella burnetii} Length = 247 Back     alignment and structure
>1kon_A Protein YEBC, YEBC; alpha/beta, two-domains, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics; 2.20A {Escherichia coli} SCOP: e.39.1.1 Length = 249 Back     alignment and structure
>1lfp_A Hypothetical protein AQ_1575; NEW fold, thermostability, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; 1.72A {Aquifex aeolicus} SCOP: e.39.1.1 Length = 249 Back     alignment and structure
>1mw7_A Hypothetical protein HP0162; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Helicobacter pylori} SCOP: e.39.1.1 Length = 240 Back     alignment and structure
>1u00_A HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A {Escherichia coli} SCOP: a.8.4.1 b.130.1.1 Length = 227 Back     alignment and structure
>1u00_A HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A {Escherichia coli} SCOP: a.8.4.1 b.130.1.1 Length = 227 Back     alignment and structure
>2z7e_A ISCU protein, NIFU-like protein; iron-sulfur cluster, iron, biosynthesis, [2Fe-2S], asymmetric trimer, three conserved Cys; 2.30A {Aquifex aeolicus} Length = 157 Back     alignment and structure
>2z7e_A ISCU protein, NIFU-like protein; iron-sulfur cluster, iron, biosynthesis, [2Fe-2S], asymmetric trimer, three conserved Cys; 2.30A {Aquifex aeolicus} Length = 157 Back     alignment and structure
>3lvl_A NIFU-like protein; protein-protein complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PLP; 3.00A {Escherichia coli} PDB: 2l4x_A 2kqk_A 1q48_A 1r9p_A 1wfz_A Length = 129 Back     alignment and structure
>3lvl_A NIFU-like protein; protein-protein complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PLP; 3.00A {Escherichia coli} PDB: 2l4x_A 2kqk_A 1q48_A 1r9p_A 1wfz_A Length = 129 Back     alignment and structure
>4eb5_C NIFU protein (NIFU-1); scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_C* Length = 153 Back     alignment and structure
>4eb5_C NIFU protein (NIFU-1); scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_C* Length = 153 Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Length = 371 Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Length = 371 Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Length = 390 Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Length = 390 Back     alignment and structure
>1q5l_A Chaperone protein DNAK; HSP70, chaperone, heat shock protein; NMR {Escherichia coli} SCOP: b.130.1.1 Length = 135 Back     alignment and structure
>1q5l_A Chaperone protein DNAK; HSP70, chaperone, heat shock protein; NMR {Escherichia coli} SCOP: b.130.1.1 Length = 135 Back     alignment and structure
>3n8e_A Stress-70 protein, mitochondrial; beta-sandwich, helix, substrate binding domain, structural G consortium, SGC, chaperone; 2.80A {Homo sapiens} Length = 182 Back     alignment and structure
>3n8e_A Stress-70 protein, mitochondrial; beta-sandwich, helix, substrate binding domain, structural G consortium, SGC, chaperone; 2.80A {Homo sapiens} Length = 182 Back     alignment and structure
>3h0x_A 78 kDa glucose-regulated protein homolog; structural genomics, APC89502.3, peptide binding, chaperone, BIP, PSI-2; 1.92A {Saccharomyces cerevisiae} PDB: 1ckr_A 7hsc_A Length = 152 Back     alignment and structure
>3h0x_A 78 kDa glucose-regulated protein homolog; structural genomics, APC89502.3, peptide binding, chaperone, BIP, PSI-2; 1.92A {Saccharomyces cerevisiae} PDB: 1ckr_A 7hsc_A Length = 152 Back     alignment and structure
>3dob_A Heat shock 70 kDa protein F44E5.5; structural genomics, APC90015.11, peptide-binding domain, HS 2, protein structure initiative; 2.39A {Caenorhabditis elegans} Length = 152 Back     alignment and structure
>3dob_A Heat shock 70 kDa protein F44E5.5; structural genomics, APC90015.11, peptide-binding domain, HS 2, protein structure initiative; 2.39A {Caenorhabditis elegans} Length = 152 Back     alignment and structure
>2op6_A Heat shock 70 kDa protein D; HSP70/peptide-binding domain, structural genomics, APC90014. 2, protein structure initiative; 1.85A {Caenorhabditis elegans} Length = 152 Back     alignment and structure
>2op6_A Heat shock 70 kDa protein D; HSP70/peptide-binding domain, structural genomics, APC90014. 2, protein structure initiative; 1.85A {Caenorhabditis elegans} Length = 152 Back     alignment and structure
>4e81_A Chaperone protein DNAK; chaperone; 1.90A {Escherichia coli} PDB: 3dpp_A* 3dpq_A* 3qnj_A 3dpo_A 1dkz_A 1dky_A 1dkx_A 1bpr_A 2bpr_A 1dg4_A Length = 219 Back     alignment and structure
>4e81_A Chaperone protein DNAK; chaperone; 1.90A {Escherichia coli} PDB: 3dpp_A* 3dpq_A* 3qnj_A 3dpo_A 1dkz_A 1dky_A 1dkx_A 1bpr_A 2bpr_A 1dg4_A Length = 219 Back     alignment and structure
>3dqg_A Heat shock 70 kDa protein F; structural genomics, APC90008.12, HSP70 protein, peptide-BIN domain, PSI-2, protein structure initiative; 1.72A {Caenorhabditis elegans} Length = 151 Back     alignment and structure
>3dqg_A Heat shock 70 kDa protein F; structural genomics, APC90008.12, HSP70 protein, peptide-BIN domain, PSI-2, protein structure initiative; 1.72A {Caenorhabditis elegans} Length = 151 Back     alignment and structure
>1su0_B NIFU like protein ISCU; structural genomics, BSGC structure funded by NI protein structure initiative, PSI; 2.30A {Streptococcus pyogenes} SCOP: d.224.1.2 Length = 159 Back     alignment and structure
>1su0_B NIFU like protein ISCU; structural genomics, BSGC structure funded by NI protein structure initiative, PSI; 2.30A {Streptococcus pyogenes} SCOP: d.224.1.2 Length = 159 Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Length = 420 Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Length = 420 Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Length = 111 Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Length = 111 Back     alignment and structure
>2qq4_A Iron-sulfur cluster biosynthesis protein ISCU; zinc binding, iron-sulfur cluster binding, three conserved Cys, three beta strands; 1.85A {Thermus thermophilus} Length = 138 Back     alignment and structure
>2qq4_A Iron-sulfur cluster biosynthesis protein ISCU; zinc binding, iron-sulfur cluster binding, three conserved Cys, three beta strands; 1.85A {Thermus thermophilus} Length = 138 Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Length = 113 Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Length = 113 Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Length = 406 Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Length = 406 Back     alignment and structure
>1xjs_A NIFU-like protein; SR17, structure, autostructure, iron-sulfur, zinc, northeast structural genomics consortium, NESG; NMR {Bacillus subtilis} SCOP: d.224.1.2 PDB: 2azh_A Length = 147 Back     alignment and structure
>1xjs_A NIFU-like protein; SR17, structure, autostructure, iron-sulfur, zinc, northeast structural genomics consortium, NESG; NMR {Bacillus subtilis} SCOP: d.224.1.2 PDB: 2azh_A Length = 147 Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Length = 406 Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Length = 406 Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Length = 103 Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Length = 103 Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Length = 109 Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Length = 109 Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Length = 108 Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Length = 108 Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Length = 123 Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Length = 123 Back     alignment and structure
>1r94_A Protein YFHF; tetrameric, beta barrel, iron-sulfur cluster protein, pseudo-symmetric motifs, metal transport; 2.30A {Escherichia coli} SCOP: b.124.1.1 PDB: 1r95_A 1s98_A Length = 118 Back     alignment and structure
>1r94_A Protein YFHF; tetrameric, beta barrel, iron-sulfur cluster protein, pseudo-symmetric motifs, metal transport; 2.30A {Escherichia coli} SCOP: b.124.1.1 PDB: 1r95_A 1s98_A Length = 118 Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Length = 416 Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Length = 416 Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Length = 320 Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Length = 320 Back     alignment and structure
>2d2a_A SUFA protein; iron-sulfur cluster, iron, ISCA, YADR, metal transport; 2.70A {Escherichia coli} Length = 145 Back     alignment and structure
>2d2a_A SUFA protein; iron-sulfur cluster, iron, ISCA, YADR, metal transport; 2.70A {Escherichia coli} Length = 145 Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Length = 272 Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Length = 272 Back     alignment and structure
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Length = 126 Back     alignment and structure
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Length = 126 Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} Length = 104 Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} Length = 104 Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Length = 105 Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Length = 105 Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Length = 106 Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Length = 106 Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Length = 106 Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Length = 106 Back     alignment and structure
>1x0g_A ISCA; [2Fe-2S], biosynthesis, cyanobacteria, domain swapping, Fe- S cluster, iron, iron-sulfur cluster protein, scaffold, sulfur; 2.50A {Thermosynechococcus elongatus} Length = 112 Back     alignment and structure
>1x0g_A ISCA; [2Fe-2S], biosynthesis, cyanobacteria, domain swapping, Fe- S cluster, iron, iron-sulfur cluster protein, scaffold, sulfur; 2.50A {Thermosynechococcus elongatus} Length = 112 Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Length = 93 Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Length = 93 Back     alignment and structure
>2k4z_A DSRR; ISCA/SUFA/HESB like fold, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Allochromatium vinosum} Length = 125 Back     alignment and structure
>2k4z_A DSRR; ISCA/SUFA/HESB like fold, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Allochromatium vinosum} Length = 125 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Length = 465 Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Length = 465 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>1nwb_A Hypothetical protein AQ_1857; QR6, structural genomics, protein structure initiative, NESG, reduced dimensionality PSI; NMR {Aquifex aeolicus} SCOP: b.124.1.1 Length = 124 Back     alignment and structure
>1nwb_A Hypothetical protein AQ_1857; QR6, structural genomics, protein structure initiative, NESG, reduced dimensionality PSI; NMR {Aquifex aeolicus} SCOP: b.124.1.1 Length = 124 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Length = 397 Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Length = 397 Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Length = 456 Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Length = 456 Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Length = 346 Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Length = 346 Back     alignment and structure
>2apn_A Protein HI1723; HI1723 solution structure, structural genomics, structure 2 function project, S2F, unknown function; NMR {Haemophilus influenzae} Length = 114 Back     alignment and structure
>2apn_A Protein HI1723; HI1723 solution structure, structural genomics, structure 2 function project, S2F, unknown function; NMR {Haemophilus influenzae} Length = 114 Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Length = 497 Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Length = 497 Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Length = 514 Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Length = 514 Back     alignment and structure
>3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} Length = 355 Back     alignment and structure
>3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} Length = 355 Back     alignment and structure
>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Length = 329 Back     alignment and structure
>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Length = 329 Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Length = 467 Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Length = 467 Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Length = 452 Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Length = 452 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Length = 366 Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Length = 366 Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Length = 456 Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Length = 456 Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Length = 502 Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Length = 502 Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Length = 359 Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Length = 359 Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Length = 396 Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Length = 396 Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Length = 411 Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Length = 411 Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Length = 393 Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Length = 393 Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Length = 384 Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Length = 384 Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Length = 392 Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Length = 392 Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Length = 393 Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Length = 393 Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Length = 481 Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Length = 481 Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Length = 386 Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Length = 386 Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Length = 353 Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Length = 353 Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Length = 467 Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Length = 467 Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Length = 393 Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Length = 393 Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Length = 376 Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Length = 376 Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Length = 486 Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Length = 486 Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Length = 416 Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Length = 416 Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Length = 357 Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Length = 357 Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Length = 352 Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Length = 352 Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Length = 715 Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Length = 715 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query2602
4b9q_A605 Chaperone protein DNAK; HET: ATP; 2.40A {Escherich 100.0
2kho_A605 Heat shock protein 70; molecular chaperone, HSP70, 100.0
1yuw_A554 Heat shock cognate 71 kDa protein; chaperone; 2.60 100.0
4b9q_A605 Chaperone protein DNAK; HET: ATP; 2.40A {Escherich 100.0
3d2f_A675 Heat shock protein homolog SSE1; nucleotide exchan 100.0
2kho_A605 Heat shock protein 70; molecular chaperone, HSP70, 100.0
2v7y_A509 Chaperone protein DNAK; HSP70, heat shock protein, 100.0
1yuw_A554 Heat shock cognate 71 kDa protein; chaperone; 2.60 100.0
3d2f_A675 Heat shock protein homolog SSE1; nucleotide exchan 100.0
2v7y_A509 Chaperone protein DNAK; HSP70, heat shock protein, 100.0
1kon_A249 Protein YEBC, YEBC; alpha/beta, two-domains, montr 100.0
1lfp_A249 Hypothetical protein AQ_1575; NEW fold, thermostab 100.0
4f3q_A247 Transcriptional regulatory protein CBU_1566; YEBC 100.0
1mw7_A240 Hypothetical protein HP0162; structural genomics, 100.0
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 100.0
4gni_A409 Putative heat shock protein; HSP70-type ATPase, AT 100.0
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 100.0
4gni_A409 Putative heat shock protein; HSP70-type ATPase, AT 100.0
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 100.0
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 100.0
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 100.0
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 100.0
1jce_A344 ROD shape-determining protein MREB; MBL, actin, HS 100.0
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 100.0
1jce_A344 ROD shape-determining protein MREB; MBL, actin, HS 100.0
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 100.0
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 100.0
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 100.0
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 100.0
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 100.0
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 100.0
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 100.0
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 100.0
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 100.0
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 100.0
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 99.98
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 99.97
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 99.97
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 99.97
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.97
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 99.97
3qm2_A386 Phosphoserine aminotransferase; structural genomic 99.97
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 99.97
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 99.97
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.97
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 99.96
3qm2_A386 Phosphoserine aminotransferase; structural genomic 99.96
1iug_A352 Putative aspartate aminotransferase; wild type, py 99.96
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 99.96
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 99.96
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.96
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 99.96
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 99.96
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 99.96
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 99.96
1iug_A352 Putative aspartate aminotransferase; wild type, py 99.95
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 99.95
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 99.95
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 99.95
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.95
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 99.95
2yrr_A353 Aminotransferase, class V; structural genomics, NP 99.95
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 99.95
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 99.95
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 99.95
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 99.95
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 99.95
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 99.95
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 99.95
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 99.95
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 99.95
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 99.95
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.95
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 99.95
2yrr_A353 Aminotransferase, class V; structural genomics, NP 99.95
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 99.94
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 99.94
3f0h_A376 Aminotransferase; RER070207000802, structural geno 99.94
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 99.94
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 99.94
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 99.94
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 99.94
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 99.94
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 99.94
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 99.94
3f0h_A376 Aminotransferase; RER070207000802, structural geno 99.94
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.94
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 99.94
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 99.93
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.93
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 99.93
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.93
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 99.93
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.93
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 99.93
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 99.93
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 99.93
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.93
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 99.93
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 99.92
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.92
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 99.92
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 99.92
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 99.92
2fnu_A375 Aminotransferase; protein-product complex, structu 99.92
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.92
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.92
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 99.92
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 99.92
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 99.92
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 99.92
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.92
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 99.92
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 99.92
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 99.92
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 99.92
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 99.92
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 99.92
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.92
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.92
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 99.91
3ftb_A361 Histidinol-phosphate aminotransferase; structural 99.91
2z61_A370 Probable aspartate aminotransferase 2; amino acid 99.91
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 99.91
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 99.91
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.91
2fsj_A346 Hypothetical protein TA0583; actin homologs, archa 99.91
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 99.91
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 99.91
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 99.91
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 99.91
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 99.91
2fnu_A375 Aminotransferase; protein-product complex, structu 99.91
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 99.91
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 99.91
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 99.91
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 99.91
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 99.91
1xi9_A406 Putative transaminase; alanine aminotransferase, s 99.91
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.91
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 99.91
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 99.91
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 99.91
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.91
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.9
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.9
3l8a_A421 METC, putative aminotransferase, probable beta-cys 99.9
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 99.9
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 99.9
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 99.9
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 99.9
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 99.9
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.9
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 99.9
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.9
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 99.9
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 99.9
3nra_A407 Aspartate aminotransferase; structural genomics, j 99.9
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 99.9
2z61_A370 Probable aspartate aminotransferase 2; amino acid 99.9
3ele_A398 Amino transferase; RER070207001803, structural gen 99.9
3dqg_A151 Heat shock 70 kDa protein F; structural genomics, 99.9
3dob_A152 Heat shock 70 kDa protein F44E5.5; structural geno 99.9
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 99.9
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 99.9
3ftb_A361 Histidinol-phosphate aminotransferase; structural 99.9
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 99.9
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 99.9
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 99.9
1xi9_A406 Putative transaminase; alanine aminotransferase, s 99.9
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 99.9
3frk_A373 QDTB; aminotransferase, sugar-modification, natura 99.9
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 99.9
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 99.9
2ych_A377 Competence protein PILM; cell cycle, type IV pilus 99.9
2fsj_A346 Hypothetical protein TA0583; actin homologs, archa 99.9
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 99.9
3uwc_A374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.9
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 99.9
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.9
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 99.9
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 99.9
1svv_A359 Threonine aldolase; structural genomics, structura 99.9
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 99.9
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 99.9
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.9
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 99.9
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 99.9
3frk_A373 QDTB; aminotransferase, sugar-modification, natura 99.9
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 99.9
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 99.9
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 99.9
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 99.9
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 99.9
3h0x_A152 78 kDa glucose-regulated protein homolog; structur 99.9
3aow_A448 Putative uncharacterized protein PH0207; protein-P 99.89
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 99.89
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 99.89
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 99.89
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 99.89
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 99.89
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.89
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 99.89
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.89
1vp4_A425 Aminotransferase, putative; structural genomics, j 99.89
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.89
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.89
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 99.89
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 99.89
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 99.89
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 99.89
3n8e_A182 Stress-70 protein, mitochondrial; beta-sandwich, h 99.89
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 99.89
3l8a_A421 METC, putative aminotransferase, probable beta-cys 99.89
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 99.89
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 99.89
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 99.89
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 99.89
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 99.89
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 99.89
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 99.89
4e81_A219 Chaperone protein DNAK; chaperone; 1.90A {Escheric 99.89
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 99.89
3ele_A398 Amino transferase; RER070207001803, structural gen 99.89
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 99.89
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 99.89
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 99.89
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 99.89
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 99.89
3nra_A407 Aspartate aminotransferase; structural genomics, j 99.89
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.89
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.89
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 99.89
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.88
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 99.88
2cb1_A412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.88
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 99.88
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 99.88
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.88
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 99.88
3uwc_A374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.88
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 99.88
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 99.88
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 99.88
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.88
3lvl_A129 NIFU-like protein; protein-protein complex, struct 99.88
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 99.88
2ych_A377 Competence protein PILM; cell cycle, type IV pilus 99.88
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.88
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.88
3aow_A448 Putative uncharacterized protein PH0207; protein-P 99.88
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 99.88
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 99.88
1svv_A359 Threonine aldolase; structural genomics, structura 99.88
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 99.88
3lvl_A129 NIFU-like protein; protein-protein complex, struct 99.88
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 99.88
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.88
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 99.88
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.88
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 99.88
1o69_A394 Aminotransferase; structural genomics, unknown fun 99.88
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 99.88
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.88
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 99.88
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 99.87
3dqg_A151 Heat shock 70 kDa protein F; structural genomics, 99.87
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 99.87
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 99.87
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 99.87
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fol 99.87
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.87
1vp4_A425 Aminotransferase, putative; structural genomics, j 99.87
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 99.87
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 99.87
2c81_A418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.87
1k8k_A418 ARP3, actin-like protein 3, actin-2; beta-propelle 99.87
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 99.87
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 99.87
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 99.87
2x3l_A446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.87
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 99.87
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 99.87
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 99.87
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 99.87
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 99.87
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 99.87
2cb1_A412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.87
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyrido 99.87
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 99.87
4a2a_A419 Cell division protein FTSA, putative; cell cycle, 99.87
1o69_A394 Aminotransferase; structural genomics, unknown fun 99.87
3dob_A152 Heat shock 70 kDa protein F44E5.5; structural geno 99.87
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.87
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 99.87
2z7e_A157 ISCU protein, NIFU-like protein; iron-sulfur clust 99.87
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 99.87
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 99.87
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 99.87
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 99.87
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyrido 99.87
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 99.87
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.87
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 99.86
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 99.86
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 99.86
3h0x_A152 78 kDa glucose-regulated protein homolog; structur 99.86
3bb8_A437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 99.86
4eb5_C153 NIFU protein (NIFU-1); scaffold, transferase-metal 99.86
2z7e_A157 ISCU protein, NIFU-like protein; iron-sulfur clust 99.86
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.86
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 99.86
2x3l_A446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.86
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 99.86
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 99.86
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.86
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 99.86
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fol 99.86
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 99.86
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 99.86
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 99.86
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.86
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 99.86
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 99.86
4eb5_C153 NIFU protein (NIFU-1); scaffold, transferase-metal 99.86
2fxu_A375 Alpha-actin-1, actin, alpha skeletal muscle; actin 99.86
2c81_A418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.86
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 99.86
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 99.86
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 99.85
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.85
3n8e_A182 Stress-70 protein, mitochondrial; beta-sandwich, h 99.85
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 99.85
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 99.85
2qq4_A138 Iron-sulfur cluster biosynthesis protein ISCU; zin 99.85
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 99.85
4e81_A219 Chaperone protein DNAK; chaperone; 1.90A {Escheric 99.85
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 99.85
2op6_A152 Heat shock 70 kDa protein D; HSP70/peptide-binding 99.85
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 99.85
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 99.85
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 99.85
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 99.85
1k8k_A418 ARP3, actin-like protein 3, actin-2; beta-propelle 99.85
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 99.85
3bb8_A437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 99.85
2qq4_A138 Iron-sulfur cluster biosynthesis protein ISCU; zin 99.85
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 99.85
4a2a_A419 Cell division protein FTSA, putative; cell cycle, 99.85
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 99.85
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 99.85
2ctz_A421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 99.85
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 99.85
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 99.85
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 99.85
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 99.85
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 99.84
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 99.84
1c4k_A730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.84
3rq1_A418 Aminotransferase class I and II; structural genomi 99.84
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 99.84
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 99.84
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 99.84
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 99.84
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 99.84
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 99.84
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 99.84
3ruy_A392 Ornithine aminotransferase; structural genomics, c 99.84
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 99.84
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.84
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 99.83
1q5l_A135 Chaperone protein DNAK; HSP70, chaperone, heat sho 99.83
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 99.83
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 99.83
2fxu_A375 Alpha-actin-1, actin, alpha skeletal muscle; actin 99.83
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 99.83
1xjs_A147 NIFU-like protein; SR17, structure, autostructure, 99.83
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 99.83
1su0_B159 NIFU like protein ISCU; structural genomics, BSGC 99.83
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 99.83
1xjs_A147 NIFU-like protein; SR17, structure, autostructure, 99.83
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 99.83
2ctz_A421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 99.83
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 99.83
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 99.83
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 99.83
1su0_B159 NIFU like protein ISCU; structural genomics, BSGC 99.83
1c4k_A730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.82
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 99.82
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 99.82
3rq1_A418 Aminotransferase class I and II; structural genomi 99.82
1u00_A227 HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A 99.82
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 99.82
2op6_A152 Heat shock 70 kDa protein D; HSP70/peptide-binding 99.82
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 99.82
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 99.71
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 99.82
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.82
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 99.81
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 99.81
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.81
3ruy_A392 Ornithine aminotransferase; structural genomics, c 99.81
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 99.81
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.81
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 99.81
1q5l_A135 Chaperone protein DNAK; HSP70, chaperone, heat sho 99.81
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 99.81
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 99.81
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 99.81
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 99.81
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 99.8
2zgy_A320 Plasmid segregation protein PARM; plasmid partitio 99.8
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 99.8
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 99.8
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 99.8
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 99.8
2vyc_A755 Biodegradative arginine decarboxylase; pyridoxal p 99.8
2vyc_A755 Biodegradative arginine decarboxylase; pyridoxal p 99.8
4adb_A406 Succinylornithine transaminase; transferase, PLP e 99.8
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 99.8
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 99.8
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.79
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 99.79
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.79
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 99.79
2zgy_A320 Plasmid segregation protein PARM; plasmid partitio 99.79
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 99.67
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 99.79
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 99.79
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 99.78
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.78
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.78
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 99.78
1u00_A227 HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A 99.78
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 99.77
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 99.77
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 99.77
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 99.77
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 99.77
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 99.77
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 99.77
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 99.76
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 99.76
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 99.76
2zy4_A546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 99.76
4adb_A406 Succinylornithine transaminase; transferase, PLP e 99.76
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 99.76
3pj0_A359 LMO0305 protein; structural genomics, joint center 99.76
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 99.75
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 99.75
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 99.75
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 99.75
3pj0_A359 LMO0305 protein; structural genomics, joint center 99.75
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 99.75
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 99.75
1z7d_A433 Ornithine aminotransferase; structural genomics co 99.75
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 99.74
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 99.74
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 99.74
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 99.74
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 99.74
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 99.74
2zy4_A546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 99.73
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 99.73
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 99.73
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 99.72
3ou5_A490 Serine hydroxymethyltransferase, mitochondrial; st 99.72
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 99.72
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 99.72
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 99.72
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 99.71
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 99.71
1z7d_A433 Ornithine aminotransferase; structural genomics co 99.71
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 99.71
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 99.71
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 99.7
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 99.7
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 99.7
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 99.7
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.69
3n75_A715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 99.69
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 99.69
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 99.69
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 99.68
3n75_A715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 99.68
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 99.68
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 99.67
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 99.67
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 99.66
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.66
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.66
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.65
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 99.65
4ehu_A276 Activator of 2-hydroxyisocaproyl-COA dehydratase; 99.65
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 99.64
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.64
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 99.64
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 99.64
3hmu_A472 Aminotransferase, class III; structural genomics, 99.63
1k8k_B394 ARP2, actin-like protein 2; beta-propeller, struct 99.63
>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D Back     alignment and structure
Probab=100.00  E-value=1.3e-80  Score=840.66  Aligned_cols=500  Identities=41%  Similarity=0.628  Sum_probs=471.5

Q ss_pred             eEEEEEcCcccEEEEEEECCeeEEEeCCCCCccccEEEEEecCCcEEEcHHHHhhhccCCCCchhhhhhhhCCCCCCCCC
Q psy15216        638 VSIGIDFGTTNSLVAIVRNNIPEVLKDKYGYFLIPSIVRYLPDGKIYVGKKAKITQNIDPKNTISSIKRFIARDLKNINT  717 (2602)
Q Consensus       638 ~vvGID~GTt~s~va~~~~~~~~ii~~~~g~~~~PS~v~~~~~~~~~vG~~A~~~~~~~p~~~~~~~K~~lg~~~~~~~~  717 (2602)
                      .+||||||||||+||++++|.|++++|..|++++||+|+|.++++++||..|+.+...+|.++++++||+||+++++...
T Consensus         3 ~viGIDlGTT~S~Va~~~~g~~~ii~n~~g~~~~PS~V~~~~~~~~~vG~~A~~~~~~~p~~ti~~~KrllG~~~~d~~v   82 (605)
T 4b9q_A            3 KIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGCTLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEV   82 (605)
T ss_dssp             CEEEEECCSSEEEEEEEETTEEEECCCTTSCSSEECCEEECTTSCEEESHHHHHTTTTCGGGEECCGGGTTTCBTTSHHH
T ss_pred             cEEEEEcCCCcEEEEEEECCEEEEEECCCCCcccceEEEEeCCCcEEecHHHHHHHHhCCCcEehhhHHhhCCCCCCHHH
Confidence            58999999999999999999999999999999999999999888899999999999999999999999999999887422


Q ss_pred             ----CCCCeeee-cCCCceEEEEeCceeCHHHHHHHHHHHHHHHHHHhhcCccceEEEEEcCCCCHHHHHHHHHHHHHcC
Q psy15216        718 ----NSFPYDFQ-NKFGMLHIKTISGIKSPIEISAQIFITLKKIAENAVNNRIFGAVITVPAYFNDIQRQFTKNAAKLAG  792 (2602)
Q Consensus       718 ----~~~~~~~~-~~~~~~~~~~~~~~~~~~ev~a~~L~~l~~~a~~~~~~~~~~~ViTVPa~f~~~qr~~~~~Aa~~AG  792 (2602)
                          ..+||.+. ..+|.+.+...++.++|+++++++|++|++.|+.++|.++.++|||||+||++.||++|++|+++||
T Consensus        83 ~~~~~~~p~~~~~~~~g~~~~~~~~~~~~p~ei~a~iL~~lk~~ae~~lg~~v~~~VITVPa~f~~~qr~a~~~Aa~~AG  162 (605)
T 4b9q_A           83 QRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAG  162 (605)
T ss_dssp             HHHHTTCSSEEEECTTSBEEEEETTEEECHHHHHHHHHHHHHHHHHHHHTSCCCEEEEEECTTCCHHHHHHHHHHHHHTT
T ss_pred             HHHhhcCCeEEEEcCCCceEEEECCEEECHHHHHHHHHHHHHHHHHHHhCCCCCeEEEEECCCCCHHHHHHHHHHHHHcC
Confidence                37899887 5678888888889999999999999999999999999999999999999999999999999999999


Q ss_pred             CceEEEechhHHHHHHhhhccCcccceEEEEEeCCceEEEEEEEEEC----CEEEEEEEecCCCCcchHHHHHHHHHHHH
Q psy15216        793 LNVLRLLNEPTSAAIAYKLDKNIFEGIFAVYDLGGGTFDISILKFKN----GVFKVLSVGGDSNLGGDDFDYCLFSWIVK  868 (2602)
Q Consensus       793 l~~~~li~EPtAAAl~y~~~~~~~~~~vlV~D~GGGT~Dvsv~~~~~----~~~~v~~~~g~~~lGG~~~D~~l~~~l~~  868 (2602)
                      |+++++|+||+|||++|++.....++.++|||+||||||+|++++.+    +.++++++.|+.++||++||++|++|+.+
T Consensus       163 l~v~~li~EP~AAAlaygl~~~~~~~~vlV~DlGGGT~Dvsi~~~~~~~~~~~~evla~~gd~~lGG~d~D~~l~~~l~~  242 (605)
T 4b9q_A          163 LEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGAFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVE  242 (605)
T ss_dssp             CEEEEEEEHHHHHHHHHHTTSCCSSEEEEEEEECSSCEEEEEEEEEESSSCEEEEEEEEEEETTCSHHHHHHHHHHHHHH
T ss_pred             CceEEEeCcHHHHHHHhhhhccCCCCEEEEEECCCCeEEEEEEEEecCCCCceEEEEEecCCCCcChHHHHHHHHHHHHH
Confidence            99999999999999999988765678999999999999999999988    89999999999999999999999999999


Q ss_pred             HHhhcc-----CCHHHHHHHHHHHHHHHHHcccccceEEEEEe-----cCCceEEEEeCHHHHHHHHHHHHHHHHHHHHH
Q psy15216        869 NAFLKK-----LSYKDVNILMIKSREIKELLSYQSSVKLNVKL-----SDKKIVNITIDMKQFFTITQHLVNRTILLSSK  938 (2602)
Q Consensus       869 ~~~~~~-----~~~~~~~~l~~~~e~~K~~LS~~~~~~~~i~~-----~~~~~~~~~itr~~fe~l~~~~~~~~~~~i~~  938 (2602)
                      +|..+.     .+++.+.+|+.+||++|+.||...++.+.++.     .++.++.++|||++|+++++|+++++..++++
T Consensus       243 ~f~~~~~~~~~~~~~~~~~L~~~aE~~K~~Ls~~~~~~i~~~~~~~~~~g~~~~~~~itr~~~e~l~~~~~~~i~~~v~~  322 (605)
T 4b9q_A          243 EFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKV  322 (605)
T ss_dssp             HHHHHTCCCGGGCHHHHHHHHHHHHHHHHHTTTCSEEEEEEEEEEECSSSEEEEEEEEEHHHHHHHHHHHHHHTTHHHHH
T ss_pred             HHhhhcCCCcccCHHHHHHHHHHHHHHHHhcCcCCCeEEEEeeeccCCCCCeeEEEEEeHHHHHHHHHHHHHHHHHHHHH
Confidence            987544     47889999999999999999999988888873     13367899999999999999999999999999


Q ss_pred             HHHHcCCCccccceEEEecCccchHHHHHHHHhhccCcccCcCCcchHhHHHHHHHhHHhcCCCCCCCceeeeccccccc
Q psy15216        939 ALMDANLTIKDINNVILVGGSTRMKHIHEGVSNFFKTTLLTSIDPDKAVVFGAAIQANFLSGNRGIDDNFLLLDVIPLSL 1018 (2602)
Q Consensus       939 ~l~~a~~~~~~i~~V~LvGG~sr~P~v~~~l~~~f~~~~~~~~~p~~aVa~GAa~~a~~l~~~~~~~~~~~~~dv~~~~~ 1018 (2602)
                      +|+++++...+|+.|+||||+||+|+|+++|+++||.++..+.||++|||+|||++|+.+++..   +++.+.|++|++|
T Consensus       323 ~L~~a~~~~~~i~~VvLvGG~sriP~v~~~l~~~fg~~~~~~~nPdeaVA~GAai~a~~l~~~~---~~~~l~dv~p~sl  399 (605)
T 4b9q_A          323 ALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDV---KDVLLLDVTPLSL  399 (605)
T ss_dssp             HHHHTTCCGGGCSEEEEESGGGGSHHHHHHHHHHHTSCCCSSSCTTTHHHHHHHHHHHHHHTSS---CSEEEECBCSSCE
T ss_pred             HHHHcCCCHHHCcEEEEeCCccCchHHHHHHHHHhccCcCCCcChhHHHHHhHHHHHHHhcCCC---CceEEEeeeeeEE
Confidence            9999999999999999999999999999999999999999999999999999999999999864   3789999999999


Q ss_pred             eEeeeccEEEEEEecCCCCCCCcEEEEEeccccccceeeeEeecCccccccCceeeeeEecCCCCCCCCccEEEEEEEEC
Q psy15216       1019 GIETIGGLVEKIIFRNTTIPCSYSGEFTTFKDNQTAIAIKVVQGEDELVKNCQVLANFELRDIPPMPAGRARIKVTYQVD 1098 (2602)
Q Consensus      1019 gi~~~~~~~~~ii~~~t~iP~~~~~~~~~~~d~q~~~~i~i~~ge~~~~~~~~~lg~~~l~~i~~~~~g~~~i~v~f~~d 1098 (2602)
                      |+++.+|.|.++|+|||+||+++++.|+|..|+|+.+.|.|||||+..+.+|..||+|.|+|+||.|+|.++|+|+|++|
T Consensus       400 gie~~~g~~~~ii~rnt~iP~~~~~~f~t~~d~q~~v~i~v~~ge~~~~~~n~~lg~~~l~~i~~~~~g~~~i~v~f~id  479 (605)
T 4b9q_A          400 GIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDID  479 (605)
T ss_dssp             EEEETTTEEEEEECTTCBSSEEEEEEECCSSTTCCEEEEEEEESSCSBGGGSEEEEEEEEECCCCCSTTCCCEEEEEEEC
T ss_pred             EEEEcCCEEEEEEeCCCcCCcceEEEeeeecccCceEEEEEEeccccccccCCEeeEEEEeCCCCCcCCCceEEEEEEEc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCeeEEEEEEEecCCceEEEEEecCCCCCHHHHHhhhhccccCC
Q psy15216       1099 ADGLLSIFAYEKISGKKKFITIKPFYNMNLDEIKNGAIFNENSG 1142 (2602)
Q Consensus      1099 ~~g~l~v~a~~~~~g~~~~~~~~~~~~l~~~~i~~~~~~~~~~g 1142 (2602)
                      .||+|+|+|+++.||++.+++|..+++||++||++|+  ++++-
T Consensus       480 ~~gil~v~a~~~~tg~~~~i~i~~~~~ls~~ei~~~~--~~~~~  521 (605)
T 4b9q_A          480 ADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMV--RDAEA  521 (605)
T ss_dssp             TTSCEEEEEEETTTCCEECCEEESCCSCCHHHHHHHH--HHHHH
T ss_pred             CCcEEEEEEEecCCCcEEEEEecCCCCCCHHHHHHHH--HHhhh
Confidence            9999999999999999999999999999999999987  44443



>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Back     alignment and structure
>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1kon_A Protein YEBC, YEBC; alpha/beta, two-domains, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics; 2.20A {Escherichia coli} SCOP: e.39.1.1 Back     alignment and structure
>1lfp_A Hypothetical protein AQ_1575; NEW fold, thermostability, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; 1.72A {Aquifex aeolicus} SCOP: e.39.1.1 Back     alignment and structure
>4f3q_A Transcriptional regulatory protein CBU_1566; YEBC family; 2.15A {Coxiella burnetii} Back     alignment and structure
>1mw7_A Hypothetical protein HP0162; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Helicobacter pylori} SCOP: e.39.1.1 Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... Back     alignment and structure
>4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} Back     alignment and structure
>4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>3dqg_A Heat shock 70 kDa protein F; structural genomics, APC90008.12, HSP70 protein, peptide-BIN domain, PSI-2, protein structure initiative; 1.72A {Caenorhabditis elegans} Back     alignment and structure
>3dob_A Heat shock 70 kDa protein F44E5.5; structural genomics, APC90015.11, peptide-binding domain, HS 2, protein structure initiative; 2.39A {Caenorhabditis elegans} Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>3h0x_A 78 kDa glucose-regulated protein homolog; structural genomics, APC89502.3, peptide binding, chaperone, BIP, PSI-2; 1.92A {Saccharomyces cerevisiae} PDB: 1ckr_A 7hsc_A Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>3n8e_A Stress-70 protein, mitochondrial; beta-sandwich, helix, substrate binding domain, structural G consortium, SGC, chaperone; 2.80A {Homo sapiens} Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>4e81_A Chaperone protein DNAK; chaperone; 1.90A {Escherichia coli} PDB: 3dpp_A* 3dpq_A* 3qnj_A 3dpo_A 1dkz_A 1dky_A 1dkx_A 1bpr_A 2bpr_A 1dg4_A Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>3lvl_A NIFU-like protein; protein-protein complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PLP; 3.00A {Escherichia coli} PDB: 2l4x_A 2kqk_A 1q48_A 1r9p_A 1wfz_A Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>3lvl_A NIFU-like protein; protein-protein complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PLP; 3.00A {Escherichia coli} PDB: 2l4x_A 2kqk_A 1q48_A 1r9p_A 1wfz_A Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>3dqg_A Heat shock 70 kDa protein F; structural genomics, APC90008.12, HSP70 protein, peptide-BIN domain, PSI-2, protein structure initiative; 1.72A {Caenorhabditis elegans} Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>3dob_A Heat shock 70 kDa protein F44E5.5; structural genomics, APC90015.11, peptide-binding domain, HS 2, protein structure initiative; 2.39A {Caenorhabditis elegans} Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>2z7e_A ISCU protein, NIFU-like protein; iron-sulfur cluster, iron, biosynthesis, [2Fe-2S], asymmetric trimer, three conserved Cys; 2.30A {Aquifex aeolicus} Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>3h0x_A 78 kDa glucose-regulated protein homolog; structural genomics, APC89502.3, peptide binding, chaperone, BIP, PSI-2; 1.92A {Saccharomyces cerevisiae} PDB: 1ckr_A 7hsc_A Back     alignment and structure
>4eb5_C NIFU protein (NIFU-1); scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_C* Back     alignment and structure
>2z7e_A ISCU protein, NIFU-like protein; iron-sulfur cluster, iron, biosynthesis, [2Fe-2S], asymmetric trimer, three conserved Cys; 2.30A {Aquifex aeolicus} Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>4eb5_C NIFU protein (NIFU-1); scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_C* Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>3n8e_A Stress-70 protein, mitochondrial; beta-sandwich, helix, substrate binding domain, structural G consortium, SGC, chaperone; 2.80A {Homo sapiens} Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>2qq4_A Iron-sulfur cluster biosynthesis protein ISCU; zinc binding, iron-sulfur cluster binding, three conserved Cys, three beta strands; 1.85A {Thermus thermophilus} Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>4e81_A Chaperone protein DNAK; chaperone; 1.90A {Escherichia coli} PDB: 3dpp_A* 3dpq_A* 3qnj_A 3dpo_A 1dkz_A 1dky_A 1dkx_A 1bpr_A 2bpr_A 1dg4_A Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>2op6_A Heat shock 70 kDa protein D; HSP70/peptide-binding domain, structural genomics, APC90014. 2, protein structure initiative; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>2qq4_A Iron-sulfur cluster biosynthesis protein ISCU; zinc binding, iron-sulfur cluster binding, three conserved Cys, three beta strands; 1.85A {Thermus thermophilus} Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>1q5l_A Chaperone protein DNAK; HSP70, chaperone, heat shock protein; NMR {Escherichia coli} SCOP: b.130.1.1 Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>1xjs_A NIFU-like protein; SR17, structure, autostructure, iron-sulfur, zinc, northeast structural genomics consortium, NESG; NMR {Bacillus subtilis} SCOP: d.224.1.2 PDB: 2azh_A Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>1su0_B NIFU like protein ISCU; structural genomics, BSGC structure funded by NI protein structure initiative, PSI; 2.30A {Streptococcus pyogenes} SCOP: d.224.1.2 Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>1xjs_A NIFU-like protein; SR17, structure, autostructure, iron-sulfur, zinc, northeast structural genomics consortium, NESG; NMR {Bacillus subtilis} SCOP: d.224.1.2 PDB: 2azh_A Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>1su0_B NIFU like protein ISCU; structural genomics, BSGC structure funded by NI protein structure initiative, PSI; 2.30A {Streptococcus pyogenes} SCOP: d.224.1.2 Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>1u00_A HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A {Escherichia coli} SCOP: a.8.4.1 b.130.1.1 Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>2op6_A Heat shock 70 kDa protein D; HSP70/peptide-binding domain, structural genomics, APC90014. 2, protein structure initiative; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>1q5l_A Chaperone protein DNAK; HSP70, chaperone, heat shock protein; NMR {Escherichia coli} SCOP: b.130.1.1 Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>1u00_A HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A {Escherichia coli} SCOP: a.8.4.1 b.130.1.1 Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 2602
d1p3wa_391 c.67.1.3 (A:) Cysteine desulfurase IscS {Escherich 1e-107
d1p3wa_391 c.67.1.3 (A:) Cysteine desulfurase IscS {Escherich 1e-105
d1eg5a_376 c.67.1.3 (A:) NifS-like protein/selenocysteine lya 1e-79
d1eg5a_376 c.67.1.3 (A:) NifS-like protein/selenocysteine lya 1e-77
d1t3ia_408 c.67.1.3 (A:) Probable cysteine desulfurase SufS { 5e-73
d1t3ia_408 c.67.1.3 (A:) Probable cysteine desulfurase SufS { 4e-71
d1jf9a_405 c.67.1.3 (A:) NifS-like protein/selenocysteine lya 5e-73
d1jf9a_405 c.67.1.3 (A:) NifS-like protein/selenocysteine lya 3e-71
d1dkgd1183 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPas 1e-53
d1dkgd1183 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPas 1e-53
d1bupa1185 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPas 4e-49
d1bupa1185 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPas 4e-49
d1dkgd2198 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATP 2e-42
d1dkgd2198 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATP 2e-42
d1bupa2193 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATP 7e-42
d1bupa2193 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATP 7e-42
d1kona_244 e.39.1.1 (A:) Hypothetical protein YebC {Escherich 6e-39
d1yuwa1159 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus 4e-36
d1yuwa1159 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus 4e-36
d1lfpa_243 e.39.1.1 (A:) Hypothetical protein aq1575 {Aquifex 2e-34
d1r9pa_134 d.224.1.2 (A:) NifU-like protein HI0377 {Haemophil 2e-34
d1r9pa_134 d.224.1.2 (A:) NifU-like protein HI0377 {Haemophil 2e-34
d1qz9a_404 c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescen 4e-34
d1qz9a_404 c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescen 4e-33
d1dkza2118 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxI 4e-34
d1dkza2118 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxI 4e-34
d1c4ka2462 c.67.1.5 (A:108-569) Ornithine decarboxylase major 2e-32
d1c4ka2462 c.67.1.5 (A:108-569) Ornithine decarboxylase major 2e-32
d1wfza_130 d.224.1.2 (A:) Iron-sulfur cluster protein U (IscU 6e-32
d1wfza_130 d.224.1.2 (A:) Iron-sulfur cluster protein U (IscU 6e-32
d1u00a2115 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc6 5e-31
d1u00a2115 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc6 5e-31
d2bkwa1382 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransfe 6e-30
d2bkwa1382 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransfe 6e-30
d1svva_340 c.67.1.1 (A:) Low-specificity threonine aldolase { 9e-30
d1svva_340 c.67.1.1 (A:) Low-specificity threonine aldolase { 2e-29
d1ax4a_465 c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanas 2e-29
d1ax4a_465 c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanas 2e-29
d1pmma_450 c.67.1.6 (A:) Glutamate decarboxylase beta, GadB { 9e-28
d1pmma_450 c.67.1.6 (A:) Glutamate decarboxylase beta, GadB { 9e-28
d1vjoa_377 c.67.1.3 (A:) Alanine-glyoxylate aminotransferase 2e-26
d1vjoa_377 c.67.1.3 (A:) Alanine-glyoxylate aminotransferase 2e-26
d1mw7a_220 e.39.1.1 (A:) Hypothetical protein HP0162 {Helicob 6e-26
d1m32a_361 c.67.1.3 (A:) 2-aminoethylphosphonate transaminase 3e-25
d1m32a_361 c.67.1.3 (A:) 2-aminoethylphosphonate transaminase 3e-25
d1h0ca_388 c.67.1.3 (A:) Alanine-glyoxylate aminotransferase 3e-25
d1h0ca_388 c.67.1.3 (A:) Alanine-glyoxylate aminotransferase 3e-25
d2ch1a1388 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminas 2e-24
d2ch1a1388 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminas 2e-24
d1elua_381 c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocyst 4e-24
d1elua_381 c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocyst 1e-22
d1jcea1137 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB 3e-23
d1jcea1137 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB 3e-23
d2v1pa1467 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptop 4e-23
d2v1pa1467 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptop 4e-23
d1xjsa_147 d.224.1.2 (A:) NifU {Bacillus subtilis [TaxId: 142 2e-21
d1xjsa_147 d.224.1.2 (A:) NifU {Bacillus subtilis [TaxId: 142 2e-21
d1v72a1345 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Ps 3e-21
d1v72a1345 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Ps 8e-21
d1jcea2196 c.55.1.1 (A:141-336) Prokaryotic actin homolog Mre 3e-20
d1jcea2196 c.55.1.1 (A:141-336) Prokaryotic actin homolog Mre 3e-20
d1i7ha_109 d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escheri 4e-19
d1i7ha_109 d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escheri 2e-16
d1su0b_136 d.224.1.2 (B:) IscU homolog SPy0289 {Streptococcus 5e-19
d1su0b_136 d.224.1.2 (B:) IscU homolog SPy0289 {Streptococcus 5e-19
d3bc8a1445 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase 5e-18
d3bc8a1445 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase 5e-18
d2e7ja1364 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase ( 2e-17
d2e7ja1364 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase ( 6e-17
d2z67a1434 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase ( 1e-16
d2z67a1434 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase ( 1e-16
d1c7ga_456 c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbi 3e-16
d1c7ga_456 c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbi 3e-16
d1l5pa_93 d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vagin 8e-16
d1l5pa_93 d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vagin 1e-13
d2bt6a1104 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [ 6e-15
d2bt6a1104 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [ 3e-12
d1js3a_476 c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) 8e-15
d1js3a_476 c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) 3e-14
d2zgya2163 c.55.1.1 (A:158-320) Plasmid segregation protein P 2e-14
d2zgya2163 c.55.1.1 (A:158-320) Plasmid segregation protein P 2e-14
d1xlqa1106 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas 2e-13
d1xlqa1106 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas 8e-11
d1b9ra_105 d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., 2e-13
d1b9ra_105 d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., 1e-10
d1bjna_360 c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT 1e-12
d1bjna_360 c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT 1e-12
d2fsja1161 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 7e-12
d2fsja1161 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 7e-12
d1e9ma_106 d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsu 1e-11
d1e9ma_106 d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsu 3e-09
d1s98a_97 b.124.1.1 (A:) Fe-S scaffold protein IscA (YfhF) { 3e-11
d1s98a_97 b.124.1.1 (A:) Fe-S scaffold protein IscA (YfhF) { 3e-11
d2fug3395 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chai 4e-10
d2fug3395 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chai 1e-07
d1nwba_101 b.124.1.1 (A:) Hypothetical protein Aq_1857 {Aquif 4e-07
d1nwba_101 b.124.1.1 (A:) Hypothetical protein Aq_1857 {Aquif 4e-07
d1doia_128 d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcu 3e-06
d1doia_128 d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcu 0.001
d1v2da_368 c.67.1.1 (A:) Glutamine aminotransferase {Thermus 6e-06
d1v2da_368 c.67.1.1 (A:) Glutamine aminotransferase {Thermus 6e-06
d1krha3104 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, 6e-06
d1krha3104 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, 0.001
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 7e-05
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 7e-05
d1a70a_97 d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia 1e-04
d1a70a_97 d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia 0.002
d1jq4a_98 d.15.4.2 (A:) Methane monooxygenase reductase N-te 2e-04
d1m6sa_343 c.67.1.1 (A:) Low-specificity threonine aldolase { 3e-04
d1m6sa_343 c.67.1.1 (A:) Low-specificity threonine aldolase { 0.001
d1frda_98 d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (A 0.003
d1frra_95 d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense 0.004
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Length = 391 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Cystathionine synthase-like
domain: Cysteine desulfurase IscS
species: Escherichia coli [TaxId: 562]
 Score =  344 bits (884), Expect = e-107
 Identities = 245/369 (66%), Positives = 317/369 (85%), Gaps = 3/369 (0%)

Query: 1   MDYSATTPIDPRVVDKMIPYLRVQ--FGNPASRNHIYGWTAEKAIEKARNEVAQLIYADP 58
           +DYSATTP+DPRV +KM+ ++ +   FGNPASR+H +GW AE+A++ ARN++A L+ ADP
Sbjct: 6   LDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADP 65

Query: 59  REIIWTSGATESNNLAIKGAAHFYKKRGKHIITVQTEHKSVLDSIRKLENDGFRVTYLKP 118
           REI++TSGATES+NLAIKGAA+FY+K+GKHIIT +TEHK+VLD+ R+LE +GF VTYL P
Sbjct: 66  REIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAP 125

Query: 119 KNNGLITLSQLEEKICSDTILVSVMLVNNEIGVIQPILEIGELCRSKGVIFHCDAAQAVG 178
           + NG+I L +LE  +  DTILVS+M VNNEIGV+Q I  IGE+CR++G+I+H DA Q+VG
Sbjct: 126 QRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVG 185

Query: 179 KIDINIQNYKVDLMSFSAHKIYGPKGIGALYIRRNPRTRIEAQIHGGGHEYGLRSGTLAT 238
           K+ I++   KVDLMSFS HKIYGPKGIGALY+RR PR RIEAQ+HGGGHE G+RSGTL  
Sbjct: 186 KLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPV 245

Query: 239 HQIVGMGEAFRLARIEMKEELKRILFLQKRLYNGLMESIEEIYINGDMNNRIPHNLNISF 298
           HQIVGMGEA+R+A+ EM  E++R+  L+ RL+NG+ + IEE+Y+NGD+ +  P+ LN+SF
Sbjct: 246 HQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGI-KDIEEVYLNGDLEHGAPNILNVSF 304

Query: 299 NFIEGESLLMAIKDIAVSSGSACTSASLEPSYVLRALGCNDELAHSSIRFTIGRFTTEKE 358
           N++EGESL+MA+KD+AVSSGSACTSASLEPSYVLRALG NDELAHSSIRF++GRFTTE+E
Sbjct: 305 NYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEE 364

Query: 359 IDFTIKLLK 367
           ID+TI+L++
Sbjct: 365 IDYTIELVR 373


>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Length = 391 Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Length = 376 Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Length = 376 Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Length = 408 Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Length = 408 Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Length = 405 Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Length = 405 Back     information, alignment and structure
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 183 Back     information, alignment and structure
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 183 Back     information, alignment and structure
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 185 Back     information, alignment and structure
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 185 Back     information, alignment and structure
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 198 Back     information, alignment and structure
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 198 Back     information, alignment and structure
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 193 Back     information, alignment and structure
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 193 Back     information, alignment and structure
>d1kona_ e.39.1.1 (A:) Hypothetical protein YebC {Escherichia coli [TaxId: 562]} Length = 244 Back     information, alignment and structure
>d1yuwa1 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 Back     information, alignment and structure
>d1yuwa1 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 Back     information, alignment and structure
>d1lfpa_ e.39.1.1 (A:) Hypothetical protein aq1575 {Aquifex aeolicus [TaxId: 63363]} Length = 243 Back     information, alignment and structure
>d1r9pa_ d.224.1.2 (A:) NifU-like protein HI0377 {Haemophilus influenzae [TaxId: 727]} Length = 134 Back     information, alignment and structure
>d1r9pa_ d.224.1.2 (A:) NifU-like protein HI0377 {Haemophilus influenzae [TaxId: 727]} Length = 134 Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Length = 404 Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Length = 404 Back     information, alignment and structure
>d1dkza2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]} Length = 118 Back     information, alignment and structure
>d1dkza2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]} Length = 118 Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Length = 462 Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Length = 462 Back     information, alignment and structure
>d1wfza_ d.224.1.2 (A:) Iron-sulfur cluster protein U (IscU) {Mouse (Mus musculus), mitochondrial [TaxId: 10090]} Length = 130 Back     information, alignment and structure
>d1wfza_ d.224.1.2 (A:) Iron-sulfur cluster protein U (IscU) {Mouse (Mus musculus), mitochondrial [TaxId: 10090]} Length = 130 Back     information, alignment and structure
>d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Length = 115 Back     information, alignment and structure
>d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Length = 115 Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 382 Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 382 Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Length = 340 Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Length = 340 Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Length = 465 Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Length = 465 Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Length = 450 Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Length = 450 Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Length = 377 Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Length = 377 Back     information, alignment and structure
>d1mw7a_ e.39.1.1 (A:) Hypothetical protein HP0162 {Helicobacter pylori [TaxId: 210]} Length = 220 Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Length = 361 Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Length = 361 Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Length = 388 Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Length = 388 Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Length = 381 Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Length = 381 Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 137 Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 137 Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Length = 467 Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Length = 467 Back     information, alignment and structure
>d1xjsa_ d.224.1.2 (A:) NifU {Bacillus subtilis [TaxId: 1423]} Length = 147 Back     information, alignment and structure
>d1xjsa_ d.224.1.2 (A:) NifU {Bacillus subtilis [TaxId: 1423]} Length = 147 Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Length = 345 Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Length = 345 Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 196 Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 196 Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Length = 109 Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Length = 109 Back     information, alignment and structure
>d1su0b_ d.224.1.2 (B:) IscU homolog SPy0289 {Streptococcus pyogenes [TaxId: 1314]} Length = 136 Back     information, alignment and structure
>d1su0b_ d.224.1.2 (B:) IscU homolog SPy0289 {Streptococcus pyogenes [TaxId: 1314]} Length = 136 Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Length = 445 Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Length = 445 Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 364 Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 364 Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Length = 434 Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Length = 434 Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Length = 456 Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Length = 456 Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Length = 93 Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Length = 93 Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Length = 104 Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Length = 104 Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 476 Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 476 Back     information, alignment and structure
>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Length = 163 Back     information, alignment and structure
>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Length = 163 Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Length = 106 Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Length = 106 Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Length = 105 Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Length = 105 Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Length = 360 Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Length = 360 Back     information, alignment and structure
>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 161 Back     information, alignment and structure
>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 161 Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Length = 106 Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Length = 106 Back     information, alignment and structure
>d1s98a_ b.124.1.1 (A:) Fe-S scaffold protein IscA (YfhF) {Escherichia coli [TaxId: 562]} Length = 97 Back     information, alignment and structure
>d1s98a_ b.124.1.1 (A:) Fe-S scaffold protein IscA (YfhF) {Escherichia coli [TaxId: 562]} Length = 97 Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 95 Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 95 Back     information, alignment and structure
>d1nwba_ b.124.1.1 (A:) Hypothetical protein Aq_1857 {Aquifex aeolicus [TaxId: 63363]} Length = 101 Back     information, alignment and structure
>d1nwba_ b.124.1.1 (A:) Hypothetical protein Aq_1857 {Aquifex aeolicus [TaxId: 63363]} Length = 101 Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 128 Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 128 Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Length = 368 Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Length = 368 Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Length = 104 Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Length = 104 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 97 Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 97 Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Length = 98 Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Length = 343 Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Length = 343 Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Length = 98 Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query2602
d1kona_244 Hypothetical protein YebC {Escherichia coli [TaxId 100.0
d1lfpa_243 Hypothetical protein aq1575 {Aquifex aeolicus [Tax 100.0
d1mw7a_220 Hypothetical protein HP0162 {Helicobacter pylori [ 100.0
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 100.0
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 100.0
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 100.0
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 100.0
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 100.0
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 100.0
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 100.0
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 100.0
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 100.0
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 100.0
d1dkgd1183 Heat shock protein 70kDa, ATPase fragment {Escheri 99.97
d1bupa2193 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 99.97
d1dkgd2198 Heat shock protein 70kDa, ATPase fragment {Escheri 99.97
d1dkgd1183 Heat shock protein 70kDa, ATPase fragment {Escheri 99.97
d1bupa1185 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 99.97
d1bupa2193 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 99.96
d1dkgd2198 Heat shock protein 70kDa, ATPase fragment {Escheri 99.96
d1bupa1185 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 99.96
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 99.95
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 99.94
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 99.94
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 99.94
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 99.94
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 99.93
d1yuwa1159 DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} 99.92
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 99.92
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 99.92
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 99.92
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 99.91
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 99.91
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 99.91
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 99.91
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 99.91
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 99.91
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 99.91
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 99.9
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 99.9
d1yuwa1159 DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} 99.9
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 99.9
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.9
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 99.9
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.9
d1dkza2118 DnaK {Escherichia coli [TaxId: 562]} 99.89
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 99.89
d1u00a2115 Chaperone protein hscA (Hsc66) {Escherichia coli [ 99.89
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 99.88
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 99.88
d1dkza2118 DnaK {Escherichia coli [TaxId: 562]} 99.88
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 99.88
d1u00a2115 Chaperone protein hscA (Hsc66) {Escherichia coli [ 99.87
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 99.87
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 99.87
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 99.87
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 99.86
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 99.86
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 99.86
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 99.86
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 99.86
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 99.86
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 99.86
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 99.86
d1r9pa_134 NifU-like protein HI0377 {Haemophilus influenzae [ 99.86
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 99.85
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 99.85
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 99.85
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 99.84
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 99.84
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 99.83
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 99.83
d1r9pa_134 NifU-like protein HI0377 {Haemophilus influenzae [ 99.83
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 99.83
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 99.83
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 99.83
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 99.82
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.82
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 99.82
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.82
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 99.82
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.81
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 99.81
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 99.81
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.81
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 99.8
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 99.8
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 99.8
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 99.79
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 99.79
d1wfza_130 Iron-sulfur cluster protein U (IscU) {Mouse (Mus m 99.79
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 99.79
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 99.78
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 99.78
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 99.78
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 99.78
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 99.78
d1jcea1137 Prokaryotic actin homolog MreB {Thermotoga maritim 99.78
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 99.77
d1wfza_130 Iron-sulfur cluster protein U (IscU) {Mouse (Mus m 99.77
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 99.77
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 99.76
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 99.76
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 99.76
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 99.75
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 99.75
d1jcea1137 Prokaryotic actin homolog MreB {Thermotoga maritim 99.75
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.75
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.74
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 99.74
d2hoxa1425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 99.73
d1su0b_136 IscU homolog SPy0289 {Streptococcus pyogenes [TaxI 99.73
d2hoxa1425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 99.73
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.73
d1su0b_136 IscU homolog SPy0289 {Streptococcus pyogenes [TaxI 99.73
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 99.72
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 99.72
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 99.72
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.72
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 99.72
d1jcea2196 Prokaryotic actin homolog MreB {Thermotoga maritim 99.72
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 99.7
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 99.7
d1xjsa_147 NifU {Bacillus subtilis [TaxId: 1423]} 99.69
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 99.69
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 99.69
d1jcea2196 Prokaryotic actin homolog MreB {Thermotoga maritim 99.69
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 99.69
d1xjsa_147 NifU {Bacillus subtilis [TaxId: 1423]} 99.69
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 99.69
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 99.69
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 99.68
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.68
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 99.67
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 99.67
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 99.66
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 99.66
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 99.65
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 99.65
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 99.65
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 99.65
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 99.65
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 99.63
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.63
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 99.63
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 99.63
d2bt6a1104 Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} 99.63
d1xlqa1106 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox 99.63
d1b9ra_105 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T 99.62
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 99.62
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.62
d2ctza1421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 99.62
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 99.61
d1pffa_331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.61
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 99.61
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 99.61
d1s98a_97 Fe-S scaffold protein IscA (YfhF) {Escherichia col 99.61
d1s98a_97 Fe-S scaffold protein IscA (YfhF) {Escherichia col 99.6
d1e9ma_106 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo 99.59
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 99.58
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 99.58
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 99.58
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 99.58
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 99.57
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 99.56
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 99.56
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 99.56
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 99.55
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 99.55
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 99.54
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 99.54
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 99.54
d1pffa_331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.54
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 99.54
d1l5pa_93 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 99.53
d2ctza1421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 99.53
d1nwba_101 Hypothetical protein Aq_1857 {Aquifex aeolicus [Ta 99.52
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.52
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 99.52
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 99.52
d1nwba_101 Hypothetical protein Aq_1857 {Aquifex aeolicus [Ta 99.51
d1i7ha_109 Adrenodoxin-like ferredoxin {Escherichia coli [Tax 99.5
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 99.49
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 99.48
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 99.45
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 99.43
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 99.42
d2bt6a1104 Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} 99.4
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 99.38
d1xlqa1106 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox 99.37
d1b9ra_105 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T 99.37
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 99.36
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 99.36
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 99.33
d1e9ma_106 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo 99.32
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 99.3
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 99.29
d2zgya2163 Plasmid segregation protein ParM {Escherichia coli 99.2
d1l5pa_93 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 99.18
d1i7ha_109 Adrenodoxin-like ferredoxin {Escherichia coli [Tax 99.16
d2zgya2163 Plasmid segregation protein ParM {Escherichia coli 99.16
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 99.07
d1e4ft2191 Cell division protein FtsA {Thermotoga maritima [T 99.04
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 99.03
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 99.03
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 98.99
d1e4ft2191 Cell division protein FtsA {Thermotoga maritima [T 98.98
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 98.97
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 98.9
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 98.86
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 98.84
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 98.82
d2fsja1161 Hypothetical protein Ta0583 {Archaeon Thermoplasma 98.78
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 98.78
d2fsja1161 Hypothetical protein Ta0583 {Archaeon Thermoplasma 98.76
d2fug3395 Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi 98.75
d2gsaa_427 Glutamate-1-semialdehyde aminomutase (aminotransfe 98.75
d1s0aa_429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 98.71
d1zoda1431 Dialkylglycine decarboxylase {Pseudomonas cepacia 98.68
d2gsaa_427 Glutamate-1-semialdehyde aminomutase (aminotransfe 98.66
d1s0aa_429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 98.64
d1zoda1431 Dialkylglycine decarboxylase {Pseudomonas cepacia 98.57
d1ohwa_461 4-aminobutyrate aminotransferase, GABA-aminotransf 98.48
d1ohwa_461 4-aminobutyrate aminotransferase, GABA-aminotransf 98.44
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 98.38
d1krha3104 Benzoate dioxygenase reductase, N-terminal domain 98.23
d1fpoa295 HSC20 (HSCB), C-terminal oligomerisation domain {E 98.23
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 98.2
d1fpoa295 HSC20 (HSCB), C-terminal oligomerisation domain {E 98.13
d1huxa_259 Hydroxyglutaryl-CoA dehydratase component A {Acida 98.09
d1huxa_259 Hydroxyglutaryl-CoA dehydratase component A {Acida 98.06
d1iuea_98 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa 97.98
d1jq4a_98 Methane monooxygenase reductase N-terminal domain 97.97
d1doia_128 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui 97.96
d1a70a_97 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta 97.92
d2fug3395 Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi 97.9
d1frda_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 97.89
d1awda_94 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} 97.86
d1frra_95 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 97.85
d1czpa_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 97.76
d2piaa398 Phthalate dioxygenase reductase, C-terminal domain 97.46
d1nbwa3202 ATPase domain of the glycerol dehydratase reactiva 97.2
d1krha3104 Benzoate dioxygenase reductase, N-terminal domain 97.18
d1nbwa3202 ATPase domain of the glycerol dehydratase reactiva 97.14
d2d0oa3203 Diol dehydratase-reactivating factor large subunit 97.07
d2fxua2225 Actin {Cow (Bos taurus) [TaxId: 9913]} 97.0
d2fxua2225 Actin {Cow (Bos taurus) [TaxId: 9913]} 96.99
d1k8ka2258 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 96.97
d1jq4a_98 Methane monooxygenase reductase N-terminal domain 96.93
d1k8ka2258 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 96.93
d2d0oa3203 Diol dehydratase-reactivating factor large subunit 96.87
d1doia_128 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui 96.78
d1frda_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 96.74
d1wria_93 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 96.62
d1czpa_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 96.45
d1a70a_97 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta 96.4
d1awda_94 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} 96.29
d1iuea_98 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa 96.21
d1frra_95 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 96.09
d1k8kb1190 Actin-related protein 2, Arp2 {Cow (Bos taurus) [T 95.72
d1k8kb1190 Actin-related protein 2, Arp2 {Cow (Bos taurus) [T 95.19
d2piaa398 Phthalate dioxygenase reductase, C-terminal domain 95.12
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 94.75
d2p2ea1118 Putative Fe-S biosynthesis protein LSL1730 {Lactob 92.72
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 92.53
d2i7na2212 Pantothenate kinase 1, PANK1 {Human (Homo sapiens) 92.37
d1r59o2235 Glycerol kinase {Enterococcus casseliflavus [TaxId 92.33
d1e4ft1193 Cell division protein FtsA {Thermotoga maritima [T 92.11
d1r59o2235 Glycerol kinase {Enterococcus casseliflavus [TaxId 91.86
d2p2ea1118 Putative Fe-S biosynthesis protein LSL1730 {Lactob 91.75
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 91.66
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 91.43
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 91.1
d2i7na2212 Pantothenate kinase 1, PANK1 {Human (Homo sapiens) 90.96
d2p3ra2247 Glycerol kinase {Escherichia coli [TaxId: 562]} 90.83
d2p3ra2247 Glycerol kinase {Escherichia coli [TaxId: 562]} 90.59
d2fxua1140 Actin {Cow (Bos taurus) [TaxId: 9913]} 89.82
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 88.68
d1k8ka1158 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 88.23
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 88.15
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 88.01
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 87.65
d2fxua1140 Actin {Cow (Bos taurus) [TaxId: 9913]} 87.39
d1e4ft1193 Cell division protein FtsA {Thermotoga maritima [T 87.1
d1wria_93 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 86.33
d1k8ka1158 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 84.93
d3c8ya2126 Fe-only hydrogenase, N-terminal domain {Clostridiu 84.46
d2fsja2164 Hypothetical protein Ta0583 {Archaeon Thermoplasma 80.91
d1sz2a1319 Glucokinase Glk {Escherichia coli [TaxId: 562]} 80.89
d2fsja2164 Hypothetical protein Ta0583 {Archaeon Thermoplasma 80.31
>d1kona_ e.39.1.1 (A:) Hypothetical protein YebC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: YebC-like
superfamily: YebC-like
family: YebC-like
domain: Hypothetical protein YebC
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=2.9e-57  Score=526.24  Aligned_cols=225  Identities=36%  Similarity=0.615  Sum_probs=204.4

Q ss_pred             cccCcccccccccccchhhHHHHHHHHHHHHHhc-CCCCCCChHHHHHHHHHHHcCCChhHHHHHHHhccCCCCCCCcce
Q psy15216       1193 KAWGLEENSRLSFDAKRGKICTRIMRELRVAINF-GNNPDTNIKLRLAIEKALDANIPKNNIFRAIQKNNSNIKNENINY 1271 (2602)
Q Consensus      1193 ~~~~~~~~srl~~d~~~~~~~~~~~~~i~~a~~~-g~~p~~n~~l~~~~~~a~~~~~p~~~i~~ai~~~~~~~~~~~~~~ 1271 (2602)
                      ++|.+++|.|.+.|++|+|+|+||+|+|++|+|. ||||+.|+|||+||++||++||||||||||||||+|+.  ++.+|
T Consensus         3 sKW~nIkh~K~a~D~~k~k~f~k~~k~I~~A~k~GG~DP~~N~~L~~ai~~Ak~~nmPkd~IeraIkk~~g~~--~~~~~   80 (244)
T d1kona_           3 SKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNNMTRDTLNRAIARGVGGD--DDANM   80 (244)
T ss_dssp             CSGGGTSSSTTTTTSCHHHHHHHHHHHHHHHHHC-----CCSTTTHHHHHHHHHTTCCHHHHHHHHSCC--------CCC
T ss_pred             chhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCCccCHHHHHHHHHHHHcCCchHHHHHHHHhccCCC--CCCce
Confidence            4899999999999999999999999999999975 57999999999999999999999999999999999875  36789


Q ss_pred             EEEEEEEeccCCcEEEEEEecCCchhhHHHHHHhhhccCccccCCcceeEeeceeEEEEECCCCChhHHHHHHHhcCCce
Q psy15216       1272 IEVRYEGYSVNGAAIIVDCITNNRMRTVSNIRNIFNKNGGNLSKEGSVLFMFKHCGQLLFLPNTKKNTLLDLALEKGAED 1351 (2602)
Q Consensus      1272 ~~~~ye~~~p~g~~~~v~~~tdn~~r~~~~~r~~~~k~~g~~~~~g~v~~~f~~~g~~~~~~~~~~~~~~~~~~~~g~~d 1351 (2602)
                      ++++|||||||||+|||||||||+|||+++||++|+|+||+||++|||+|||+|||+|.+++. ++|++||.|||+||+|
T Consensus        81 ~e~~yEg~gp~gvaiiVe~lTDN~nRt~~~vR~~f~K~gG~lg~~GsV~~~F~~kG~i~~~~~-~~d~l~e~aie~gAeD  159 (244)
T d1kona_          81 ETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKCGGNLGTDGSVAYLFSKKGVISFEKG-DEDTIMEAALEAGAED  159 (244)
T ss_dssp             EEEEEEEEETTTEEEEEEEEESCHHHHHHHHHHHHHTTTCEECCTTSSGGGEEEEEEEEESSS-CHHHHHHHHHHHTCSE
T ss_pred             EEEEEEEEcCCccEEEEEEecCcHHHHHHHHHHHHHHcCCeeCCCccHhhhhheeceeccCCC-CHHHHHHHHHHhccch
Confidence            999999999999999999999999999999999999999999999999999999999999864 8999999999999999


Q ss_pred             eeeccCceEEEEeCcccHHHHHHHHHhcCCCccccceeeeeceeeeccCCCCCCCHHHHHHHHHHHhhc
Q psy15216       1352 FLIDKDNKITIITSPSKFIEIKNSLEMTGFKAESSGIVMRPYTNIVFKDATTPIDPRVVDKMIPYLRVQ 1420 (2602)
Q Consensus      1352 ~~~~~~~~~~~~~~~~~~~~v~~aL~~~g~~~~~~ei~~iP~~~v~L~~~~~~~~~~v~eal~~~l~~~ 1420 (2602)
                      +++.+++.++|+|+|++|..|+++|+++|+.+.++++.|+|.+++.++.........++++|++..+.+
T Consensus       160 v~~~d~~~~~i~~~~~dl~~v~~~Le~~g~~~~~aei~~~P~~~v~l~~e~~~k~~kLid~Led~DDVq  228 (244)
T d1kona_         160 VVTYDDGAIDVYTAWEEMGKVRDALEAAGLKADSAEVSMIPSTKADMDAETAPKLMRLIDMLEDCDDVQ  228 (244)
T ss_dssp             EEECTTSCEEEEEEGGGHHHHHHHHHHTTCCCSEEEEEEEESSCCCCCTTTSHHHHHHHHHHHHSSSEE
T ss_pred             hcccCCCceEEEecchhHHHHHHHHHhcCCCceeeeEEEEeCCccccCHHHHHHHHHHHHHHhcccCcc
Confidence            977777889999999999999999999999999999999999999998877777778888888877664



>d1lfpa_ e.39.1.1 (A:) Hypothetical protein aq1575 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1mw7a_ e.39.1.1 (A:) Hypothetical protein HP0162 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yuwa1 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1yuwa1 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1dkza2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dkza2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r9pa_ d.224.1.2 (A:) NifU-like protein HI0377 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r9pa_ d.224.1.2 (A:) NifU-like protein HI0377 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wfza_ d.224.1.2 (A:) Iron-sulfur cluster protein U (IscU) {Mouse (Mus musculus), mitochondrial [TaxId: 10090]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wfza_ d.224.1.2 (A:) Iron-sulfur cluster protein U (IscU) {Mouse (Mus musculus), mitochondrial [TaxId: 10090]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d1su0b_ d.224.1.2 (B:) IscU homolog SPy0289 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1su0b_ d.224.1.2 (B:) IscU homolog SPy0289 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1xjsa_ d.224.1.2 (A:) NifU {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1xjsa_ d.224.1.2 (A:) NifU {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s98a_ b.124.1.1 (A:) Fe-S scaffold protein IscA (YfhF) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s98a_ b.124.1.1 (A:) Fe-S scaffold protein IscA (YfhF) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nwba_ b.124.1.1 (A:) Hypothetical protein Aq_1857 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nwba_ b.124.1.1 (A:) Hypothetical protein Aq_1857 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1fpoa2 a.23.1.1 (A:77-171) HSC20 (HSCB), C-terminal oligomerisation domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fpoa2 a.23.1.1 (A:77-171) HSC20 (HSCB), C-terminal oligomerisation domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1nbwa3 c.55.1.6 (A:406-607) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1nbwa3 c.55.1.6 (A:406-607) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2d0oa3 c.55.1.6 (A:404-606) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]} Back     information, alignment and structure
>d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2d0oa3 c.55.1.6 (A:404-606) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]} Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Back     information, alignment and structure
>d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p2ea1 b.124.1.1 (A:3-120) Putative Fe-S biosynthesis protein LSL1730 {Lactobacillus salivarius [TaxId: 1624]} Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i7na2 c.55.1.14 (A:382-593) Pantothenate kinase 1, PANK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r59o2 c.55.1.4 (O:257-491) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} Back     information, alignment and structure
>d1e4ft1 c.55.1.1 (T:7-199) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r59o2 c.55.1.4 (O:257-491) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} Back     information, alignment and structure
>d2p2ea1 b.124.1.1 (A:3-120) Putative Fe-S biosynthesis protein LSL1730 {Lactobacillus salivarius [TaxId: 1624]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i7na2 c.55.1.14 (A:382-593) Pantothenate kinase 1, PANK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fxua1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d2fxua1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1e4ft1 c.55.1.1 (T:7-199) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2fsja2 c.55.1.12 (A:1-164) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1sz2a1 c.55.1.7 (A:3-321) Glucokinase Glk {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fsja2 c.55.1.12 (A:1-164) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure