Psyllid ID: psy1521


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
MRAVPGGIAATDGRLLKGDQIMSVDGTDVRDKSQEEVATIMKGGILVHDIYPEGAAAKDARLKFGDQILELTGEDFRNITHAKAMAHLRLTPAKAKPCPTVPSEPNANATTGEKTTFYFHFQVKLVVLRDTVTKEDDLLEFVDVELTKKAGKGFGLSLVGRKQGPGVFISDLVSE
cEEEcccccccccccccccEEEEEccccccccccccccEEEccEEEEEEEccccccccccccccccEEEEEccEEcccccHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEEcccccccccccccEEEEEEEEcccccccEEEEcccccccEEEEEcccc
ccEEcccHHHHHccccccEEEEEEccEEcccccHHHHHHHHHcEEEEEEEccccHHHHHcccccccEEEEEccEEcccccHHHHHHHHHHccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEEccccccEEEEEcccccccEEEEEEEcc
mravpggiaatdgrllkgdqimsvdgtdvrdKSQEEVATIMKGGIlvhdiypegaaakDARLKFGDQILELTGEDFRNITHAKAMAHLrltpakakpcptvpsepnanattgekttFYFHFQVKLVVLRdtvtkeddlleFVDVELTKkagkgfglslvgrkqgpgvfisdlvse
mravpggiaatdgrllkgdqimsvdgtdvrdKSQEEVATIMKGGILVHDIYPEGAAAKDARLKFGDQILELTGEDFRNITHAKAMAHLRLTPAKAKPCPTVPSEPNANATTGEKTTFYFHFQVKLVVLRDTVTKEDDLLEFVDveltkkagkgfglslvgrkqgpgvfisdlvse
MRAVPGGIAATDGRLLKGDQIMSVDGTDVRDKSQEEVATIMKGGILVHDIYPEGAAAKDARLKFGDQILELTGEDFRNITHAKAMAHLRLTPAKAKPCPTVPSEPNANATTGEKTTFYFHFQVKLVVLRDTVTKEDDLLEFVDVELTKKAGKGFGLSLVGRKQGPGVFISDLVSE
************************************VATIMKGGILVHDIYPEGAAAKDARLKFGDQILELTGEDFRNITHAKAMAHLRL***********************KTTFYFHFQVKLVVLRDTVTKEDDLLEFVDVELTKKAGKGFGLSLVGRKQGPGVFI******
MRAVPGGIAATDGRLLKGDQIMSVDGTDVRDKSQEEVATIMKGGILVHDIYPEGAAAKDARLKFGDQILELTGEDFRNITHAKAMAHLRL*************************************************EFVDVELTKKAGKGFGLSLVGRKQGPGVFISDLVSE
MRAVPGGIAATDGRLLKGDQIMSVDGTDVRDKSQEEVATIMKGGILVHDIYPEGAAAKDARLKFGDQILELTGEDFRNITHAKAMAHLRLTPAKAKPCPTVPSEPNANATTGEKTTFYFHFQVKLVVLRDTVTKEDDLLEFVDVELTKKAGKGFGLSLVGRKQGPGVFISDLVSE
*RAVPGGIAATDGRLLKGDQIMSVDGTDVRDKSQEEVATIMKGGILVHDIYPEGAAAKDARLKFGDQILELTGEDFRNITHAKAMAHLRLTPAKAKPCPTVPSE*********************************LLEFVDVELTKKAGKGFGLSLVGRKQGPGVFISDLVSE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRAVPGGIAATDGRLLKGDQIMSVDGTDVRDKSQEEVATIMKGGILVHDIYPEGAAAKDARLKFGDQILELTGEDFRNITHAKAMAHLRLTPAKAKPCPTVPSEPNANATTGEKTTFYFHFQVKLVVLRDTVTKEDDLLEFVDVELTKKAGKGFGLSLVGRKQGPGVFISDLVSE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query175 2.2.26 [Sep-21-2011]
Q8NI35 1801 InaD-like protein OS=Homo yes N/A 0.588 0.057 0.424 2e-21
Q63ZW7 1834 InaD-like protein OS=Mus no N/A 0.582 0.055 0.412 9e-20
O55164 2054 Multiple PDZ domain prote no N/A 0.588 0.050 0.401 4e-19
O75970 2070 Multiple PDZ domain prote no N/A 0.588 0.049 0.393 4e-19
Q8VBX6 2055 Multiple PDZ domain prote no N/A 0.588 0.050 0.393 5e-19
Q8N448 690 Ligand of Numb protein X no N/A 0.628 0.159 0.284 3e-06
Q91XL2 687 Ligand of Numb protein X no N/A 0.628 0.160 0.292 4e-06
Q5PYH6 873 Disks large homolog 1 OS= no N/A 0.965 0.193 0.235 9e-06
Q5PYH5 827 Discs large homolog 1-lik no N/A 0.902 0.191 0.244 1e-05
Q9CSB4 1203 Partitioning defective 3 no N/A 0.268 0.039 0.489 6e-05
>sp|Q8NI35|INADL_HUMAN InaD-like protein OS=Homo sapiens GN=INADL PE=1 SV=3 Back     alignment and function desciption
 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 76/132 (57%), Gaps = 29/132 (21%)

Query: 43   GGILVHDIYPEGAAAKDARLKFGDQILELTGEDFRNITHAKAMAHLRLTPAKAKPCPTVP 102
              I++H++Y EGAAA+D RL  GDQILE+ G D RN +H +A+  LR TP K        
Sbjct: 1460 NAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNSSHEEAITALRQTPQK-------- 1511

Query: 103  SEPNANATTGEKTTFYFHFQVKLVVLRDTV-TKEDDLLEFVDVELTKKAGKGFGLSLVGR 161
                                V+LVV RD    ++++ LE   V+L KKAG+G GLS+VG+
Sbjct: 1512 --------------------VRLVVYRDEAHYRDEENLEIFPVDLQKKAGRGLGLSIVGK 1551

Query: 162  KQGPGVFISDLV 173
            + G GVFISD+V
Sbjct: 1552 RNGSGVFISDIV 1563




Scaffolding protein that may bring different proteins into adjacent positions at the cell membrane. May regulate protein targeting, cell polarity and integrity of tight junctions. May regulate the surface expression and/or function of ASIC3 in sensory neurons.
Homo sapiens (taxid: 9606)
>sp|Q63ZW7|INADL_MOUSE InaD-like protein OS=Mus musculus GN=Inadl PE=1 SV=2 Back     alignment and function description
>sp|O55164|MPDZ_RAT Multiple PDZ domain protein OS=Rattus norvegicus GN=Mpdz PE=1 SV=1 Back     alignment and function description
>sp|O75970|MPDZ_HUMAN Multiple PDZ domain protein OS=Homo sapiens GN=MPDZ PE=1 SV=2 Back     alignment and function description
>sp|Q8VBX6|MPDZ_MOUSE Multiple PDZ domain protein OS=Mus musculus GN=Mpdz PE=1 SV=2 Back     alignment and function description
>sp|Q8N448|LNX2_HUMAN Ligand of Numb protein X 2 OS=Homo sapiens GN=LNX2 PE=1 SV=1 Back     alignment and function description
>sp|Q91XL2|LNX2_MOUSE Ligand of Numb protein X 2 OS=Mus musculus GN=Lnx2 PE=1 SV=2 Back     alignment and function description
>sp|Q5PYH6|DLG1_DANRE Disks large homolog 1 OS=Danio rerio GN=dlg1 PE=2 SV=2 Back     alignment and function description
>sp|Q5PYH5|DLG1L_DANRE Discs large homolog 1-like protein OS=Danio rerio GN=dlg1l PE=2 SV=1 Back     alignment and function description
>sp|Q9CSB4|PAR3L_MOUSE Partitioning defective 3 homolog B OS=Mus musculus GN=Pard3b PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
321475910 370 hypothetical protein DAPPUDRAFT_43800 [D 0.588 0.278 0.5 7e-28
328708386 2081 PREDICTED: multiple PDZ domain protein-l 0.582 0.049 0.435 7e-23
395516015 2074 PREDICTED: multiple PDZ domain protein [ 0.617 0.052 0.430 8e-21
449514518 2040 PREDICTED: multiple PDZ domain protein [ 0.617 0.052 0.416 3e-20
397475572 1800 PREDICTED: inaD-like protein [Pan panisc 0.588 0.057 0.431 4e-20
410291498 1801 InaD-like [Pan troglodytes] gi|410347864 0.588 0.057 0.431 4e-20
410033031 1793 PREDICTED: inaD-like protein isoform 6 [ 0.588 0.057 0.431 4e-20
380804345 438 inaD-like protein, partial [Macaca mulat 0.577 0.230 0.430 5e-20
194374211 452 unnamed protein product [Homo sapiens] 0.594 0.230 0.421 7e-20
426329850 474 PREDICTED: inaD-like protein-like [Goril 0.577 0.213 0.430 7e-20
>gi|321475910|gb|EFX86871.1| hypothetical protein DAPPUDRAFT_43800 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 88/132 (66%), Gaps = 29/132 (21%)

Query: 43  GGILVHDIYPEGAAAKDARLKFGDQILELTGEDFRNITHAKAMAHLRLTPAKAKPCPTVP 102
           G IL+H++YP+GAAA+D RLK GDQILE+ GE FRNITH++A+A LR TPAK        
Sbjct: 79  GAILIHEVYPDGAAARDKRLKPGDQILEVNGESFRNITHSRALAVLRQTPAK-------- 130

Query: 103 SEPNANATTGEKTTFYFHFQVKLVVLRD-TVTKEDDLLEFVDVELTKKAGKGFGLSLVGR 161
                               V+++V RD T  K+DD+L+ ++VEL KK G+G GLS+VGR
Sbjct: 131 --------------------VRMMVYRDETSLKDDDMLDIIEVELLKKPGRGLGLSIVGR 170

Query: 162 KQGPGVFISDLV 173
           + GPGV+ISD+V
Sbjct: 171 RNGPGVYISDVV 182




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328708386|ref|XP_001942633.2| PREDICTED: multiple PDZ domain protein-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|395516015|ref|XP_003762192.1| PREDICTED: multiple PDZ domain protein [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|449514518|ref|XP_002192031.2| PREDICTED: multiple PDZ domain protein [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|397475572|ref|XP_003809209.1| PREDICTED: inaD-like protein [Pan paniscus] Back     alignment and taxonomy information
>gi|410291498|gb|JAA24349.1| InaD-like [Pan troglodytes] gi|410347864|gb|JAA40750.1| InaD-like [Pan troglodytes] Back     alignment and taxonomy information
>gi|410033031|ref|XP_001158789.2| PREDICTED: inaD-like protein isoform 6 [Pan troglodytes] Back     alignment and taxonomy information
>gi|380804345|gb|AFE74048.1| inaD-like protein, partial [Macaca mulatta] Back     alignment and taxonomy information
>gi|194374211|dbj|BAG57001.1| unnamed protein product [Homo sapiens] Back     alignment and taxonomy information
>gi|426329850|ref|XP_004025944.1| PREDICTED: inaD-like protein-like [Gorilla gorilla gorilla] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
UNIPROTKB|Q8NI35 1801 INADL "InaD-like protein" [Hom 0.297 0.028 0.538 3.2e-28
UNIPROTKB|E1BLF1 1794 Bt.110063 "Uncharacterized pro 0.297 0.028 0.519 1.7e-27
UNIPROTKB|F1SMP5 1588 MPDZ "Uncharacterized protein" 0.337 0.037 0.491 3.6e-27
UNIPROTKB|E1C4T3 1839 E1C4T3 "Uncharacterized protei 0.297 0.028 0.538 3.7e-27
UNIPROTKB|F1N9G0 1999 F1N9G0 "Uncharacterized protei 0.337 0.029 0.508 3.8e-27
MGI|MGI:1277960 1834 Inadl "InaD-like (Drosophila)" 0.297 0.028 0.519 5.9e-27
UNIPROTKB|F1MMT3 2056 F1MMT3 "Uncharacterized protei 0.308 0.026 0.518 6.7e-27
UNIPROTKB|O75970 2070 MPDZ "Multiple PDZ domain prot 0.308 0.026 0.518 1.8e-26
UNIPROTKB|F1MAD2 1833 Inadl2 "Protein Inadl2" [Rattu 0.297 0.028 0.519 3.1e-26
RGD|3105 2054 Mpdz "multiple PDZ domain prot 0.308 0.026 0.518 1.2e-25
UNIPROTKB|Q8NI35 INADL "InaD-like protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 149 (57.5 bits), Expect = 3.2e-28, Sum P(3) = 3.2e-28
 Identities = 28/52 (53%), Positives = 38/52 (73%)

Query:    45 ILVHDIYPEGAAAKDARLKFGDQILELTGEDFRNITHAKAMAHLRLTPAKAK 96
             I++H++Y EGAAA+D RL  GDQILE+ G D RN +H +A+  LR TP K +
Sbjct:  1462 IVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNSSHEEAITALRQTPQKVR 1513


GO:0016324 "apical plasma membrane" evidence=IEA
GO:0035556 "intracellular signal transduction" evidence=NAS
GO:0005515 "protein binding" evidence=IPI
GO:0048471 "perinuclear region of cytoplasm" evidence=IDA
GO:0005923 "tight junction" evidence=IDA
GO:0005886 "plasma membrane" evidence=TAS
GO:0034329 "cell junction assembly" evidence=TAS
GO:0045216 "cell-cell junction organization" evidence=TAS
GO:0070830 "tight junction assembly" evidence=TAS
UNIPROTKB|E1BLF1 Bt.110063 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SMP5 MPDZ "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C4T3 E1C4T3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N9G0 F1N9G0 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1277960 Inadl "InaD-like (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MMT3 F1MMT3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O75970 MPDZ "Multiple PDZ domain protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAD2 Inadl2 "Protein Inadl2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|3105 Mpdz "multiple PDZ domain protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 3e-09
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 3e-07
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 2e-06
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 4e-06
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 6e-06
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 2e-05
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 4e-05
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 8e-05
TIGR02038351 TIGR02038, protease_degS, periplasmic serine pepet 0.003
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
 Score = 51.0 bits (123), Expect = 3e-09
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 42 KGGILVHDIYPEGAAAKDARLKFGDQILELTGEDFRNITHAKAMAHLR 89
           GGI V  + P G A +   L+ GD+ILE+ G     +TH +A+  L+
Sbjct: 25 GGGIFVSRVEPGGPAER-GGLRVGDRILEVNGVSVEGLTHEEAVELLK 71


May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases. Length = 82

>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|233696 TIGR02038, protease_degS, periplasmic serine pepetdase DegS Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 175
KOG3209|consensus984 99.95
KOG3209|consensus984 99.81
PRK10779449 zinc metallopeptidase RseP; Provisional 99.61
KOG3580|consensus 1027 99.61
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 99.6
KOG3580|consensus 1027 99.5
PRK10139455 serine endoprotease; Provisional 99.49
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 99.49
PRK10942473 serine endoprotease; Provisional 99.46
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.35
KOG3605|consensus829 99.27
KOG3550|consensus207 99.14
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 99.07
KOG3605|consensus829 99.07
KOG3553|consensus124 99.06
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 99.03
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 99.03
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 99.0
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.96
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 98.87
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.87
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.76
KOG3551|consensus 506 98.72
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.72
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.72
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.7
PLN00049 389 carboxyl-terminal processing protease; Provisional 98.67
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 98.65
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.65
KOG3549|consensus 505 98.64
KOG1892|consensus 1629 98.64
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.64
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 98.6
PRK10139455 serine endoprotease; Provisional 98.54
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 98.47
PRK10942473 serine endoprotease; Provisional 98.46
PRK11186 667 carboxy-terminal protease; Provisional 98.46
KOG3571|consensus 626 98.41
KOG3550|consensus207 98.41
PRK10779 449 zinc metallopeptidase RseP; Provisional 98.4
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.36
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.32
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 98.31
TIGR01713259 typeII_sec_gspC general secretion pathway protein 98.29
KOG3606|consensus358 98.27
PRK10898353 serine endoprotease; Provisional 98.26
KOG3552|consensus 1298 98.25
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.24
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 98.23
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.2
KOG3651|consensus 429 98.19
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 98.16
KOG3553|consensus124 98.14
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.04
KOG4407|consensus 1973 97.99
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 97.99
PF1281278 PDZ_1: PDZ-like domain 97.91
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 97.91
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 97.86
KOG3542|consensus 1283 97.86
KOG0609|consensus 542 97.84
KOG3129|consensus231 97.79
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 97.78
KOG3651|consensus 429 97.77
TIGR00225334 prc C-terminal peptidase (prc). A C-terminal pepti 97.77
KOG1892|consensus 1629 97.77
PLN00049 389 carboxyl-terminal processing protease; Provisional 97.76
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 97.68
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.66
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 97.64
COG3480342 SdrC Predicted secreted protein containing a PDZ d 97.61
KOG3551|consensus 506 97.55
KOG4371|consensus1332 97.51
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 97.49
KOG3571|consensus 626 97.46
KOG1421|consensus955 97.45
KOG3834|consensus 462 97.39
PRK11186 667 carboxy-terminal protease; Provisional 97.37
TIGR01713259 typeII_sec_gspC general secretion pathway protein 97.36
KOG3552|consensus 1298 97.31
COG0265347 DegQ Trypsin-like serine proteases, typically peri 97.23
KOG3938|consensus334 97.22
PRK09681276 putative type II secretion protein GspC; Provision 97.2
KOG1421|consensus 955 97.19
KOG4371|consensus1332 97.06
KOG3606|consensus358 97.01
KOG0606|consensus 1205 96.94
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 96.92
PRK10898353 serine endoprotease; Provisional 96.88
KOG0609|consensus 542 96.87
COG3975558 Predicted protease with the C-terminal PDZ domain 96.79
KOG1320|consensus473 96.76
KOG3549|consensus 505 96.65
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 96.63
KOG3834|consensus 462 96.48
KOG3542|consensus 1283 96.44
COG3975558 Predicted protease with the C-terminal PDZ domain 95.67
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 95.56
KOG0606|consensus 1205 95.45
KOG3532|consensus 1051 95.38
COG0265347 DegQ Trypsin-like serine proteases, typically peri 95.33
KOG3532|consensus 1051 95.18
KOG3129|consensus231 94.95
COG3031275 PulC Type II secretory pathway, component PulC [In 94.22
PRK09681276 putative type II secretion protein GspC; Provision 94.21
KOG1320|consensus473 93.89
KOG1738|consensus 638 93.82
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 92.82
COG3031275 PulC Type II secretory pathway, component PulC [In 91.01
KOG1738|consensus 638 89.44
COG0750 375 Predicted membrane-associated Zn-dependent proteas 89.32
COG0750375 Predicted membrane-associated Zn-dependent proteas 88.17
COG3480342 SdrC Predicted secreted protein containing a PDZ d 86.87
KOG3938|consensus334 85.53
PF07591130 PT-HINT: Pretoxin HINT domain; InterPro: IPR011451 84.65
PF1281278 PDZ_1: PDZ-like domain 83.41
>KOG3209|consensus Back     alignment and domain information
Probab=99.95  E-value=2.8e-27  Score=199.40  Aligned_cols=173  Identities=27%  Similarity=0.406  Sum_probs=129.3

Q ss_pred             ccCCCChhhhcCCCCCCCEEEEECCeeCCCCCHHHHHHHhhC--------------------------------------
Q psy1521           2 RAVPGGIAATDGRLLKGDQIMSVDGTDVRDKSQEEVATIMKG--------------------------------------   43 (175)
Q Consensus         2 ~v~~~~~A~~~G~L~~GD~Il~Vng~~v~~~~~~~~~~~l~~--------------------------------------   43 (175)
                      .|+|.|+|++||||+.||.|++|+|.+|...+|.+++.++..                                      
T Consensus       680 ~Iv~lGaAe~DGRL~~gDElv~iDG~pV~GksH~~vv~Lm~~AArnghV~LtVRRkv~~~~~~rsp~~s~~~~~~yDV~l  759 (984)
T KOG3209|consen  680 AIVPLGAAEEDGRLREGDELVCIDGIPVEGKSHSEVVDLMEAAARNGHVNLTVRRKVRTGPARRSPRNSAAPSGPYDVVL  759 (984)
T ss_pred             eeeecccccccCcccCCCeEEEecCeeccCccHHHHHHHHHHHHhcCceEEEEeeeeeeccccCCcccccCCCCCeeeEE
Confidence            478999999999999999999999999999999999999841                                      


Q ss_pred             -------------------CeEEEEecCCCcccccCCcCCCCEEEEECCeecCCCCHHHHHHHHHcCCCCCCCCCCCCCC
Q psy1521          44 -------------------GILVHDIYPEGAAAKDARLKFGDQILELTGEDFRNITHAKAMAHLRLTPAKAKPCPTVPSE  104 (175)
Q Consensus        44 -------------------gi~V~~v~~gg~A~~~G~L~~GD~Il~VNG~~l~~~~~~~a~~~lk~~~~~~~~~~~~~~~  104 (175)
                                         +.-|.+|++||||+++|+|++||+|++|||+++.+++|.+.+++||.++..++++..++.+
T Consensus       760 hR~ENeGFGFVi~sS~~kp~sgiGrIieGSPAdRCgkLkVGDrilAVNG~sI~~lsHadiv~LIKdaGlsVtLtIip~ee  839 (984)
T KOG3209|consen  760 HRKENEGFGFVIMSSQNKPESGIGRIIEGSPADRCGKLKVGDRILAVNGQSILNLSHADIVSLIKDAGLSVTLTIIPPEE  839 (984)
T ss_pred             ecccCCceeEEEEecccCCCCCccccccCChhHhhccccccceEEEecCeeeeccCchhHHHHHHhcCceEEEEEcChhc
Confidence                               1227799999999999999999999999999999999999999999999998877665544


Q ss_pred             CCCCCCCC-----Ccccceeeeee--eeeecccCCC----------------CCCCCCceEEEEEEeCCCCCcCEEEEcC
Q psy1521         105 PNANATTG-----EKTTFYFHFQV--KLVVLRDTVT----------------KEDDLLEFVDVELTKKAGKGFGLSLVGR  161 (175)
Q Consensus       105 ~~~~~~~~-----~~~~~~~~~~v--~l~v~r~~~~----------------~~~~~~~~~~v~l~k~~~~~lGfsi~gg  161 (175)
                      .....++.     .+.....++..  .+.-.|+.-.                ........++|+|+ ++..||||||+||
T Consensus       840 ~~~~~~~~sa~~~s~~t~~~~~~q~~glp~~~~s~~~~~pqpdt~~~~~~~~r~~qn~~~~~VelE-rG~kGFGFSiRGG  918 (984)
T KOG3209|consen  840 AGPPTSMTSAEKQSPFTQNGPYEQQYGLPGPRPSVYEEHPQPDTFQGLSINDRMSQNGDLYTVELE-RGAKGFGFSIRGG  918 (984)
T ss_pred             cCCCCCCcchhhcCcccccCCHhHccCCCCCCccccccCCCCccccceeccccccccCCeeEEEee-ccccccceEeecc
Confidence            32211110     11111111111  1111110000                11122368999999 6779999999999


Q ss_pred             c-CCCceEEEeccCC
Q psy1521         162 K-QGPGVFISDLVSE  175 (175)
Q Consensus       162 ~-~~~gi~I~~i~~~  175 (175)
                      + ++.++||.++..+
T Consensus       919 reynM~LfVLRlAeD  933 (984)
T KOG3209|consen  919 REYNMDLFVLRLAED  933 (984)
T ss_pred             cccccceEEEEeccC
Confidence            7 8899999988653



>KOG3209|consensus Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>PF07591 PT-HINT: Pretoxin HINT domain; InterPro: IPR011451 This entry represents a cluster of homologous proteins identified in Leptospira interrogans Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
2dm8_A116 Solution Structure Of The Eighth Pdz Domain Of Huma 1e-11
2opg_A98 The Crystal Structure Of The 10th Pdz Domain Of Mpd 6e-11
2qg1_A92 Crystal Structure Of The 11th Pdz Domain Of Mpdz (M 3e-07
2qg1_A92 Crystal Structure Of The 11th Pdz Domain Of Mpdz (M 5e-05
2fne_A117 The Crystal Structure Of The 13th Pdz Domain Of Mpd 9e-06
1q7x_A108 Solution Structure Of The Alternatively Spliced Pdz 2e-05
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 5e-05
2daz_A124 Solution Structure Of The 7th Pdz Domain Of Inad-Li 5e-05
3pdz_A96 Solution Structure Of The Pdz2 Domain From Human Ph 6e-05
1gm1_A94 Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 6e-05
1d5g_A96 Solution Structure Of The Pdz2 Domain From Human Ph 6e-05
2eno_A120 Solution Structure Of The Pdz Domain From Human Syn 7e-05
2jin_A102 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 7e-05
1vj6_A102 Pdz2 From Ptp-Bl In Complex With The C-Terminal Lig 7e-05
1ozi_A99 The Alternatively Spliced Pdz2 Domain Of Ptp-Bl Len 7e-05
2jik_A101 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 8e-05
3r0h_A206 Structure Of Inad Pdz45 In Complex With Ng2 Peptide 1e-04
3gsl_A196 Crystal Structure Of Psd-95 Tandem Pdz Domains 1 An 1e-04
2ka9_A189 Solution Structure Of Psd-95 Pdz12 Complexed With C 1e-04
2dlu_A111 Solution Structure Of The Second Pdz Domain Of Huma 1e-04
3zrt_A199 Crystal Structure Of Human Psd-95 Pdz1-2 Length = 1 2e-04
2koj_A111 Solution Structure Of Mouse Par-3 Pdz2 (Residues 45 2e-04
2koj_A111 Solution Structure Of Mouse Par-3 Pdz2 (Residues 45 4e-04
2ogp_A97 Solution Structure Of The Second Pdz Domain Of Par- 3e-04
2ogp_A97 Solution Structure Of The Second Pdz Domain Of Par- 3e-04
1uju_A111 Solution Structure Of The Fourth Pdz Domain Of Huma 3e-04
2q9v_A90 Crystal Structure Of The C890s Mutant Of The 4th Pd 3e-04
1x6d_A119 Solution Structures Of The Pdz Domain Of Human Inte 3e-04
1wfv_A103 Solution Structure Of The Fifth Pdz Domain Of Human 4e-04
2kom_A121 Solution Structure Of Humar Par-3b Pdz2 (Residues 4 4e-04
2kom_A121 Solution Structure Of Humar Par-3b Pdz2 (Residues 4 4e-04
2wl7_A102 Crystal Structure Of The Psd93 Pdz1 Domain Length = 5e-04
3k82_A98 Crystal Structure Of The Third Pdz Domain Of Psd-95 5e-04
2he2_A102 Crystal Structure Of The 3rd Pdz Domain Of Human Di 5e-04
1be9_A119 The Third Pdz Domain From The Synaptic Protein Psd- 5e-04
3i4w_A104 Crystal Structure Of The Third Pdz Domain Of Psd-95 5e-04
1zok_A93 Pdz1 Domain Of Synapse Associated Protein 97 Length 6e-04
2koh_A111 Nmr Structure Of Mouse Par3-Pdz3 In Complex With Ve 6e-04
3rl7_B107 Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc L 6e-04
2k1z_A104 Solution Structure Of Par-3 Pdz3 Length = 104 6e-04
1tp3_A119 Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv 6e-04
1rgr_A99 Cyclic Peptides Targeting Pdz Domains Of Psd-95: St 7e-04
1kef_A93 Pdz1 Of Sap90 Length = 93 7e-04
1iu0_A91 The First Pdz Domain Of Psd-95 Length = 91 7e-04
1x5n_A114 Solution Structure Of The Second Pdz Domain Of Harm 9e-04
>pdb|2DM8|A Chain A, Solution Structure Of The Eighth Pdz Domain Of Human Inad- Like Protein Length = 116 Back     alignment and structure

Iteration: 1

Score = 65.9 bits (159), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 28/52 (53%), Positives = 38/52 (73%) Query: 45 ILVHDIYPEGAAAKDARLKFGDQILELTGEDFRNITHAKAMAHLRLTPAKAK 96 I++H++Y EGAAA+D RL GDQILE+ G D RN +H +A+ LR TP K + Sbjct: 45 IVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNSSHEEAITALRQTPQKVR 96
>pdb|2OPG|A Chain A, The Crystal Structure Of The 10th Pdz Domain Of Mpdz Length = 98 Back     alignment and structure
>pdb|2QG1|A Chain A, Crystal Structure Of The 11th Pdz Domain Of Mpdz (Mupp1) Length = 92 Back     alignment and structure
>pdb|2QG1|A Chain A, Crystal Structure Of The 11th Pdz Domain Of Mpdz (Mupp1) Length = 92 Back     alignment and structure
>pdb|2FNE|A Chain A, The Crystal Structure Of The 13th Pdz Domain Of Mpdz Length = 117 Back     alignment and structure
>pdb|1Q7X|A Chain A, Solution Structure Of The Alternatively Spliced Pdz2 Domain (Pdz2b) Of Ptp-Bas (Hptp1e) Length = 108 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|2DAZ|A Chain A, Solution Structure Of The 7th Pdz Domain Of Inad-Like Protein Length = 124 Back     alignment and structure
>pdb|3PDZ|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Length = 96 Back     alignment and structure
>pdb|1GM1|A Chain A, Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 Back     alignment and structure
>pdb|1D5G|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Complexed With A Peptide Length = 96 Back     alignment and structure
>pdb|2ENO|A Chain A, Solution Structure Of The Pdz Domain From Human Synaptojanin 2 Binding Protein Length = 120 Back     alignment and structure
>pdb|2JIN|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 102 Back     alignment and structure
>pdb|1VJ6|A Chain A, Pdz2 From Ptp-Bl In Complex With The C-Terminal Ligand From The Apc Protein Length = 102 Back     alignment and structure
>pdb|1OZI|A Chain A, The Alternatively Spliced Pdz2 Domain Of Ptp-Bl Length = 99 Back     alignment and structure
>pdb|2JIK|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 101 Back     alignment and structure
>pdb|3R0H|A Chain A, Structure Of Inad Pdz45 In Complex With Ng2 Peptide Length = 206 Back     alignment and structure
>pdb|3GSL|A Chain A, Crystal Structure Of Psd-95 Tandem Pdz Domains 1 And 2 Length = 196 Back     alignment and structure
>pdb|2KA9|A Chain A, Solution Structure Of Psd-95 Pdz12 Complexed With Cypin Peptide Length = 189 Back     alignment and structure
>pdb|2DLU|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Inad- Like Protein Length = 111 Back     alignment and structure
>pdb|3ZRT|A Chain A, Crystal Structure Of Human Psd-95 Pdz1-2 Length = 199 Back     alignment and structure
>pdb|2KOJ|A Chain A, Solution Structure Of Mouse Par-3 Pdz2 (Residues 450-558) Length = 111 Back     alignment and structure
>pdb|2KOJ|A Chain A, Solution Structure Of Mouse Par-3 Pdz2 (Residues 450-558) Length = 111 Back     alignment and structure
>pdb|2OGP|A Chain A, Solution Structure Of The Second Pdz Domain Of Par-3 Length = 97 Back     alignment and structure
>pdb|2OGP|A Chain A, Solution Structure Of The Second Pdz Domain Of Par-3 Length = 97 Back     alignment and structure
>pdb|1UJU|A Chain A, Solution Structure Of The Fourth Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 111 Back     alignment and structure
>pdb|2Q9V|A Chain A, Crystal Structure Of The C890s Mutant Of The 4th Pdz Domain Of Human Membrane Associated Guanylate Kinase Length = 90 Back     alignment and structure
>pdb|1X6D|A Chain A, Solution Structures Of The Pdz Domain Of Human Interleukin- 16 Length = 119 Back     alignment and structure
>pdb|1WFV|A Chain A, Solution Structure Of The Fifth Pdz Domain Of Human Membrane Associated Guanylate Kinase Inverted-2 (Kiaa0705 Protein) Length = 103 Back     alignment and structure
>pdb|2KOM|A Chain A, Solution Structure Of Humar Par-3b Pdz2 (Residues 451-549) Length = 121 Back     alignment and structure
>pdb|2KOM|A Chain A, Solution Structure Of Humar Par-3b Pdz2 (Residues 451-549) Length = 121 Back     alignment and structure
>pdb|2WL7|A Chain A, Crystal Structure Of The Psd93 Pdz1 Domain Length = 102 Back     alignment and structure
>pdb|3K82|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 98 Back     alignment and structure
>pdb|2HE2|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of Human Discs Large Homologue 2, Dlg2 Length = 102 Back     alignment and structure
>pdb|1BE9|A Chain A, The Third Pdz Domain From The Synaptic Protein Psd-95 In Complex With A C-Terminal Peptide Derived From Cript. Length = 119 Back     alignment and structure
>pdb|3I4W|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 104 Back     alignment and structure
>pdb|1ZOK|A Chain A, Pdz1 Domain Of Synapse Associated Protein 97 Length = 93 Back     alignment and structure
>pdb|2KOH|A Chain A, Nmr Structure Of Mouse Par3-Pdz3 In Complex With Ve-Cadherin C-Terminus Length = 111 Back     alignment and structure
>pdb|3RL7|B Chain B, Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc Length = 107 Back     alignment and structure
>pdb|2K1Z|A Chain A, Solution Structure Of Par-3 Pdz3 Length = 104 Back     alignment and structure
>pdb|1TP3|A Chain A, Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv Peptide Ligand Length = 119 Back     alignment and structure
>pdb|1RGR|A Chain A, Cyclic Peptides Targeting Pdz Domains Of Psd-95: Structural Basis For Enhanced Affinity And Enzymatic Stability Length = 99 Back     alignment and structure
>pdb|1KEF|A Chain A, Pdz1 Of Sap90 Length = 93 Back     alignment and structure
>pdb|1IU0|A Chain A, The First Pdz Domain Of Psd-95 Length = 91 Back     alignment and structure
>pdb|1X5N|A Chain A, Solution Structure Of The Second Pdz Domain Of Harmonin Protein Length = 114 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 1e-20
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 7e-15
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 1e-18
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 9e-16
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 1e-18
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 3e-18
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 8e-18
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 1e-11
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-09
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 4e-07
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 1e-15
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 2e-10
2opg_A98 Multiple PDZ domain protein; structural protein, s 1e-14
2opg_A98 Multiple PDZ domain protein; structural protein, s 4e-10
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 1e-14
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 3e-10
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 3e-14
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 6e-10
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 3e-14
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 2e-09
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 2e-09
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 2e-08
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 4e-14
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 2e-10
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 6e-14
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 1e-09
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 8e-14
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 1e-09
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 9e-14
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 5e-10
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 9e-14
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 1e-09
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 1e-13
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 7e-10
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 1e-13
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 9e-10
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 1e-13
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 2e-09
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 1e-13
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 3e-10
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 2e-13
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 7e-10
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 2e-13
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 6e-10
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 2e-13
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 5e-10
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 2e-13
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 2e-09
2byg_A117 Channel associated protein of synapse-110; DLG2, P 2e-13
2byg_A117 Channel associated protein of synapse-110; DLG2, P 3e-10
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 2e-13
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 5e-11
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 3e-13
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 4e-09
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 4e-13
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 3e-11
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 4e-13
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 2e-09
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 4e-13
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 1e-09
2awx_A105 Synapse associated protein 97; membrane protein, s 4e-13
2awx_A105 Synapse associated protein 97; membrane protein, s 3e-09
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 4e-13
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 1e-09
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 5e-13
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 6e-11
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 5e-13
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 2e-09
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 5e-13
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 7e-10
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 5e-13
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 5e-10
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 6e-13
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 3e-09
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 6e-13
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 3e-12
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 2e-06
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 6e-13
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 3e-11
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 6e-13
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 1e-09
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 7e-13
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 2e-11
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 7e-13
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 1e-09
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 7e-13
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 2e-10
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 7e-13
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 5e-09
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 9e-13
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-09
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 9e-13
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 1e-09
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 9e-13
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 5e-10
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-12
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-09
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 1e-12
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 3e-09
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 1e-12
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 5e-12
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 1e-05
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 1e-12
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 4e-10
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 1e-12
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 5e-10
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 1e-12
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 5e-09
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-12
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 6e-10
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 2e-12
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 5e-09
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 2e-12
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 3e-12
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 1e-06
2fne_A117 Multiple PDZ domain protein; structural protein, s 2e-12
2fne_A117 Multiple PDZ domain protein; structural protein, s 2e-10
2djt_A104 Unnamed protein product; PDZ domain, structural ge 2e-12
2djt_A104 Unnamed protein product; PDZ domain, structural ge 9e-09
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 2e-12
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 1e-09
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 2e-12
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 4e-10
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 3e-12
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 9e-12
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 4e-07
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 3e-12
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 2e-11
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 3e-12
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 2e-09
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 9e-04
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 3e-12
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 2e-10
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 5e-06
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 3e-12
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 2e-11
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 5e-12
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 3e-10
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 6e-06
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 7e-12
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 2e-09
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 8e-12
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 2e-08
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 9e-12
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 7e-08
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 1e-11
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 2e-08
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 1e-11
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 2e-07
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 1e-11
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 4e-11
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 1e-11
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 2e-10
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 1e-11
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 5e-09
2o2t_A117 Multiple PDZ domain protein; structural protein, s 1e-11
2o2t_A117 Multiple PDZ domain protein; structural protein, s 2e-08
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 1e-11
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 2e-09
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 2e-11
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 4e-09
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 2e-11
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 8e-08
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 3e-11
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 3e-09
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 4e-11
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 4e-11
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 4e-11
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 6e-06
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 5e-11
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 1e-09
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 6e-11
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 4e-09
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 6e-11
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 2e-10
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 7e-11
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 4e-06
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 7e-11
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 1e-09
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 8e-11
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 6e-10
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 9e-11
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 5e-07
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 1e-10
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 1e-05
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 2e-10
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 2e-06
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 2e-10
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 7e-10
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 2e-10
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 3e-06
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 2e-10
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 1e-05
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 2e-10
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 1e-06
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 3e-10
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 3e-06
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 3e-10
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 1e-09
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 3e-10
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 1e-09
2eeh_A100 PDZ domain-containing protein 7; structural genomi 5e-10
2eeh_A100 PDZ domain-containing protein 7; structural genomi 4e-06
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 5e-10
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 5e-08
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 6e-10
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 2e-05
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 6e-10
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 2e-05
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 6e-10
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 6e-09
3k1r_A192 Harmonin; protein-protein complex, alternative spl 8e-10
3k1r_A192 Harmonin; protein-protein complex, alternative spl 3e-06
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 1e-09
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 4e-05
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 3e-09
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 3e-07
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 9e-09
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 3e-07
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 1e-08
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 7e-08
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 2e-08
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 3e-08
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 2e-08
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 5e-06
2eaq_A90 LIM domain only protein 7; conserved hypothetical 2e-08
2eaq_A90 LIM domain only protein 7; conserved hypothetical 2e-06
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 2e-08
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 6e-08
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 4e-08
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 4e-07
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 4e-08
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 3e-07
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 4e-08
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 9e-08
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 8e-08
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 6e-05
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 9e-08
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 2e-05
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 2e-07
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 5e-05
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 2e-07
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 7e-06
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 2e-07
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 5e-05
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 3e-07
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 5e-05
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 3e-07
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 3e-06
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 3e-07
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 6e-06
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 3e-07
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 2e-06
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 4e-07
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 8e-05
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 6e-07
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 4e-05
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 6e-07
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 2e-05
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 6e-07
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 5e-05
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 6e-07
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 7e-07
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 1e-06
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 8e-05
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 1e-06
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 3e-06
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 1e-06
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 7e-05
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 1e-06
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 5e-05
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 2e-06
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 1e-05
2eei_A106 PDZ domain-containing protein 1; regulatory factor 2e-06
2eei_A106 PDZ domain-containing protein 1; regulatory factor 5e-06
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 2e-06
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 7e-06
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 2e-06
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 2e-05
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 3e-06
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 2e-05
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 5e-06
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 7e-06
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 5e-06
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 5e-06
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 1e-05
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 7e-06
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 8e-06
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 1e-05
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 2e-05
2d90_A102 PDZ domain containing protein 1; structural genomi 1e-05
2d90_A102 PDZ domain containing protein 1; structural genomi 1e-04
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 1e-05
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 1e-04
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 2e-05
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 2e-05
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 4e-05
2v90_A96 PDZ domain-containing protein 3; membrane, protein 3e-05
2v90_A96 PDZ domain-containing protein 3; membrane, protein 4e-05
3khf_A99 Microtubule-associated serine/threonine-protein ki 3e-05
3khf_A99 Microtubule-associated serine/threonine-protein ki 1e-04
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 3e-05
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 1e-04
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 5e-05
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 2e-04
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 7e-05
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 1e-04
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 9e-05
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 7e-04
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 1e-04
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 6e-04
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 1e-04
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 4e-04
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 1e-04
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 1e-04
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 2e-04
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 2e-04
2ego_A96 General receptor for phosphoinositides 1- associat 2e-04
2ego_A96 General receptor for phosphoinositides 1- associat 6e-04
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 3e-04
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
 Score = 83.3 bits (206), Expect = 1e-20
 Identities = 35/137 (25%), Positives = 48/137 (35%), Gaps = 48/137 (35%)

Query: 4   VPGGIAATDGRLLKGDQIMSVDGTDVRDKSQEEVATIMK--------------------- 42
           +PGG AA DGRL   D I+ V+  DVR+ +       +K                     
Sbjct: 43  IPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVM 102

Query: 43  ---------------------------GGILVHDIYPEGAAAKDARLKFGDQILELTGED 75
                                        I V  I   GAA KD RL+ GD+IL +    
Sbjct: 103 EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVG 162

Query: 76  FRNITHAKAMAHLRLTP 92
             ++ H  A+A L+ T 
Sbjct: 163 LEDVMHEDAVAALKNTY 179


>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.89
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.88
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.87
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.78
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.78
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.77
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 99.7
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.7
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.69
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 99.63
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.62
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.62
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 99.61
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.54
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.54
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.5
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.48
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.46
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.44
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 99.43
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.41
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.41
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.41
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.4
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.39
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.38
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.38
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.37
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.37
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.37
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.36
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.36
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.36
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.36
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.36
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.36
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.36
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.35
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.35
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.35
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.34
2awx_A105 Synapse associated protein 97; membrane protein, s 99.34
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.34
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.34
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.34
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.34
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.34
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.34
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.33
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.33
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.33
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.33
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.33
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.33
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.33
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.33
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.33
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.33
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.32
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.32
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.32
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.32
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.32
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.31
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.31
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.31
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.31
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.31
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.31
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.31
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.3
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.3
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.3
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.3
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.3
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.3
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.3
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.3
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.3
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.3
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.3
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.3
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.29
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.29
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.29
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.29
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.28
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.28
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.28
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.28
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.28
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.28
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.28
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.28
2ego_A96 General receptor for phosphoinositides 1- associat 99.27
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.27
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 99.27
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.27
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.27
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.27
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.27
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.27
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.27
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.26
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.26
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.26
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.26
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.26
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.26
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.26
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.26
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.26
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.26
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.25
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 99.25
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.25
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.25
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.24
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.24
2d90_A102 PDZ domain containing protein 1; structural genomi 99.24
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.24
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.23
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.23
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.23
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.23
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.23
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.23
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.23
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.22
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.22
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.22
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.22
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.22
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.22
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.22
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.21
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 99.2
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.2
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.2
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.19
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 99.19
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.19
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.18
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.17
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.17
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.17
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.17
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.17
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.17
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.16
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.16
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.16
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.14
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.14
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.13
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.13
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.12
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.12
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.11
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.11
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 99.11
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 99.11
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 99.1
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.09
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 99.08
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.08
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 99.08
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 99.07
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 99.07
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 99.07
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 99.06
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.05
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 99.04
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 99.04
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.03
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 99.03
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.59
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 99.02
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 99.01
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.99
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.97
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.95
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 98.94
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 98.92
2kl1_A94 YLBL protein; structure genomics, structural genom 98.88
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.88
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 98.87
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.87
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 98.86
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.85
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 98.85
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 98.84
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 98.84
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.84
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 98.83
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 98.83
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 98.83
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 98.83
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 98.82
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 98.82
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 98.81
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 98.81
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 98.81
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 98.81
4amh_A106 Disks large homolog 1; permutation, protein foldin 98.8
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 98.8
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 98.8
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.8
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.79
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.79
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 98.78
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 98.78
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 98.78
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 98.78
2byg_A117 Channel associated protein of synapse-110; DLG2, P 98.78
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 98.78
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 98.78
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 98.77
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 98.77
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 98.77
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 98.77
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 98.77
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 98.77
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 98.77
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 98.76
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 98.76
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 98.76
2djt_A104 Unnamed protein product; PDZ domain, structural ge 98.76
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 98.76
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 98.76
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 98.76
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 98.76
2opg_A98 Multiple PDZ domain protein; structural protein, s 98.75
2ego_A96 General receptor for phosphoinositides 1- associat 98.75
2fne_A117 Multiple PDZ domain protein; structural protein, s 98.75
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 98.75
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.75
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 98.75
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 98.75
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 98.75
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 98.75
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 98.75
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 98.73
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 98.73
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 98.73
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 98.73
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 98.73
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 98.73
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 98.73
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 98.73
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 98.73
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 98.73
2awx_A105 Synapse associated protein 97; membrane protein, s 98.73
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 98.72
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 98.72
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 98.72
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 98.72
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 98.72
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 98.72
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 98.72
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 98.72
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.71
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 98.71
2o2t_A117 Multiple PDZ domain protein; structural protein, s 98.71
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 98.71
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 98.71
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 98.71
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 98.71
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 98.71
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 98.71
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 98.71
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 98.7
2v90_A96 PDZ domain-containing protein 3; membrane, protein 98.7
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 98.7
3khf_A99 Microtubule-associated serine/threonine-protein ki 98.7
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 98.7
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 98.7
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 98.69
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 98.69
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 98.69
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.69
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 98.69
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 98.69
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 98.68
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 98.68
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 98.68
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 98.68
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 98.67
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.67
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 98.67
2eei_A106 PDZ domain-containing protein 1; regulatory factor 98.67
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 98.66
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 98.66
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 98.66
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.65
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 98.65
2d90_A102 PDZ domain containing protein 1; structural genomi 98.65
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.65
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 98.64
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.64
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.64
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 98.64
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.63
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.63
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 98.63
2eeh_A100 PDZ domain-containing protein 7; structural genomi 98.63
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.63
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 98.62
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 98.61
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 98.61
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 98.6
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 98.6
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 98.6
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 98.6
2eaq_A90 LIM domain only protein 7; conserved hypothetical 98.6
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 98.6
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 98.6
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 98.6
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.59
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 98.59
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 98.59
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 98.59
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 98.58
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 98.58
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 98.57
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.56
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 98.55
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.55
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 98.54
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 98.53
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 98.52
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 98.52
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 98.5
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 98.49
3k1r_A192 Harmonin; protein-protein complex, alternative spl 98.48
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.47
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 98.47
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 98.46
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.46
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.46
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 98.45
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 98.42
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 97.78
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.41
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 98.4
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.39
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.39
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 98.34
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.33
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.29
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 98.28
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 98.28
3k50_A 403 Putative S41 protease; structural genomics, joint 98.27
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.24
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.23
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.22
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 98.22
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.12
2kl1_A94 YLBL protein; structure genomics, structural genom 98.11
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.05
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.02
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.0
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 97.93
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 97.93
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 97.91
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 97.84
1k32_A 1045 Tricorn protease; protein degradation, substrate g 97.77
3k50_A 403 Putative S41 protease; structural genomics, joint 97.56
2hga_A125 Conserved protein MTH1368; GFT structural genomics 97.56
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 97.53
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 97.46
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 97.46
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 97.45
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 97.18
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.15
4fgm_A597 Aminopeptidase N family protein; structural genomi 97.09
1k32_A 1045 Tricorn protease; protein degradation, substrate g 95.46
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 94.09
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
Probab=99.89  E-value=7.8e-22  Score=172.93  Aligned_cols=172  Identities=30%  Similarity=0.484  Sum_probs=118.8

Q ss_pred             ccCCCChhhhcCCCCCCCEEEEECCeeCCCCCHHHHHHHhhC--------------------------------------
Q psy1521           2 RAVPGGIAATDGRLLKGDQIMSVDGTDVRDKSQEEVATIMKG--------------------------------------   43 (175)
Q Consensus         2 ~v~~~~~A~~~G~L~~GD~Il~Vng~~v~~~~~~~~~~~l~~--------------------------------------   43 (175)
                      +|.|||||+++|+|+.||+|++|||+++.+++|.+++.+++.                                      
T Consensus        95 ~v~~gspA~~aG~L~~GD~Il~Vng~~v~~~~~~~~~~~l~~~g~~v~l~v~R~~~~~~~~~~v~l~k~~~~lG~~i~~~  174 (721)
T 2xkx_A           95 KIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGG  174 (721)
T ss_pred             EeCCCCHHHhcCCCCCCCEEEEECCEECCCCCHHHHHHHhhccccccceEEEecccccccceeeeeeeecCCCceeeccC
Confidence            578999999999999999999999999999999988877741                                      


Q ss_pred             ----------CeEEEEecCCCcccccCCcCCCCEEEEECCeecCCCCHHHHHHHHHcCCCCCCCCCCCC---------CC
Q psy1521          44 ----------GILVHDIYPEGAAAKDARLKFGDQILELTGEDFRNITHAKAMAHLRLTPAKAKPCPTVP---------SE  104 (175)
Q Consensus        44 ----------gi~V~~v~~gg~A~~~G~L~~GD~Il~VNG~~l~~~~~~~a~~~lk~~~~~~~~~~~~~---------~~  104 (175)
                                |++|..|.++|+|+++|+|++||+|++|||+++.+++|.+++.++++.+..+++.....         ..
T Consensus       175 ~~~~~~~~~~gv~V~~V~~gs~A~~aG~L~~GD~Il~Vng~~v~~~~~~~~~~~l~~~~~~v~l~V~R~g~~~~~~~~~~  254 (721)
T 2xkx_A          175 VGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAP  254 (721)
T ss_pred             CCccccCCCCceEEEEeCCCCchhhcCCCCCCCEEEEECCeeCCCCCHHHHHHHHHcCCCeEEEEEEeCCcccccCCCCC
Confidence                      46899999999999999999999999999999999999999999998776543211100         00


Q ss_pred             CCCCCCCCC--c---cc-ce--eeeeeeeeec---ccCC-----C-CCCCCCceEEEEEEeCCCCCcCEEEEcCcCCCce
Q psy1521         105 PNANATTGE--K---TT-FY--FHFQVKLVVL---RDTV-----T-KEDDLLEFVDVELTKKAGKGFGLSLVGRKQGPGV  167 (175)
Q Consensus       105 ~~~~~~~~~--~---~~-~~--~~~~v~l~v~---r~~~-----~-~~~~~~~~~~v~l~k~~~~~lGfsi~gg~~~~gi  167 (175)
                      |....+...  .   ++ .+  ..+...+...   +..+     . ........+.|+|.+. ..+|||++.++....|+
T Consensus       255 p~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~v~l~~~-~~~lG~~i~~~~~~~gv  333 (721)
T 2xkx_A          255 PDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRG-STGLGFNIVGGEDGEGI  333 (721)
T ss_pred             CCcccCCCCCcccccCCcccccccccccCCCCCCcccCCcccccccccccccceEEEEEEEC-CCCccEEEeccCCCCCe
Confidence            110000000  0   00 00  0000000000   0000     0 0011224688888864 47899999988777899


Q ss_pred             EEEeccC
Q psy1521         168 FISDLVS  174 (175)
Q Consensus       168 ~I~~i~~  174 (175)
                      ||..|.|
T Consensus       334 ~V~~V~~  340 (721)
T 2xkx_A          334 FISFILA  340 (721)
T ss_pred             EEEEeCC
Confidence            9999976



>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 175
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-10
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-07
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 8e-09
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 3e-07
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 9e-09
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 2e-08
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 1e-08
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 2e-07
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 1e-08
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 2e-07
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 1e-08
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 5e-07
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 3e-08
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 2e-07
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 4e-08
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 2e-04
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 5e-08
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 1e-06
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 6e-08
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 9e-08
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 7e-08
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 7e-06
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 1e-07
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 8e-06
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-07
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 3e-07
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 1e-07
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 8e-07
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 1e-07
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 1e-05
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 0.001
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 1e-07
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 2e-07
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 1e-07
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 4e-07
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 2e-07
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 1e-05
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 2e-07
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 1e-04
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 2e-07
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 3e-06
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 2e-07
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 7e-07
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 2e-07
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 2e-05
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 3e-07
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 3e-06
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 3e-07
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 2e-06
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 4e-07
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 1e-06
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 4e-07
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 7e-06
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 4e-07
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 8e-05
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 5e-07
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 9e-05
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 5e-07
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 9e-07
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 6e-07
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 4e-05
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 7e-07
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 3e-05
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 8e-07
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 3e-05
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 8e-07
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 8e-05
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 9e-07
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 8e-05
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-06
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-05
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 1e-06
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 4e-06
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 1e-06
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 6e-06
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 2e-06
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 1e-05
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 2e-06
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 4e-06
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 2e-06
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 2e-05
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 2e-06
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 3e-04
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 3e-06
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 3e-05
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 4e-06
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 2e-05
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 5e-06
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 1e-04
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 6e-04
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 5e-06
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 0.001
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 6e-06
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 2e-05
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 6e-06
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-05
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 7e-06
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 0.004
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 1e-05
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 3e-04
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 0.002
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 2e-05
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 0.002
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 2e-05
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 3e-05
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 3e-05
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 6e-04
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 0.004
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 3e-05
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 0.001
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 4e-05
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 2e-04
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 4e-05
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 4e-04
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 0.002
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 4e-05
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 1e-04
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 5e-05
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 0.001
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 7e-05
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 2e-04
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 3e-04
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 0.004
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 54.2 bits (130), Expect = 1e-10
 Identities = 17/79 (21%), Positives = 32/79 (40%), Gaps = 9/79 (11%)

Query: 42  KGGILVHDIYPEGAAAKDARLKFGDQILELTGEDFRNITHAKAMAHLR---------LTP 92
              + V  + P+G AA+D +++ GD I+ +        THA  +   +         L  
Sbjct: 43  DEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVVKLFQSVPIGQSVNLVL 102

Query: 93  AKAKPCPTVPSEPNANATT 111
            +  P P  P +P  +  +
Sbjct: 103 CRGYPLPFDPEDPANSGPS 121


>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.66
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.65
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.65
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.64
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.64
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.64
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.62
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.61
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.6
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.6
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.58
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.58
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.57
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.57
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.57
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.57
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.56
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.56
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.56
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.56
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.55
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.55
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.54
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.54
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.54
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.54
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.54
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.53
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.52
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.52
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.52
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.52
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.51
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.5
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.5
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.5
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.5
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.48
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.48
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.47
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.47
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.46
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.46
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.46
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.45
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.45
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.44
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.44
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.43
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.42
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.42
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.42
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.39
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.36
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.28
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.24
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.22
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.21
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.21
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.2
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.2
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.19
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.18
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.17
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 99.17
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.17
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.16
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.15
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.15
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.13
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.13
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.12
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.12
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.12
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.12
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.12
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.12
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 99.12
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.12
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 99.11
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.1
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.1
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 99.1
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.09
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.09
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.09
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.09
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.08
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.07
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.07
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.07
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.06
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.06
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.06
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.06
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.06
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.05
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.04
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.04
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.04
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.03
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.03
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.03
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.03
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.02
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.02
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 99.02
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.01
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.01
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.99
d1fc6a392 Photosystem II D1 C-terminal processing protease { 98.99
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 98.98
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 98.96
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.95
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.93
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 98.9
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.9
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 98.9
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 98.88
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 98.86
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.77
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 98.74
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 98.71
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.64
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.46
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.38
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.21
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.21
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.13
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.09
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 97.95
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 97.81
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Synapse-associated protein 102
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.66  E-value=1.1e-16  Score=104.34  Aligned_cols=52  Identities=33%  Similarity=0.592  Sum_probs=50.0

Q ss_pred             CCeEEEEecCCCcccccCCcCCCCEEEEECCeecCCCCHHHHHHHHHcCCCC
Q psy1521          43 GGILVHDIYPEGAAAKDARLKFGDQILELTGEDFRNITHAKAMAHLRLTPAK   94 (175)
Q Consensus        43 ~gi~V~~v~~gg~A~~~G~L~~GD~Il~VNG~~l~~~~~~~a~~~lk~~~~~   94 (175)
                      .++||++|.++|||+++|+|++||+|++|||+++.+++|++++++||++++.
T Consensus        31 ~gi~I~~v~~gg~A~~~G~L~~GD~Il~VNg~~v~~~~~~e~~~~lk~~~~~   82 (92)
T d2fe5a1          31 NSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDM   82 (92)
T ss_dssp             CCEEEEEECTTSHHHHHCCCCTTCEEEEETTEECTTCBHHHHHHHHHTCCSE
T ss_pred             CCEEEEEECCCCChhhcCCCCCCCEEEEeCCeecCCCCHHHHHHHHHcCCCE
Confidence            4899999999999999999999999999999999999999999999998777



>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure